NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F104956

Metagenome Family F104956

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F104956
Family Type Metagenome
Number of Sequences 100
Average Sequence Length 82 residues
Representative Sequence LTEFDDKAAMDLEDEDLIMAIYWSDIFRACAIEFEPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH
Number of Associated Samples 91
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 84.00 %
% of genes near scaffold ends (potentially truncated) 25.00 %
% of genes from short scaffolds (< 2000 bps) 77.00 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(17.000 % of family members)
Environment Ontology (ENVO) Unclassified
(71.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(81.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 73.49%    β-sheet: 0.00%    Coil/Unstructured: 26.51%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF13481AAA_25 18.00
PF12684DUF3799 4.00
PF03237Terminase_6N 3.00
PF05127Helicase_RecD 2.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG1444tRNA(Met) C34 N-acetyltransferase TmcATranslation, ribosomal structure and biogenesis [J] 2.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.00 %
UnclassifiedrootN/A14.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10043561All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2315Open in IMG/M
3300000116|DelMOSpr2010_c10067117All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1476Open in IMG/M
3300000928|OpTDRAFT_10038487All Organisms → Viruses10817Open in IMG/M
3300001352|JGI20157J14317_10235707Not Available501Open in IMG/M
3300003410|JGI26086J50260_1111584All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium539Open in IMG/M
3300003580|JGI26260J51721_1043884All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium725Open in IMG/M
3300003908|JGI26085J52751_1038554All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium648Open in IMG/M
3300004448|Ga0065861_1067069All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium665Open in IMG/M
3300004461|Ga0066223_1046608All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium721Open in IMG/M
3300005068|Ga0070769_1298016All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium500Open in IMG/M
3300005612|Ga0070723_10424245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Calidifontibacillus/Schinkia group → Schinkia → Schinkia azotoformans → Schinkia azotoformans MEV2011647Open in IMG/M
3300005837|Ga0078893_14715942Not Available542Open in IMG/M
3300005942|Ga0070742_10090816All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium840Open in IMG/M
3300006029|Ga0075466_1018883All Organisms → cellular organisms → Bacteria2254Open in IMG/M
3300006752|Ga0098048_1021279All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2172Open in IMG/M
3300006789|Ga0098054_1176896Not Available782Open in IMG/M
3300006793|Ga0098055_1333896All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium564Open in IMG/M
3300006802|Ga0070749_10139628All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1414Open in IMG/M
3300006803|Ga0075467_10207145All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1087Open in IMG/M
3300006803|Ga0075467_10440075All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium675Open in IMG/M
3300006810|Ga0070754_10095216All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1478Open in IMG/M
3300006810|Ga0070754_10148991All Organisms → cellular organisms → Bacteria → Proteobacteria1120Open in IMG/M
3300006868|Ga0075481_10169515All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium789Open in IMG/M
3300006920|Ga0070748_1075129All Organisms → Viruses → Predicted Viral1311Open in IMG/M
3300006922|Ga0098045_1008195All Organisms → cellular organisms → Bacteria3046Open in IMG/M
3300006922|Ga0098045_1046468All Organisms → cellular organisms → Bacteria1083Open in IMG/M
3300006924|Ga0098051_1010406All Organisms → cellular organisms → Bacteria → Proteobacteria2838Open in IMG/M
3300006925|Ga0098050_1022224All Organisms → cellular organisms → Bacteria1758Open in IMG/M
3300006990|Ga0098046_1006336All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3446Open in IMG/M
3300007229|Ga0075468_10231959All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium528Open in IMG/M
