Basic Information | |
---|---|
Family ID | F104982 |
Family Type | Metagenome |
Number of Sequences | 100 |
Average Sequence Length | 44 residues |
Representative Sequence | MALVNQVQKRVKMPKWDVVKFQILVHCYINRITMSDSDLNCLT |
Number of Associated Samples | 84 |
Number of Associated Scaffolds | 100 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 46.46 % |
% of genes near scaffold ends (potentially truncated) | 96.00 % |
% of genes from short scaffolds (< 2000 bps) | 91.00 % |
Associated GOLD sequencing projects | 82 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (68.000 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (26.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (49.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (55.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.58% β-sheet: 0.00% Coil/Unstructured: 70.42% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 100 Family Scaffolds |
---|---|---|
PF01510 | Amidase_2 | 7.00 |
PF13539 | Peptidase_M15_4 | 3.00 |
PF08291 | Peptidase_M15_3 | 1.00 |
PF07992 | Pyr_redox_2 | 1.00 |
PF00959 | Phage_lysozyme | 1.00 |
PF01391 | Collagen | 1.00 |
PF09374 | PG_binding_3 | 1.00 |
PF01471 | PG_binding_1 | 1.00 |
PF05105 | Phage_holin_4_1 | 1.00 |
PF12705 | PDDEXK_1 | 1.00 |
COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
---|---|---|---|
COG4824 | Phage-related holin (Lysis protein) | Mobilome: prophages, transposons [X] | 1.00 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 68.00 % |
All Organisms | root | All Organisms | 32.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000792|BS_KBA_SWE02_21mDRAFT_10178571 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 518 | Open in IMG/M |
3300002360|B570J29630_1010004 | Not Available | 627 | Open in IMG/M |
3300002408|B570J29032_109804370 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1393 | Open in IMG/M |
3300002835|B570J40625_100550102 | Not Available | 1070 | Open in IMG/M |
3300002835|B570J40625_101348549 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 590 | Open in IMG/M |
3300002835|B570J40625_101777171 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 500 | Open in IMG/M |
3300003277|JGI25908J49247_10006223 | Not Available | 3807 | Open in IMG/M |
3300003860|Ga0031658_1066566 | Not Available | 632 | Open in IMG/M |
3300004481|Ga0069718_16165672 | Not Available | 1135 | Open in IMG/M |
3300005581|Ga0049081_10023884 | All Organisms → Viruses → Predicted Viral | 2321 | Open in IMG/M |
3300005584|Ga0049082_10330571 | Not Available | 505 | Open in IMG/M |
3300006735|Ga0098038_1225530 | Not Available | 599 | Open in IMG/M |
3300007171|Ga0102977_1029965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8540 | Open in IMG/M |
3300007560|Ga0102913_1268126 | Not Available | 545 | Open in IMG/M |
3300007974|Ga0105747_1099195 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 908 | Open in IMG/M |
3300008261|Ga0114336_1011733 | Not Available | 18047 | Open in IMG/M |
3300008263|Ga0114349_1217231 | Not Available | 668 | Open in IMG/M |
3300009068|Ga0114973_10690598 | Not Available | 520 | Open in IMG/M |
3300009081|Ga0105098_10184347 | Not Available | 956 | Open in IMG/M |
3300009085|Ga0105103_10495694 | Not Available | 685 | Open in IMG/M |
3300009152|Ga0114980_10597206 | Not Available | 624 | Open in IMG/M |
