NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F105013

Metagenome / Metatranscriptome Family F105013

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105013
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 53 residues
Representative Sequence MGFLDNYEASRERLERWLATYPNGRIETRIVEFSAEKGYVLVEAKAFRND
Number of Associated Samples 84
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 94.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 93.00 %
Associated GOLD sequencing projects 79
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (92.000 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(22.000 % of family members)
Environment Ontology (ENVO) Unclassified
(54.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(47.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 23.08%    β-sheet: 24.36%    Coil/Unstructured: 52.56%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF05257CHAP 7.00
PF13539Peptidase_M15_4 6.00
PF05065Phage_capsid 1.00
PF03406Phage_fiber_2 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG4653Predicted phage phi-C31 gp36 major capsid-like proteinMobilome: prophages, transposons [X] 1.00


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.00 %
UnclassifiedrootN/A4.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000525|JGI1221J11331_1086547All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage531Open in IMG/M
3300002408|B570J29032_109510487All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage823Open in IMG/M
3300003393|JGI25909J50240_1060292All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage776Open in IMG/M
3300004126|Ga0066179_10227609All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage528Open in IMG/M
3300004460|Ga0066222_1175524All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300004460|Ga0066222_1184893All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage748Open in IMG/M
3300005581|Ga0049081_10319434All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage532Open in IMG/M
3300006037|Ga0075465_10011433All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1666Open in IMG/M
3300006641|Ga0075471_10612389All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage534Open in IMG/M
3300006805|Ga0075464_10197280All Organisms → Viruses → Predicted Viral1194Open in IMG/M
3300006805|Ga0075464_10400420All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage834Open in IMG/M
3300006805|Ga0075464_10566615All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia698Open in IMG/M
3300006920|Ga0070748_1074155All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1321Open in IMG/M
3300006920|Ga0070748_1275691All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage601Open in IMG/M
3300007520|Ga0105054_11004111All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage580Open in IMG/M
3300007523|Ga0105052_10903247All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage552Open in IMG/M
3300008107|Ga0114340_1005963All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage11881Open in IMG/M
3300008267|Ga0114364_1048574All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1536Open in IMG/M
3300008448|Ga0114876_1093188All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1218Open in IMG/M
3300008450|Ga0114880_1195028All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage684Open in IMG/M
3300009085|Ga0105103_10358290All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage803Open in IMG/M
3300009085|Ga0105103_10432796All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage731Open in IMG/M
3300009163|Ga0114970_10108222All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1713Open in IMG/M
3300009164|Ga0114975_10719106All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage527Open in IMG/M