3300007540|Ga0099847_1071220All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1076Open in IMG/M
3300007540|Ga0099847_1075813All Organisms → Viruses → Predicted Viral1038Open in IMG/M
3300009074|Ga0115549_1011800All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium3783Open in IMG/M
3300009076|Ga0115550_1100801All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1068Open in IMG/M
3300009076|Ga0115550_1170135All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium750Open in IMG/M
3300009080|Ga0102815_10468819All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium703Open in IMG/M
3300009086|Ga0102812_10037445All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2738Open in IMG/M
3300009124|Ga0118687_10309845All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium596Open in IMG/M
3300009426|Ga0115547_1118006All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium864Open in IMG/M
3300009433|Ga0115545_1154103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Carnobacteriaceae → Marinilactibacillus → Marinilactibacillus psychrotolerans801Open in IMG/M
3300009434|Ga0115562_1085124All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1287Open in IMG/M
3300009435|Ga0115546_1034882All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2016Open in IMG/M
3300009438|Ga0115559_1089778All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1219Open in IMG/M
3300009442|Ga0115563_1324674Not Available557Open in IMG/M
3300009443|Ga0115557_1090512All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1304Open in IMG/M
3300009449|Ga0115558_1437024Not Available507Open in IMG/M
3300009495|Ga0115571_1046525All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2028Open in IMG/M
3300010149|Ga0098049_1103071All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium892Open in IMG/M
3300010392|Ga0118731_111606856All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1005Open in IMG/M
3300017697|Ga0180120_10214084Not Available794Open in IMG/M
3300017697|Ga0180120_10319711All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium618Open in IMG/M
3300017706|Ga0181377_1002068All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium6256Open in IMG/M
3300017719|Ga0181390_1039406All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1436Open in IMG/M
3300017727|Ga0181401_1131003Not Available621Open in IMG/M
3300017742|Ga0181399_1000115All Organisms → cellular organisms → Bacteria27638Open in IMG/M
3300017749|Ga0181392_1113720All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium803Open in IMG/M
3300017783|Ga0181379_1068292All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1333Open in IMG/M
3300018041|Ga0181601_10303288All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium885Open in IMG/M
3300018048|Ga0181606_10273588All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium944Open in IMG/M
3300020165|Ga0206125_10025718All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium3353Open in IMG/M
3300020174|Ga0181603_10168973All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium932Open in IMG/M
3300020191|Ga0181604_10307067All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium718Open in IMG/M
3300021375|Ga0213869_10009088All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria6039Open in IMG/M
3300021957|Ga0222717_10073325All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2177Open in IMG/M
3300021960|Ga0222715_10693497Not Available514Open in IMG/M
3300022072|Ga0196889_1002717All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium4425Open in IMG/M
3300022178|Ga0196887_1080849All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium760Open in IMG/M
3300024231|Ga0233399_1016239All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2333Open in IMG/M
3300024319|Ga0228670_1014539All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2126Open in IMG/M
3300024346|Ga0244775_10255500All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1460Open in IMG/M
(restricted) 3300024517|Ga0255049_10315314All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium719Open in IMG/M
(restricted) 3300024518|Ga0255048_10236535All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium889Open in IMG/M
(restricted) 3300024518|Ga0255048_10599195All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium532Open in IMG/M