3300009157|Ga0105092_10007925 | Not Available | 5588 | Open in IMG/M |
3300009159|Ga0114978_10189297 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1306 | Open in IMG/M |
3300009165|Ga0105102_10859192 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 520 | Open in IMG/M |
3300009169|Ga0105097_10560538 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 641 | Open in IMG/M |
3300009180|Ga0114979_10744789 | Not Available | 552 | Open in IMG/M |
3300010318|Ga0136656_1104727 | Not Available | 990 | Open in IMG/M |
3300010354|Ga0129333_11516123 | Not Available | 549 | Open in IMG/M |
3300010885|Ga0133913_11822235 | All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | 1522 | Open in IMG/M |
3300011011|Ga0139556_1023150 | Not Available | 903 | Open in IMG/M |
3300012013|Ga0153805_1031740 | Not Available | 899 | Open in IMG/M |
3300012017|Ga0153801_1024936 | Not Available | 1060 | Open in IMG/M |
3300012663|Ga0157203_1035971 | Not Available | 685 | Open in IMG/M |
3300013372|Ga0177922_10657442 | Not Available | 729 | Open in IMG/M |
3300013372|Ga0177922_10751390 | Not Available | 668 | Open in IMG/M |
3300015050|Ga0181338_1008850 | Not Available | 1673 | Open in IMG/M |
3300015050|Ga0181338_1036809 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 735 | Open in IMG/M |
3300017700|Ga0181339_1010741 | Not Available | 1075 | Open in IMG/M |
3300017707|Ga0181363_1045662 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 795 | Open in IMG/M |
3300017716|Ga0181350_1116150 | Not Available | 646 | Open in IMG/M |
3300017716|Ga0181350_1150911 | Not Available | 542 | Open in IMG/M |
3300017747|Ga0181352_1093411 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 831 | Open in IMG/M |
3300017747|Ga0181352_1116590 | Not Available | 723 | Open in IMG/M |
3300017747|Ga0181352_1132687 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 667 | Open in IMG/M |
3300017754|Ga0181344_1216652 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 534 | Open in IMG/M |
3300017766|Ga0181343_1128189 | Not Available | 711 | Open in IMG/M |
3300017766|Ga0181343_1198974 | Not Available | 549 | Open in IMG/M |
3300017778|Ga0181349_1199946 | Not Available | 691 | Open in IMG/M |
3300017780|Ga0181346_1131201 | Not Available | 952 | Open in IMG/M |
3300017784|Ga0181348_1245946 | Not Available | 621 | Open in IMG/M |
3300019781|Ga0181360_107053 | Not Available | 950 | Open in IMG/M |
3300019781|Ga0181360_117245 | Not Available | 590 | Open in IMG/M |
3300019784|Ga0181359_1238037 | Not Available | 561 | Open in IMG/M |
3300020172|Ga0211729_10913120 | Not Available | 925 | Open in IMG/M |
3300020542|Ga0208857_1020048 | Not Available | 1110 | Open in IMG/M |
3300020556|Ga0208486_1033275 | Not Available | 773 | Open in IMG/M |
3300022176|Ga0212031_1031698 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 859 | Open in IMG/M |
3300022190|Ga0181354_1136811 | Not Available | 776 | Open in IMG/M |
3300022308|Ga0224504_10363139 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 602 | Open in IMG/M |
3300022407|Ga0181351_1193615 | Not Available | 687 | Open in IMG/M |
3300022543|Ga0212119_1000956 | Not Available | 10573 | Open in IMG/M |
3300024505|Ga0255150_1071370 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 539 | Open in IMG/M |
(restricted) 3300024520|Ga0255047_10064710 | Not Available | 1891 | Open in IMG/M |