3300009169|Ga0105097_10270574All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage937Open in IMG/M
3300009169|Ga0105097_10837692All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage526Open in IMG/M
3300009180|Ga0114979_10333220All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage897Open in IMG/M
3300009180|Ga0114979_10545684All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage666Open in IMG/M
3300009184|Ga0114976_10602882All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage557Open in IMG/M
3300009185|Ga0114971_10574876All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage625Open in IMG/M
3300010368|Ga0129324_10405298All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage526Open in IMG/M
3300012757|Ga0157628_1196422All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1605Open in IMG/M
3300013004|Ga0164293_10035180Not Available4134Open in IMG/M
3300013014|Ga0164295_10037567All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3672Open in IMG/M
3300013372|Ga0177922_10202518All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage502Open in IMG/M
3300017761|Ga0181356_1225231All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage544Open in IMG/M
3300017766|Ga0181343_1188489All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage567Open in IMG/M
3300017774|Ga0181358_1264728All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage535Open in IMG/M
3300017778|Ga0181349_1034287Not Available2033Open in IMG/M
3300017780|Ga0181346_1314508All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage528Open in IMG/M
3300017785|Ga0181355_1002370All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8376Open in IMG/M
3300017785|Ga0181355_1051469All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1749Open in IMG/M
3300019784|Ga0181359_1084027All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1188Open in IMG/M
3300019784|Ga0181359_1087775Not Available1157Open in IMG/M
3300019784|Ga0181359_1244851All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage548Open in IMG/M
3300020205|Ga0211731_11006608All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1900Open in IMG/M
3300020505|Ga0208088_1018525All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage921Open in IMG/M
3300020553|Ga0208855_1041715All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage613Open in IMG/M
3300021963|Ga0222712_10650400All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage601Open in IMG/M
3300022190|Ga0181354_1067030All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1192Open in IMG/M
3300022222|Ga0226658_10327356All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage689Open in IMG/M
3300024346|Ga0244775_11360586All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage547Open in IMG/M
3300025451|Ga0208426_1028178All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage851Open in IMG/M
3300027707|Ga0209443_1231191All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage638Open in IMG/M
3300027720|Ga0209617_10077569All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1361Open in IMG/M
3300027732|Ga0209442_1144287All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage922Open in IMG/M
3300027734|Ga0209087_1031874All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2514Open in IMG/M
3300027746|Ga0209597_1318253All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage591Open in IMG/M
3300027763|Ga0209088_10363962All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage568Open in IMG/M
3300027808|Ga0209354_10441145All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage502Open in IMG/M
3300027848|Ga0209390_10522241All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage778Open in IMG/M