(restricted) 3300024529|Ga0255044_10247721All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium715Open in IMG/M
3300025070|Ga0208667_1013800All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1744Open in IMG/M
3300025084|Ga0208298_1032866Not Available1078Open in IMG/M
3300025085|Ga0208792_1023525All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1264Open in IMG/M
3300025543|Ga0208303_1055730All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium943Open in IMG/M
3300025617|Ga0209138_1132789All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium668Open in IMG/M
3300025617|Ga0209138_1156716Not Available576Open in IMG/M
3300025632|Ga0209194_1029962All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1733Open in IMG/M
3300025671|Ga0208898_1102729All Organisms → cellular organisms → Bacteria → Proteobacteria864Open in IMG/M
3300025809|Ga0209199_1163112All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium817Open in IMG/M
3300025853|Ga0208645_1175296All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctxc31786Open in IMG/M
3300027612|Ga0209037_1102398Not Available699Open in IMG/M
3300027833|Ga0209092_10000417All Organisms → cellular organisms → Bacteria41189Open in IMG/M
(restricted) 3300027837|Ga0255041_10173442All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium751Open in IMG/M
(restricted) 3300027861|Ga0233415_10314340Not Available741Open in IMG/M
(restricted) 3300027996|Ga0233413_10117524All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1083Open in IMG/M
(restricted) 3300028045|Ga0233414_10206911All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium883Open in IMG/M
3300028133|Ga0228609_1045703All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1206Open in IMG/M
3300029632|Ga0135266_101659All Organisms → cellular organisms → Bacteria → Proteobacteria1133Open in IMG/M
3300031539|Ga0307380_10191003All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1987Open in IMG/M
3300031565|Ga0307379_10031242All Organisms → cellular organisms → Bacteria → Proteobacteria6407Open in IMG/M
3300031673|Ga0307377_10053631All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium3409Open in IMG/M
3300032254|Ga0316208_1074796Not Available914Open in IMG/M
3300032255|Ga0316209_1100463All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium779Open in IMG/M
3300032373|Ga0316204_10920646All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium621Open in IMG/M
3300032373|Ga0316204_11133189Not Available548Open in IMG/M
3300034374|Ga0348335_024409All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2806Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous17.00%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine14.00%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine14.00%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater7.00%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater6.00%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine6.00%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat4.00%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater4.00%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh4.00%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil3.00%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.00%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine2.00%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.00%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine2.00%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.00%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine2.00%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine1.00%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment1.00%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water1.00%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.00%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.00%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine1.00%
Marine HarborEnvironmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor1.00%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment1.00%
WaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Water1.00%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000928Marine plume microbial communities from the Columbia River - 25 PSUEnvironmentalOpen in IMG/M