3300025769|Ga0208767_1225720 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 607 | Open in IMG/M |
3300025889|Ga0208644_1052516 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → unclassified Rhodopirellula → Rhodopirellula sp. | 2248 | Open in IMG/M |
3300027205|Ga0208926_1024865 | Not Available | 901 | Open in IMG/M |
3300027278|Ga0208439_1069440 | Not Available | 656 | Open in IMG/M |
3300027578|Ga0255075_1092473 | Not Available | 522 | Open in IMG/M |
3300027721|Ga0209492_1070298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1236 | Open in IMG/M |
3300027772|Ga0209768_10147173 | Not Available | 1106 | Open in IMG/M |
3300027798|Ga0209353_10075518 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae → Flexithrix → Flexithrix dorotheae | 1532 | Open in IMG/M |
3300027808|Ga0209354_10028911 | Not Available | 2212 | Open in IMG/M |
3300027808|Ga0209354_10070509 | Not Available | 1416 | Open in IMG/M |
3300027808|Ga0209354_10133681 | Not Available | 1013 | Open in IMG/M |
3300027897|Ga0209254_10680642 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 712 | Open in IMG/M |
(restricted) 3300027970|Ga0247837_1213198 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 791 | Open in IMG/M |
3300031539|Ga0307380_10464468 | Not Available | 1123 | Open in IMG/M |
3300031539|Ga0307380_10956679 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 688 | Open in IMG/M |
3300031669|Ga0307375_10298115 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
3300031746|Ga0315293_10222805 | Not Available | 1541 | Open in IMG/M |
3300031857|Ga0315909_10720954 | Not Available | 644 | Open in IMG/M |
3300031951|Ga0315904_10500506 | Not Available | 1072 | Open in IMG/M |
3300031963|Ga0315901_10873830 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 643 | Open in IMG/M |
3300031999|Ga0315274_12041547 | Not Available | 513 | Open in IMG/M |
3300032053|Ga0315284_11132610 | Not Available | 867 | Open in IMG/M |
3300032053|Ga0315284_11703618 | Not Available | 656 | Open in IMG/M |
3300032053|Ga0315284_11844533 | Not Available | 621 | Open in IMG/M |
3300032053|Ga0315284_12171856 | Not Available | 555 | Open in IMG/M |
3300032116|Ga0315903_10889981 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 637 | Open in IMG/M |
3300032275|Ga0315270_10377100 | Not Available | 901 | Open in IMG/M |
3300033557|Ga0316617_100232507 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → Fluviicola → unclassified Fluviicola → Fluviicola sp. XM-24bin1 | 1500 | Open in IMG/M |
3300033992|Ga0334992_0080031 | Not Available | 1782 | Open in IMG/M |
3300034012|Ga0334986_0231106 | Not Available | 1016 | Open in IMG/M |
3300034013|Ga0334991_0428806 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 502 | Open in IMG/M |
3300034101|Ga0335027_0437203 | Not Available | 838 | Open in IMG/M |
3300034104|Ga0335031_0308871 | Not Available | 1026 | Open in IMG/M |
3300034109|Ga0335051_0070515 | Not Available | 1843 | Open in IMG/M |
3300034279|Ga0335052_0384878 | Not Available | 751 | Open in IMG/M |