3300027900|Ga0209253_11150851All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage524Open in IMG/M
3300027976|Ga0209702_10287538All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage672Open in IMG/M
3300027976|Ga0209702_10322228All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage625Open in IMG/M
(restricted) 3300029268|Ga0247842_10354648All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage772Open in IMG/M
3300031746|Ga0315293_11169916All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage536Open in IMG/M
3300031772|Ga0315288_10285826Not Available1732Open in IMG/M
3300031787|Ga0315900_10951567All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage570Open in IMG/M
3300031834|Ga0315290_11592646All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage528Open in IMG/M
3300031873|Ga0315297_10915903All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage728Open in IMG/M
3300031951|Ga0315904_10923950All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage701Open in IMG/M
3300031952|Ga0315294_11464436All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage536Open in IMG/M
3300032046|Ga0315289_11380868All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage548Open in IMG/M
3300032116|Ga0315903_10938049All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage614Open in IMG/M
3300032118|Ga0315277_11820837All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage505Open in IMG/M
3300032143|Ga0315292_10489960All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1035Open in IMG/M
3300032256|Ga0315271_11115117All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage682Open in IMG/M
3300032342|Ga0315286_11635356All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage612Open in IMG/M
3300032401|Ga0315275_11916785All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage626Open in IMG/M
3300032462|Ga0335396_10801122All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage567Open in IMG/M
3300032462|Ga0335396_10958175All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage501Open in IMG/M
3300032516|Ga0315273_11576384All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage803Open in IMG/M
3300033994|Ga0334996_0551213All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage505Open in IMG/M
3300033996|Ga0334979_0012506All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5810Open in IMG/M
3300034050|Ga0335023_0577419All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage573Open in IMG/M
3300034068|Ga0334990_0516051All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage635Open in IMG/M
3300034093|Ga0335012_0253392All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage911Open in IMG/M
3300034093|Ga0335012_0543687All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage545Open in IMG/M
3300034093|Ga0335012_0579127All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage522Open in IMG/M
3300034095|Ga0335022_0618633All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage545Open in IMG/M
3300034101|Ga0335027_0397256All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage896Open in IMG/M
3300034105|Ga0335035_0346484All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage860Open in IMG/M
3300034105|Ga0335035_0535103All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage634Open in IMG/M
3300034111|Ga0335063_0358879All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage751Open in IMG/M
3300034118|Ga0335053_0202482All Organisms → Viruses → Predicted Viral1304Open in IMG/M
3300034120|Ga0335056_0643289All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage543Open in IMG/M