3300001352Pelagic Microbial community sample from North Sea - COGITO 998_met_07EnvironmentalOpen in IMG/M
3300003410Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNAEnvironmentalOpen in IMG/M
3300003580Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNAEnvironmentalOpen in IMG/M
3300003908Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_125SG_5_DNAEnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004461Marine viral communities from Newfoundland, Canada BC-2EnvironmentalOpen in IMG/M
3300005068Microbial Community from Halfdan Field MHDA13EnvironmentalOpen in IMG/M
3300005612Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2EnvironmentalOpen in IMG/M
3300005837Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18EnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300006990Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaGEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300009074Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430EnvironmentalOpen in IMG/M
3300009076Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009124Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsfEnvironmentalOpen in IMG/M
3300009426Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420EnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300009438Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506EnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009443Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421EnvironmentalOpen in IMG/M
3300009449Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426EnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300018041Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018048Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020174Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041409US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020191Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300024231Seawater microbial communities from Monterey Bay, California, United States - 43DEnvironmentalOpen in IMG/M
3300024319Seawater microbial communities from Monterey Bay, California, United States - 85DEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024517 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3EnvironmentalOpen in IMG/M
3300024518 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2EnvironmentalOpen in IMG/M
3300024529 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21EnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025085Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025617Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025632Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025809Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300027612Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_125SG_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027837 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300027996 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MGEnvironmentalOpen in IMG/M
3300028045 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MGEnvironmentalOpen in IMG/M
3300028133Seawater microbial communities from Monterey Bay, California, United States - 10DEnvironmentalOpen in IMG/M
3300029632Marine harbor viral communities from the Pacific Ocean - SMB3EnvironmentalOpen in IMG/M
3300031539Soil microbial communities from Risofladan, Vaasa, Finland - UN-3EnvironmentalOpen in IMG/M
3300031565Soil microbial communities from Risofladan, Vaasa, Finland - UN-2EnvironmentalOpen in IMG/M
3300031673Soil microbial communities from Risofladan, Vaasa, Finland - TR-3EnvironmentalOpen in IMG/M
3300032254Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month chalcopyriteEnvironmentalOpen in IMG/M
3300032255Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month chalcopyriteEnvironmentalOpen in IMG/M
3300032373Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2EnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1004356133300000101MarineLTEFDDKAAMDLEDDDLIMAVYWSDIFRACAIEFDPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQLTEVRSDADVLH*
DelMOSpr2010_1006711733300000116MarineVTEFDDSGDMNLQDEDLIMAIYWSDILRACAIEFEPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH*