3300034279|Ga0335052_0398651 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 733 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 26.00% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.00% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 7.00% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 6.00% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.00% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.00% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.00% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.00% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.00% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.00% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.00% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 3.00% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.00% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.00% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 2.00% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.00% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.00% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.00% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 1.00% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.00% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.00% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 1.00% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.00% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.00% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.00% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 1.00% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.00% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.00% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000792 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 02_21m | Environmental | Open in IMG/M |
3300002360 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2010 deep hole epilimnion | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003860 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
3300007171 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects | Environmental | Open in IMG/M |
3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
3300008263 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTR | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017700 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D | Environmental | Open in IMG/M |
3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300019781 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM15.S.D | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020542 | Freshwater microbial communities from Lake Mendota, WI - 05NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020556 | Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022308 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24 | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022543 | Indian_combined assembly | Environmental | Open in IMG/M |
3300024505 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8h | Environmental | Open in IMG/M |
3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300027205 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 (SPAdes) | Environmental | Open in IMG/M |
3300027278 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 (SPAdes) | Environmental | Open in IMG/M |
3300027578 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h | Environmental | Open in IMG/M |
3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
3300027970 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5m | Environmental | Open in IMG/M |
3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
BS_KBA_SWE02_21mDRAFT_101785712 | 3300000792 | Marine | MALVNQVQKKVIMSKKDVIKFQIVTHCYINKIALSDSDFECLTLLSTIGP |
B570J29630_10100042 | 3300002360 | Freshwater | MALVIQVQKRAVMPKWEIVKFQILSHCYINRIVVSESDLNCLTLLSI |
B570J29032_1098043705 | 3300002408 | Freshwater | MAIVNQVQKRVKMPKWDLVKYQILTHCYINKLSLSESDL |
B570J40625_1005501021 | 3300002835 | Freshwater | MALVNQVQKKVMMSREDVIKYQILTHCYINRITVSDSDLECLALLSQIGP |
B570J40625_1013485492 | 3300002835 | Freshwater | MALVNQVQKRVKMSKWDVVKFQILTHCYINRITMSESDLNCLTLLSFNEPIELTSF |
B570J40625_1017771711 | 3300002835 | Freshwater | MALVNQVQKKVKMPKWDIVKFQILTHCYINRIAMSESDLNCLTLLSFNEP |
JGI25908J49247_100062231 | 3300003277 | Freshwater Lake | MALVNQVQKRVKMSKWDIVKFQILTHCYINRITMSESDFDCL |
Ga0031658_10665661 | 3300003860 | Freshwater Lake Sediment | MALVNQVQKRVKMPKWDIVKFQILTHCYIKRINLSDSDLNCLTLL |
Ga0069718_161656725 | 3300004481 | Sediment | MALVTQVEKLVKMSKWDLVKFQIVTHCYINSIIMSDSDLNCLT |
Ga0049081_100238847 | 3300005581 | Freshwater Lentic | MALVNQVQKRAVMTKWDVIKFQIVTHCYINNITVSDSDLNCLTL |
Ga0049082_103305712 | 3300005584 | Freshwater Lentic | MALVNQVQKRVKMPKWDIVKFQILTHCYVNHITMSDSDLNCLTLLSF |
Ga0098038_12255301 | 3300006735 | Marine | MAIVNQVQKRVVMSKKDIIKYQILTHCYINSIMVSNSEL |
Ga0102977_10299651 | 3300007171 | Freshwater Lake | MALVNQVQKRVRMPKWDIVKFQILTHCYINRVTMSESDL |
Ga0102913_12681262 | 3300007560 | Estuarine | MALVNQVQKRVKMPKWDIVKFQILTHCYVNKITMSDSDLN |
Ga0105747_10991951 | 3300007974 | Estuary Water | MALVNQVQKRVRMPKWEIVKFQILTHCYINRIAVSESDLNCLTLLSFNEPI |
Ga0114336_10117336 | 3300008261 | Freshwater, Plankton | MALVNQVQKRAVMPKWEIVKFQILSHCYINRITVSELDYKFLGR* |
Ga0114349_12172313 | 3300008263 | Freshwater, Plankton | MALVNQVQKRVKMPKWNIVKYQILTHCYINNITVSNSDL |
Ga0114363_11843581 | 3300008266 | Freshwater, Plankton | MALVNQVQKKVVMSKKDIIKFQFITHCYINKIALSD |
Ga0114973_106905981 | 3300009068 | Freshwater Lake | MALVNQVQKRVKMPKWDIVKFQILTHCYVNHITMSDSDLNCLTLLSFNQPIELTH |
Ga0105098_101843473 | 3300009081 | Freshwater Sediment | MALVNQVQKRVKMPKWDVVKFQILVHCYINRITMSDSDLNCLTLLSLNEPIELT* |
Ga0105103_104956943 | 3300009085 | Freshwater Sediment | MALVNQVQKRVKMPKWNIVKYQILTHCYINNITVSNSDLD |
Ga0114980_105972062 | 3300009152 | Freshwater Lake | MALVNQVQKRVKMPKWDIVKFQILTHCYIKRINLSDSDLNCLTLLSFNEPI |
Ga0105092_100079258 | 3300009157 | Freshwater Sediment | MALVNQVQKRVKMPKWDVVKFQILTHCYINHIAMS* |
Ga0114978_101892971 | 3300009159 | Freshwater Lake | MALVNQVQKRVKMSKWEVVKFQILTHCYINKITLSNSDLDCLT |
Ga0105102_108591922 | 3300009165 | Freshwater Sediment | MALVNQVQKRVKMPKWDIVKFQILTHCYINRITMSESDLDCLTLLSFNEPI |
Ga0105097_105605381 | 3300009169 | Freshwater Sediment | MALVNQVQKRVKMPKWDVVKFQILTHCYVNRITVSESDLNCLTLLSFNEPIE |
Ga0114979_107447891 | 3300009180 | Freshwater Lake | MAIVNQVQKRVKMPKWEVVKFQILTHCYVNRITMSDSDLN |
Ga0136656_11047273 | 3300010318 | Freshwater To Marine Saline Gradient | MALVNQVQKRVKLPKWEVVKFQILTHCYINRITMSESDLN |
Ga0129333_115161231 | 3300010354 | Freshwater To Marine Saline Gradient | MAIVNQVQKRVKMPKWDIVKFQILTHCYIKRINLSDSDLNCLTLLSFNEPIE |
Ga0133913_118222351 | 3300010885 | Freshwater Lake | MATVNQVQKKVRMRKWDVVKFQILTHCYINRVVMSDSDLNCLTLLS |
Ga0139556_10231501 | 3300011011 | Freshwater | MALVNQVQKRVKMPKWDIVKFQILTHCYVNHITMSDSDLNCLTLLS |