3300034200|Ga0335065_0414403All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage824Open in IMG/M
3300034200|Ga0335065_0716273All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage570Open in IMG/M
3300034283|Ga0335007_0615670All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage625Open in IMG/M
3300034356|Ga0335048_0401599All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage680Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater22.00%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake16.00%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment12.00%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake9.00%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous8.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater7.00%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment4.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater3.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater3.00%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton2.00%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.00%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine2.00%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment1.00%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.00%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.00%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat1.00%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.00%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.00%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.00%
HypersalineEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline1.00%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000525Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micronEnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300003393Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DDEnvironmentalOpen in IMG/M
3300004126Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2)EnvironmentalOpen in IMG/M
3300004460Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300006037Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNAEnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007520Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (megahit assembly)EnvironmentalOpen in IMG/M
3300007523Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03EnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008267Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTREnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009164Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaGEnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009180Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaGEnvironmentalOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300009185Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaGEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300012757Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES161 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013014Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaGEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020505Freshwater microbial communities from Lake Mendota, WI - 02APR2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020553Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022222Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 (v2)EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025451Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027707Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027732Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027734Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027746Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027763Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027848Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-01 (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300027976Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes)EnvironmentalOpen in IMG/M
3300029268 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_19mEnvironmentalOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300032046Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300032118Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032462Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly)EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033994Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034050Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095EnvironmentalOpen in IMG/M
3300034068Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031EnvironmentalOpen in IMG/M
3300034093Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072EnvironmentalOpen in IMG/M
3300034095Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034105Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127EnvironmentalOpen in IMG/M
3300034111Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186EnvironmentalOpen in IMG/M
3300034118Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165EnvironmentalOpen in IMG/M
3300034120Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172EnvironmentalOpen in IMG/M
3300034200Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M
3300034356Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI1221J11331_108654723300000525HypersalineMNIKEDYEGNRDRNDRWWRTHPTGRIETEIVEFNAEKGYVLVKAIAYR
B570J29032_10951048713300002408FreshwaterMGFLDNYEASRERLERWIKTYPTGRIETRIVEFSAEKGYVLVEAKAFRNDTEVNPAG
JGI25909J50240_106029213300003393Freshwater LakeMGFLDNYEASRERLERWLSSYPLGRIETRIVEFSAEKGYVLVEAKAFRNYDD
Ga0066179_1022760913300004126Freshwater LakeMGFLDGYEASLARLTRWNTTYPTGRIETRIVEFSAEKGYVLVEAQAF
Ga0066222_117552433300004460MarineMGFLDNYEASRERLERWNRTYPLGRIETRIVEFSAEKGYVLVEAKAFRNQEDILPAGVDYAYGY
Ga0066222_118489333300004460MarineMGFLDNYEASRERLERWNRTYPLGRIETRIVEFSAEKGYVLVEAKAFRNHDDVLPAGIDYAYGY
Ga0049081_1031943433300005581Freshwater LenticMGFLDNYEASRERLERWLKTYPLGRIETSIVEFSA
Ga0075465_1001143363300006037AqueousMGFLDNYEAARARTDRWIKTYPTGRIETRVMEFDAEKGYVLVKAE
Ga0075471_1061238933300006641AqueousMGFLDNYEAARARTDRWLATYPTGRIETEIMEFSAEKGYVLVKAT
Ga0075464_1019728013300006805AqueousASRERLERWIRTYPTGRIETRVMEFDAEKGYVLVKAEAYRNDTDQHPAGIDYAYGYQGAYVQNMKR*
Ga0075464_1040042033300006805AqueousMGFLDNYEASRERLERWNRTYPTGRIETSIVEFSADKGYVLVEAKAFRHEDDSRPAGVDYAYGYQGAYQ
Ga0075464_1056661513300006805AqueousMGFLDNYEAARARTDRWIKTYPTGRIETRVMEFDAEKGYVLVKAEAYRNDTDQHPAG
Ga0070748_107415513300006920AqueousMGFLDNYEASRERLERWIRTYPTGRIETRVVEFDAEKGYVLVKAEAYRNDTDQHPAGI
Ga0070748_127569123300006920AqueousMGFLDNYEAARARTDRWIATNPTGRIETEIVEFSAEKGY
Ga0105054_1100411113300007520FreshwaterMSFLDNYEASRDRNDRWWRTYPSGRIESEIVEFNAEKGYVLVKATAYRERIDL
Ga0105052_1090324723300007523FreshwaterMNIKEDYEGNRDRNDRWWRTHPTGRIETEIVEFNA
Ga0114340_100596313300008107Freshwater, PlanktonMGFLDNYEASRERLERWIKTYPTGRIETRIVEFSAEKGYVLVEAKAFRNHDDVLAAGVDY
Ga0114364_104857413300008267Freshwater, PlanktonMGFLDNYEASRERLERWIRTYPTGRIETRVMEFDAEKGYVLVKAEAYRNDTDQ
Ga0114876_109318813300008448Freshwater LakeMGFLDNYEASRERLERWLASYPTGRIETRIVEFSAEKGYVLVEAKAYRKQTDEQPAGIDY
Ga0114880_119502813300008450Freshwater LakeMGFLDNYEASRERLERWLKTFPNGRIETRIVEFSAEKGYVL
Ga0105103_1035829013300009085Freshwater SedimentMGFLDNYEASRERLERWLATYPLGCIETRIVEFSAEKGYVLVEAKAFRNDTDVNPAGIDYAYG
Ga0105103_1043279633300009085Freshwater SedimentMGFLDNYEASRERLERWIKTYPTGRIETRIVEFSAEKGFVLVEAKAFRNQEGTVPAGIDFGYGYQGAYQPNM
Ga0114970_1010822213300009163Freshwater LakeMGFLDGYEAARARTDRWLATFPAGRIETRIVQFDAEK
Ga0114975_1071910613300009164Freshwater LakeMGFLDNYEASRERLERWLATYPNGRIETRIVEFNAEKGYVLVEAR