OpTDRAFT_1003848793300000928Freshwater And MarineVSEFDDKAAMDLEDDDLVMAIYWSDLFKACAIEFEQGFMQPHTVEERMRVQEVIVATMQCLEHALLRLDDQIVEVRSGADLLH*
JGI20157J14317_1023570723300001352Pelagic MarineFDDKAAMDLEDDDLIMAVYWSDIFRACAIEFEPDFMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH*
JGI26086J50260_111158423300003410MarineLTEFDDSGDMNLXDEDLIMAIYWSDILRACAIEFEPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLX*
JGI26260J51721_104388423300003580MarineVTEFDDKAAMDLEDEDLVMAIYWSDIFRACAIEFEPDLMQPRTVEERMRVQEIIVTTMQCLEHALLRLDDQIVEVRSDADVLH*
JGI26085J52751_103855413300003908MarineTEFDDSGDMNLQDEDLIMAIYWSDILRACAIEFEPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH*
Ga0065861_106706913300004448MarineTEFDDKAAMDLEDEDLIMAIYWSDIFRACAIEFEPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH*
Ga0066223_104660813300004461MarineLTEFDDKAAMDLEDEDLIMAIYWSDIFRACAIEFEPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH*
Ga0070769_129801613300005068WaterVTDFDDKAAMDLEADDLVMAIYWSDIFKACAIEFEQGFMQPRTVEERMRVQEIIVAAMQCLEHALLRLDDQITEVRSDADVLH*
Ga0070723_1042424513300005612Marine SedimentVTDFDDKAAMDLEDDDLVMAIYWSDIFKACAIEFEQGFMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH*
Ga0078893_1471594213300005837Marine Surface WaterVTEFDDKAAMDLEDDDLIMAVYWSDIFRACAIEFEPGFMQPRTVEERMRVQEVIVATMRCLEHALVRLDDQMVEVRSGA
Ga0070742_1009081623300005942EstuarineVTEFDDKAAMDLEDEDLIMAIYWSDIFRACAIEFEPGLMQPRTVEERMRVQEVIVATMQCLEHALVRLDDQMVEVRSGAELLH*
Ga0075466_101888323300006029AqueousLTEFDDSGDMNLEDEDLIMAVYWSDILRACAIEFEPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITGVRSDADVLH*
Ga0098048_102127933300006752MarineLTDFDDKAAMDLEDEDLIMAVYWSDIFRACAIEFQPDLMQPRTVEERMRVQEVIVATMQCLEHALVRLDGQMVEVRSGEELLH*
Ga0098054_117689613300006789MarineVTDFDDKAAMDLEDEDLIMAVYWSDIFRACAIEFQPDLMQPRTVEERMRVQEVIVATMQCLEHALVRLDGQMVAVRSGEELLH*
Ga0098055_133389623300006793MarineVTEFDDKAAMDLEDEDLIMAVYWSDIFRACAIEFQPDLMQPRTVEERMRVQEVIVATMQCLEHALVRLDGQMVEVRSGEELLH*
Ga0070749_1013962823300006802AqueousLTEFDDKAAMDLEDDDLIMAVYWSDIFRACAIEFDPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH*
Ga0075467_1020714533300006803AqueousLTEFDDSGDMNLEDEDLIMAVYWSDILRACAIEFEPGLMQPRTVEERMRVQEIIVATMQCLEHALLRL
Ga0075467_1044007523300006803AqueousLTEFDDKAAMDLEDEDLIMAVYWSDIFRACAIEFEPELMQPRTVEERMRVQEIIVATMQCLEHALVRLDDQIVEVRSGAELLH*
Ga0070754_1009521623300006810AqueousLTEFDDSGDMNLQDEDLIMAIYWSDILRACAIEFEPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH*
Ga0070754_1014899123300006810AqueousVTEFDDKAAMDLEDDDLIMAIYWSDIFRACAIEFEPGFMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH*
Ga0075481_1016951513300006868AqueousAMDLEDDDLIMAIYWSDIFRACAIEFEPGFMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH*
Ga0070748_107512923300006920AqueousVTEFDDSGDMNLQDEDLIMAVYWSDIFRACAIEFDPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH*
Ga0098045_100819523300006922MarineMDLEDEDLIMAVYWSDIFRACAIEFEQGFMQPRTVEERMRVQEVIVATMQCLEHALVRLDDQIVEVRSGEELLH*
Ga0098045_104646833300006922MarineVTEFDDKAAMDLEDEDLIMAVYWSDIFRACAIEFQHDLMQPRTVEERMRVQEVIVATMQCLEHALVRLDGQMVEERSGEE
Ga0098051_101040643300006924MarineVTEFDDKAAMDLEDEDLIMAVYWSDIFRACAIEFQPDLMQPRTVEERMRVQEVIVATMQCLEHALVRLDDQIVEVRSGEELLH*
Ga0098050_102222423300006925MarineLTDFDDKAAMDLEDEDLIMAVYWSDIFRACAIEFEQGFMQPRTVEERMRVQEVIVATMQCLEHALVRLDDQIVEVRSGEELLH*
Ga0098046_100633633300006990MarineVTDFDDKAAMDLEDEDLIMAVYWSDIFRACAIEFQPDLMQPRTVEERMRVQEVIVATMQCLEHALVRLDDQIVEVRSGEELLH*
Ga0075468_1023195923300007229AqueousLTEFDDKAAMDLEDEDLIMAIYWSDILSACAIEFEPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH*
Ga0099847_107122013300007540AqueousLTEFDDSGDMNLQDEDLIMAIYWSDILRACAIEFEPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRS
Ga0099847_107581313300007540AqueousVTEFDDSGSMDLQDEDLIMAIYWSDILRACAIEFEPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRS
Ga0115549_101180013300009074Pelagic MarineEDLIMAVYWSDIFRACAIEFEPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH*
Ga0115550_110080123300009076Pelagic MarineNLQDEDLIMAIYWSDILRACAIEFEPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH*
Ga0115550_117013523300009076Pelagic MarineNLQDEDLIMAIYWSDILRACAIEFEPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQIMEVRSDADVLH*
Ga0102815_1046881923300009080EstuarineDKAAMDLEDEDLIMAVYWSDIFRACAIEFEPDLMQPRTVEERMRVQEVIVATMQCLEHALVRLDDQMVEVRSGAELLH*
Ga0102812_1003744523300009086EstuarineVTEFDDKAAMDLEDEDLVMAIYWSDIFRACAIEFEPGLMQPRTVEERMRVQEVIVATMQCLEHALVRLDDQMVEVRSGAEMLH*