Ga0153805_10317401 | 3300012013 | Surface Ice | MALVNQVQKRVKMPKWDIVKFQILTHCYVNHITMSDSDLNCLT |
Ga0153801_10249361 | 3300012017 | Freshwater | MALVNQVQKRVVMSIEDIIKFQILTHCYLSRIMVSDSDINC |
Ga0157203_10359711 | 3300012663 | Freshwater | MALVNQVQKRVMMSKNDIIKFQILTHCYINRITMSE |
Ga0177922_106574421 | 3300013372 | Freshwater | MALVNQVQKRAIMTKWDVIKFQIVTHCYINNITVSDSDLNCLTLLSTIGPI |
Ga0177922_107513903 | 3300013372 | Freshwater | MALVIQVQKRAVMPKWEIVKFQILSHCYINRIVVSESDLN |
Ga0181338_10088501 | 3300015050 | Freshwater Lake | MAIVNQVQKKVRMPKWDVVKFQILTHCYIKRINLSDSDLNCLTLLSF |
Ga0181338_10368093 | 3300015050 | Freshwater Lake | MALVNQVQKRVKMSKWEVVKFQILTHCYINKITLSNSDLDCLTLLSFNEPIEL |
Ga0181339_10107413 | 3300017700 | Freshwater Lake | MAIVNQVQKKVRMPKWDVVKFQILTHCYIKRINLS |
Ga0181363_10456621 | 3300017707 | Freshwater Lake | MALVNQVQKRVMMSKKDVIKFQILTHCYINRITMSESDLDCLTLLSLLGPLSL |
Ga0181350_11161503 | 3300017716 | Freshwater Lake | MAIVNQVQKKVRMPKWDVVKFQILTHCYIKRINLSDSDLNCLTLLSFNEPIEL |
Ga0181350_11509111 | 3300017716 | Freshwater Lake | MTLVNQVQKKVKMPKWDIVKYQILTHCYINRITMSDS |
Ga0181352_10934111 | 3300017747 | Freshwater Lake | MALVNQVQKRVKMPKWDVVKFQILTHCYINRITMSESDLNCLTLLSFNE |
Ga0181352_11165901 | 3300017747 | Freshwater Lake | MALVNQVQKKVMMPKWNVVKFQILTHCYINNIEMSNSDLN |
Ga0181352_11326873 | 3300017747 | Freshwater Lake | MALVNQVQKRVKMPKWDVVKFQILTHCYINRITMSESDL |
Ga0181344_12166522 | 3300017754 | Freshwater Lake | MALVNQVQKRVRMAKWDVVKFQILTHCYINRITVSESD |
Ga0181343_11281891 | 3300017766 | Freshwater Lake | MALVNQVQKRVKMPKWDVVKLQILTHCYINRITMSE |
Ga0181343_11989741 | 3300017766 | Freshwater Lake | MALVNQVQKRVKMPKWDVVKFQILTHCYLNRITMSESDLNCLTLLSFNQPIE |
Ga0181349_11999461 | 3300017778 | Freshwater Lake | MALVNQVQKRAVMPKWEIVKFQILSHCYINHIVVSDSDLN |
Ga0181346_11312011 | 3300017780 | Freshwater Lake | MAIVNQVQKKVRMPKWDVVKFQILTHCYIKRINLSDSDLNCLTLLSFNEPIE |
Ga0181348_12459461 | 3300017784 | Freshwater Lake | MAIVNQVQKRVKMPKWDIVKFQILTHCYIKRINLSD |
Ga0181360_1070531 | 3300019781 | Freshwater Lake | MAIVNQVQKKVRMPKWDVVKFQILTHCYIKRINLSDSDLNCLTLLI |
Ga0181360_1172451 | 3300019781 | Freshwater Lake | MALVNQVQKRVKMPKWDVVKFQILVHCYINRITMSDSDLNCLT |
Ga0181359_12380371 | 3300019784 | Freshwater Lake | MAIVNQVQKRVRMPKWDVVKFQILTHCYVNRINLSDSDLNCL |
Ga0211729_109131201 | 3300020172 | Freshwater | MATVNQVQKKVKMPKWDVVKFQILTHCYINRVVMS |
Ga0208857_10200482 | 3300020542 | Freshwater | MSAVNQVQKKVIMSKNGIIKYQILTHCYINNIALSDSDFECLTLLTII |
Ga0208486_10332751 | 3300020556 | Freshwater | MALVNQVQKRVKMPKWDVVKFQILTHCYINRITMSESD |
Ga0212031_10316981 | 3300022176 | Aqueous | MALVNQVQKRVKMTKWDAVKFQIVTHCYINRITMSESDL |
Ga0181354_11368111 | 3300022190 | Freshwater Lake | MALVNQVQKRVKMPKWEVVKFQILAHCYINRITMSESDLNCF |
Ga0224504_103631392 | 3300022308 | Sediment | MALVNQVQKRVKLPKWEIVKFQILTHCYINGITMSESDLNCLTLLSFNEP |
Ga0181351_11936151 | 3300022407 | Freshwater Lake | MALVNQVQKRAVMTKWDVIKFQIVTHCYINNITVSDSDLNCLTLLSTTGP |
Ga0212119_10009561 | 3300022543 | Freshwater | MALVNQVQKRVRMPKWDIVKFQILTHCYINRVTMS |
Ga0255150_10713701 | 3300024505 | Freshwater | MALVNQVQKRVKMPKWDIVKFQILTHCYINRITMSESDLDCLTLLSF |
(restricted) Ga0255047_100647106 | 3300024520 | Seawater | MALVNQVQKRVRMPKWDIVKFQILTHCYINRVTMSDSDLDCLTLLS |
Ga0208767_12257201 | 3300025769 | Aqueous | MALVNQVKKQVQMPKWDLVKYQILTHCYINRITVSDSDLNCLTLLSFNEPVELT |
Ga0208644_10525161 | 3300025889 | Aqueous | MALVNQVKKQVQMPKWDLVKYQILTHCYINRITVSDSDLNCLTLL |