Ga0105097_1027057413300009169Freshwater SedimentMGFLDNYEASRERLDRWNRTFPDGRIETRIVEFSAEKGYVLVEAKAFKNSESLVPAGIDYAYGYQG
Ga0105097_1083769223300009169Freshwater SedimentMGFLDNYEASRERLERWNRTFPDGRIETRIVEFSAEKAYILVEAKAFKNSEMLTPAGIDFAYGYQG
Ga0114979_1033322013300009180Freshwater LakeMGFLDNYEASRERLERWNRTFPLGRIETRIVEFSAEKGYVLVEAKAFRNYDD
Ga0114979_1054568413300009180Freshwater LakeMGFLDNYEASRERLERWNRTYPTGRIETRIVEFSAEKG
Ga0114976_1060288213300009184Freshwater LakeMGFLDGYEAARARTDRWILTHPTGRIETEIMEFNAEKGYVLVKA
Ga0114971_1057487633300009185Freshwater LakeMGFLDGYEAARARTDRWLATYPSGRIETRIVQFDAEKGFVLVEARAFR
Ga0129324_1040529813300010368Freshwater To Marine Saline GradientMGFLDNYEAARARTDRWLATYPTGRIETEIMEFSAEKGYVLVKATGYRNADD
Ga0157628_119642253300012757FreshwaterMGFLDNYEASRERLERWLATYATGRIETRIVEFSAEKGYVLVE
Ga0164293_10035180103300013004FreshwaterMGFLDNYEASRERLERWLATYPNGRIETRIVEFSAEKGYVLVEARAYRDNDM
Ga0164295_1003756713300013014FreshwaterMGFLDNYEASRERLERWLATYPTGRIETRIVEFSAEKGYVL
Ga0177922_1020251823300013372FreshwaterMGFLDNYEASLARLTRWNTTYPLGRIETRIVEFSADKGYILVEAKAYRHYDDIVPAGTDFAYGYVSAYQPNMK
Ga0181356_122523123300017761Freshwater LakeMGFLDNYEPSRERLERWLATYPTGRIETRIVEFNAEKGYVLVEAKAYRTQDDEQPAGI
Ga0181343_118848923300017766Freshwater LakeMGFLDNYEASRERLERWNRTFPTGRIETRIVEFSAEKGYVLVEAKAFRNQEDTQPAGIDYAYGY
Ga0181358_126472833300017774Freshwater LakeMGFLDGYEAARARTDRWIATYPTGKIHAEIVEFNAEKGYVLVKAIAYRNADD
Ga0181349_103428713300017778Freshwater LakeMGFLDNYEASRARLERWWLTYPNGRIETRIVEFSAEKGFALIEAKAFRNAEDLLPAGID
Ga0181346_131450813300017780Freshwater LakeMGFLDGYEASLERLTRWNTTYPLGRIETRIVEFSAEKGYVLVEAKAYRHYD
Ga0181355_1002370153300017785Freshwater LakeMGFLDNYEASRERLERWLSSYPLGRIETRIVEFSAEKGYVLVEAKAFRNYDDVLPAGIDYAHGYVGAYQQNM
Ga0181355_105146913300017785Freshwater LakeMGFLDNYEASRERLERWLAMYPTGRIETRIVEFSAEKGYVLVEAKAYRKQPDEHPAGIDY
Ga0181359_108402733300019784Freshwater LakeMGFLDNYEASRERLERWLAMYPTGRIETRIVEFSAEKGYVLVV
Ga0181359_108777513300019784Freshwater LakeMGFLDGYEASLARLTRWNTTYPTGRIETRIVEFSAEKGYVLVEAQAFRHYDDLLPAGIDFAYG
Ga0181359_124485113300019784Freshwater LakeMGFLDNYEASRARLERWWLTYPNGRIETRIVEFSAEKG
Ga0211731_1100660813300020205FreshwaterMGFLDNYEASRERLERWNRTYPLGRIETSIVEFSADKGYVLVEAKAFRNEDDTRPAGIDYAY
Ga0208088_101852513300020505FreshwaterMGFLDNYEASRERLERWIKTYPTGRIETRIVEFSAEKGYVLVEAKAFRNDT
Ga0208855_104171533300020553FreshwaterMGFLDNYEASRERLERWLATYPNGRIETRIVEFSAEKGYVLVEAKAFRND
Ga0222712_1065040013300021963Estuarine WaterMGFLDGYEAARARTDRWLATFPNGRIETCIVQFDAEKGFVLVEAKAF
Ga0181354_106703013300022190Freshwater LakeMGFLDGYEAARARTDRWIATYPTGKIHAEIVEFNAEKGYVLVKAIAYRNADYI
Ga0226658_1032735633300022222Freshwater Microbial MatMSFLDNYEASRDRNDRWWRTYPSGRIETEIVEFNAEKGYVLVKATAYRERI
Ga0244775_1136058633300024346EstuarineMGFLDNYEAARARTDRWIKTYPTGRIETRVMEFDAEKGYVLVKAEAYRNDTDQHPAGID
Ga0208426_102817813300025451AqueousMGFLDNYEASRERLERWLSSFPLGRIETRIVEFSAEKGYVLVEAKAFRNYDD
Ga0209443_123119113300027707Freshwater LakeMGFLDGYEAARARTDRWLATYPAGRIETRIVEFDAEKGFVLVEAKAFRQSEDTHPAGIDH
Ga0209617_1007756953300027720Freshwater And SedimentMGFLDNYEASRERLERWLKTYPTGRIETSIVEFSADKGYVLVEAKAFRHEDDTRPAAVDF
Ga0209442_114428753300027732Freshwater LakeMGFLDNYEASRARLERWWLTYPNGRIETRIVEFSAEKGFALVEAKAFRNAEDLL
Ga0209087_103187473300027734Freshwater LakeMGFLDGYEAARARTDRWLATYPTGRIETRIVQFDAEKGFVLVEARAFRQSDDTRPAG
Ga0209597_131825313300027746Freshwater LakeMGFLDNYEASRERLERWIRTYPTGRIETRVMEFDAEKGYVLVKAEAYRNDTDQHP
Ga0209088_1036396213300027763Freshwater LakeMGFLDGYEAARARTDRWLATYPAGRIETRIVQFDAEKGFV
Ga0209354_1044114533300027808Freshwater LakeMGFLDNYEASRERLERWLKTYPTGRIETSIVEFSADKG
Ga0209390_1052224133300027848FreshwaterMSFLDNYEASRDRNDRWWRTYPTGRIETEIIEFNAEKGYVLVKATAYRERIDSQPA
Ga0209253_1115085113300027900Freshwater Lake SedimentMGFLDNYEASRERLERWLKTYPTGRIETRIVEFSAE