Ga0208926_10248654 | 3300027205 | Estuarine | MALVNQVQKRVIMNRKDVVKFQILTHCYINNIVVTESDLN |
Ga0208439_10694403 | 3300027278 | Estuarine | MALVNQVQKRVKMPKWDIVKFQILTHCYINHLTMSESDL |
Ga0255075_10924731 | 3300027578 | Freshwater | MAIVNQVQKRVRMPKWDVVKFQILTHCYVNRINLSDSD |
Ga0209492_10702981 | 3300027721 | Freshwater Sediment | MALVNQVQKRVKMPKWNIVKYQILTHCYINNITVSNSDLDCLTLLSFNEPIELT |
Ga0209768_101471735 | 3300027772 | Freshwater Lake | MALVNQVQKRAVMPKWEIVKFQILSHCYINHIVVSDSDL |
Ga0209353_100755184 | 3300027798 | Freshwater Lake | MAIVNQVQKKVRMPKWDVVKFQILTHCYIKRINLSDSDLNCLTLLSFNEPIELT |
Ga0209354_100289117 | 3300027808 | Freshwater Lake | MALVNQVQKRAVMTKWDVIKFQIVTHCYINNITVSDS |
Ga0209354_100705093 | 3300027808 | Freshwater Lake | MAIVNQVQKKVRMPKWDVVKFQILTHCYIKRINLSDSDLNCLTL |
Ga0209354_101336813 | 3300027808 | Freshwater Lake | MAIVNQVQKKVRMPKWDVVKFQILTHCYIKRINLSDSDLNCLTLL |
Ga0209254_106806423 | 3300027897 | Freshwater Lake Sediment | MALVNQVQKRVRMPKWEIVKFQILTHCYINRIAVSESDLNCLTLLSFNE |
(restricted) Ga0247837_12131983 | 3300027970 | Freshwater | MALVNQVQKRVKMSKWDVVKFQILTHCYINKITMSESDLDCI |
Ga0307380_104644681 | 3300031539 | Soil | MALVNQVQKRVRMPKWDIVKFQILTHCYINRVTMSDSDLDCLTLLSFNQPIELSNF |
Ga0307380_109566793 | 3300031539 | Soil | MALVNQVQKRVKMSKWDIVKFQILTHCYINRITMSESDFDCLTL |
Ga0307375_102981151 | 3300031669 | Soil | MALVNQVQKRVRMPKWDIVKFQILTHCYVNRITMSESDLDCLTLLSFNQP |
Ga0315293_102228055 | 3300031746 | Sediment | MALVNQVQKRVRMPKWDIVKFQILTHCYIKRITMSDSDLDCLTLLSFNQPIELTA |
Ga0315909_107209541 | 3300031857 | Freshwater | MALVNQVQKKVKMPKWDIVKFQILTYSYINRISLSESDLNCLALL |
Ga0315904_105005064 | 3300031951 | Freshwater | MALVNQVQKRVKMPKWDVVKFQILTHCYINRITMSDSDLNCLTLLSFNQPIE |
Ga0315901_108738303 | 3300031963 | Freshwater | MALVNQVQKRVKMSKWDVVKFQILTHCYINRITMSESDLNCLTLLSFN |
Ga0315274_120415472 | 3300031999 | Sediment | MALVNQVQKRVKMPKWDIVKFQILTHCYINHITMSD |
Ga0315284_111326101 | 3300032053 | Sediment | MALVIQVQKRAVMPKWEIVKFQILSHCYINRIVVSESDLNCLTL |
Ga0315284_117036182 | 3300032053 | Sediment | MAVVNQIEKKAVMTNWDVIKYQIVTHCYISKIQVSEADLECLTYL |
Ga0315284_118445332 | 3300032053 | Sediment | MALVNQVQKRVRMSKWNVVKFQILTHCYIKRILLSDSDLNCLTL |
Ga0315284_121718561 | 3300032053 | Sediment | MALVNQVQKKVRMPKWDIVKFQILTHCYIKRITMSDSDL |
Ga0315903_108899811 | 3300032116 | Freshwater | MALVNQVQKRVKMTKWDAVKFQILTHCYINRITMSESDLNC |
Ga0315270_103771001 | 3300032275 | Sediment | MALVNQVQKRVKMPKWDIVKFQILTHCYVNHITMSDSDLNCLTLLSFNQPI |
Ga0316617_1002325071 | 3300033557 | Soil | MALVNQVQKRVKMPKWDIVKFQILTHCYINRIAMSESDL |
Ga0334992_0080031_2_112 | 3300033992 | Freshwater | MALVNQVEKRVKMPKWDVVKFQILTHCYVNHITMSDS |
Ga0334986_0231106_3_164 | 3300034012 | Freshwater | MALVNQVQKRVKMPKWDVVKFQILTHCYINHITMSDSDLNCLTLLSFNEPLELT |
Ga0334991_0428806_368_502 | 3300034013 | Freshwater | MALVNQVQKRVRMAKWDVVKFQILTHCYINRITVSESDLNCLTLL |
Ga0335027_0437203_1_123 | 3300034101 | Freshwater | MALVNQVQKKVKMPKWDVVKFQILTYSYINRISLSESDLNC |
Ga0335031_0308871_1_108 | 3300034104 | Freshwater | MALVNQVQKKVIMSKPDVVKFQILTHCYINRITVSE |
Ga0335051_0070515_2_133 | 3300034109 | Freshwater | MALVNQVQKRVRMPKWEVVKFQILTHCYINRIAVSESDLNCLTL |
Ga0335052_0384878_637_750 | 3300034279 | Freshwater | MALVNQVQKKVVMSKKDIIKYQILTHCYISRITLSDSD |
Ga0335052_0398651_607_732 | 3300034279 | Freshwater | MALVNQVQKRVKMPKWDVVKFQILTHCYINHITVSESDLNCL |
⦗Top⦘ |