Ga0209702_1028753843300027976FreshwaterMSFLDNYEASRDRNDRWWRTYPSGRIESEIVEFNAEKGYV
Ga0209702_1032222823300027976FreshwaterMNIKEDYEGNRDRNDRWWRTHPTGRIETEIVEFNAEKGYVLV
(restricted) Ga0247842_1035464813300029268FreshwaterMGFLDNYEASRERLERWLATFPTGRIETRILQFDPEKGYVLVEAKAYRKQDDEQPAGIDY
Ga0315293_1116991613300031746SedimentMGFLDGYEAARARTDRWLATYPAGRIETRIVQFDAEKGFVLVEAKA
Ga0315288_1028582673300031772SedimentMGFLDNYEASRERLERWLKTYPNGRIETRIVEFSAEKGYVLVEAKAYKGKPHIDDCTICADIVELPAGTDFAYGFVS
Ga0315900_1095156733300031787FreshwaterMGFLDNYEASRERLERWIKTYPTGRIETRIVEFSAEKGF
Ga0315290_1159264623300031834SedimentMKFLDGYEAARARTDRWLATYPAGRIETRIVQFDAEKGFVLVE
Ga0315297_1091590333300031873SedimentMGFLDGYEAARARTDRWLATYPTGRIETRIVQFDAEKGFVLVEARAFRQ
Ga0315904_1092395013300031951FreshwaterMGFLDNYEASRERLERWIKTYPTGRIETRIVEFSAEKGFVLVEAKAFRNQEDTQ
Ga0315294_1146443633300031952SedimentMGFLDGYEAARARTDRWIATYPTGRIETRIVQFDAEKGFVLVEAK
Ga0315289_1138086813300032046SedimentMGFLDGYEAARARTDRWLATYPAGRIETRIVQFDAEKGFVLVEAKAFRQSDDTHPAGIDH
Ga0315903_1093804913300032116FreshwaterMGFLDNYEASRERLERWNRTFPLGRIETRIVEFSAEKGYVLVEAKAFRHMDDLEPAGIDY
Ga0315277_1182083713300032118SedimentMGFLDGYEANRQRLERWIATYPTGRIETRIMEFNAEKGYVFVEARAFRTAED
Ga0315292_1048996013300032143SedimentMGFLDGYEAARARTDRWLATYPAGRIETRIVQFDAEKGFVLVEARAFRQSDDTHPAGIDHAYGYQ
Ga0315271_1111511713300032256SedimentMGFLDGYEAARARTDRWLATYPAGRIETRIVQFDAEKGFVLVEARAFRQSDDTHPAGIDHAYGYQGAYVQ
Ga0315286_1163535623300032342SedimentMGFLDGYEAARARTDRWLATYPAGRIETRIVQFDAEKGFVLVEARAFRQSDDTHP
Ga0315275_1191678533300032401SedimentMGFLDGYEAARARTDRWLATYPTGRIETRIVQFDAEKGFVLVEARAFRQSDDTHPAGIDHAYGYQGAYVQ
Ga0335396_1080112223300032462FreshwaterMNIKEDYEGNRDRNDRWWRTHPTGRIETEIVEFNAEKGYVLVKA
Ga0335396_1095817513300032462FreshwaterMSFLDNYEASRDRNDRWWRTHPTGRIETEIVEFNAEK
Ga0315273_1157638413300032516SedimentMGFLDGYEAARARTDRWLATYPAGRIETRIVQFDAEKGFVLVEAKAFRQSDDTHPAGIDHAYGYQGA
Ga0334996_0551213_328_5043300033994FreshwaterMGFLDNYEASRERLERWIKTYPTGRIETRIVEFSAEKGYVLVEAKAFRNDTDVNPAGID
Ga0334979_0012506_5702_58093300033996FreshwaterMGFLDNYEASRERLERWNRTYPLGRIETSIVEFNAD
Ga0335023_0577419_1_1173300034050FreshwaterMGFLDNYEASRERLERWLKTYPTGRIETSIVEFSADKGY
Ga0334990_0516051_2_1243300034068FreshwaterMGFLDNYEAARARTDRWLATYPTGRIETEIMEFSAEKGYVL
Ga0335012_0253392_1_1893300034093FreshwaterMGFLDNYEASRARLERWWLTYPNGRIETRIVEFSAEKGFALIEAKAFRNAEDLLPAGIDFAFG
Ga0335012_0543687_3_1853300034093FreshwaterMGFLDNYEASRERLERWLAKYPTGRIETRIVEFSAEKGYVLVEAKAFRNDTDLHPAGIDY
Ga0335012_0579127_1_1953300034093FreshwaterMGFLDNYEASRERLERWLKTYPLGRIETSIVEFSADKGYVLVEAKAFRHEDDTRPAAIDFAYGYQ
Ga0335022_0618633_396_5453300034095FreshwaterMGFLDGYEAARARTDRWILTHPTGRIETEIMEFNAEKGYVLVKATGYRNA
Ga0335027_0397256_687_8963300034101FreshwaterMGFLDNYEASLARLTRWNSTYPLGRIETRIVEFSAEKGYVLVEAKAYRHYDDVVPAGTDFAYGYQGAYQP
Ga0335035_0346484_712_8583300034105FreshwaterMGFLDNYEAARARTDRWIATFPTGRITTEIMEFSADKGYVLVKATGYRN
Ga0335035_0535103_1_1653300034105FreshwaterMGFLDNYEASRERLERWNRTFPLGRIETRIVEFSAEKGYVLVEAKAFRHMDDLEP
Ga0335063_0358879_635_7513300034111FreshwaterMGFLDNYEASRERLERWLATYPNGRIETRIVEFSAEKGY
Ga0335053_0202482_2_1753300034118FreshwaterMGFLDNYEASRERLERWLATYPNGRIETRIVEFSAEKGYVLVEARAYRENDMIPAGID
Ga0335056_0643289_1_1263300034120FreshwaterMGFLDNYEAARARTDRWIATFPTGRITTEIMEFSADKGYVLV
Ga0335065_0414403_1_1683300034200FreshwaterMGFLDNYEASRERLERWLKTYPTGRIETRIVEFSAEKGYVLVEAKAFRNDTDLHPA
Ga0335065_0716273_1_2283300034200FreshwaterVGFLDNYEASRERLERWLKTYPTGRIETSIVEFSADKGYVLVEAKAFRHEDDTRPAAIDFAYGYQGAYQQNMKRWF
Ga0335007_0615670_455_6253300034283FreshwaterMGFLDNYEASRERLERWLKTFPNGRIETRIVEFSAEKGYVLVEARAFKGIDSVLPDG
Ga0335048_0401599_2_1243300034356FreshwaterMGFLDNYEASRERLERWLKTYPTGRIETIIVEFSADKGYVL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.