Ga0118687_1030984523300009124SedimentLTEFDDKAAMDLEDEDLIMAIYWSDILRACAIEFEPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH*
Ga0115547_111800623300009426Pelagic MarineVTAFDGSGDMNLQDEDLIMAVYWSDILRACAIEFEPELMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQIMEVRSDADVLH*
Ga0115545_115410323300009433Pelagic MarineVTEFDDKAAMDLEDEDLIMAVYWSDILRACAIEFEPELMQPRTVEERMRVQEIIVATMQCLEHALLRRDDQIVEVRSDYDVLH*
Ga0115562_108512413300009434Pelagic MarineLTEFDDKAAMDLEDDDLIMAVYWSDIFRACAIEFEPDFMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDAD
Ga0115546_103488233300009435Pelagic MarineVTEFDGSGDMNLQDEDLIMAVYWSDILRACAIEFEPELMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH*
Ga0115559_108977813300009438Pelagic MarineGAVTEFDDSGDMNLQDEDLIMAIYWSDILRACAIEFEPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDGQITEVRSDADVLH*
Ga0115563_132467423300009442Pelagic MarineLTEFDDKAAMDLEDDDLIMAVYWSDIFRACAIEFEPDFMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH*
Ga0115557_109051213300009443Pelagic MarineLTAFDDSGDINLEDEDLIMAIYWSDILRACAIEFEPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDGQITEVRSDADVLH*
Ga0115558_143702413300009449Pelagic MarineGRGRVDHRRGGGRLTAFDDSGDINLEDEDLIMAIYWSDILRACAIEFEPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDGQITEVRSDADVLH*
Ga0115571_104652533300009495Pelagic MarineLTEFDSSGDMNLQDEDLIMAIYWSDILRACAIEFEPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH*
Ga0098049_110307113300010149MarineLTDFDDKAAMDLEDEDLIMAVYWSDIFRACAIEFEQGFMQPRTVEERMRVQEVIVATMQCLEHALVRLDDQIVE
Ga0118731_11160685613300010392MarineAMDLEDDDLVMAIYWSDIFKACAIEFEQGFMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH*
Ga0180120_1021408413300017697Freshwater To Marine Saline GradientVTEFDDSGSMDLQDEDLIMAIYWSDILRACAIEFEPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH
Ga0180120_1031971113300017697Freshwater To Marine Saline GradientVTEFDDSGDMNLQDEDLIMAVYWSDIFRACAIEFDPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH
Ga0181377_100206833300017706MarineVIDFDDSGPMDLNDEDLIMAIYWSDIFNACAVEFTPGLMQPRTIEERKRVQQVIVAAMNCMEQALVRLDDQLVEVRSDAELLH
Ga0181390_103940623300017719SeawaterVTEFDDKAAMDLEDEDLIMAVYWSDIFRACAIEFEPGLMQPRTVEERMRVQEVIVATMQCLEHALVRLDGQMVEVRSGAELLH
Ga0181401_113100313300017727SeawaterVTEFDDKAAMDLEDEDLIMAVYWSDIFRACAIEFQPDLMQPRTVEERMRVQEVIVATMQCLEHALVRLDDQMVEVRSGAELLH
Ga0181399_1000115293300017742SeawaterLTEFDDKAAMDLEDDDLIMAVYWSDIFRACAIEFEPDFMQPRTVEERMRVQEVIVATMQCLEHALVRLDDQMVEVRSGAELLH
Ga0181392_111372023300017749SeawaterVIEFDDKAAMDLEDEDLIMAVYWSDIFRACAIEFQPDLMQPRTVEERMRVQEIIVATMQCLEHALVRLDDQIVEVRSGAELLH
Ga0181379_106829213300017783SeawaterVIEFDDKAAMDLEDEDLIMAVYWSDIFRACAIEFQPDLMQPRTVEERMRVQEIIVATMQCLEHALVRLDDQMVEVRSGAELLH
Ga0181601_1030328813300018041Salt MarshLTEFDDKAAMDLEDDDLIMAVYWSDIFRACAIEFEPDFMQPRTVEERMRGQEIIVATVQCLEHALLRLDVQITEVRSDADVLH
Ga0181606_1027358823300018048Salt MarshLTEFDDKAAMDLEDDDLIMAVYWSDIFRACAIEFERGFMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQLTEVRSDADVLH
Ga0206125_1002571843300020165SeawaterLTEFDDKAAMDLEDDDLIMAVYWSDIFRACAIEFEPDFMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH
Ga0181603_1016897323300020174Salt MarshLTEFDDKAAMDLEDDDLIMAVYWSDIFRACAIEFEQGFMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQLTEVRSDADVLH
Ga0181604_1030706723300020191Salt MarshLTEFDDKAAMDLEDDDLIMAVYWSDIFRACAIEFEQGFMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQLTEVRSDA
Ga0213869_1000908833300021375SeawaterLTEFDDKAAMDLEDDDLVMAVYWSDIFRACAIEFEPDFMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH
Ga0222717_1007332523300021957Estuarine WaterVTEFDDKAAMDLEDEDLIMAIYWSDIFRACAIEFEPGLMQPRTVEERMRVQEVIVATMQCLEHALVRLDGQMVEVRSGAELLH
Ga0222715_1069349713300021960Estuarine WaterLTEFNDRAAMDLEDEDLIMAIYWSDILRACAIEFDPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH
Ga0196889_100271723300022072AqueousLTEFDDSGDMNLEDEDLIMAVYWSDILRACAIEFEPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITGVRSDADVLH
Ga0196887_108084923300022178AqueousLTEFDDKAAMDLEDEDLIMAVYWSDIFRACAIEFEPELMQPRTVEERMRVQEIIVATMQCLEHALVRLDDQIVEVRSGAELLH
Ga0233399_101623933300024231SeawaterVTEFDDKAAMDLEDEDLVMAIYWSDIFRACAIEFEPGLMQPRTVEERMRVQEVIVATMQCLEHALVRLDGQMVEVRSGAELLH
Ga0228670_101453923300024319SeawaterVTEFDDKAAMDLEDEDLIMAVYWSDIFRACAIEFQPDLMQPRTVEERMRVQEIIVATMQCLEHALVRLDDQMVEVRSGAELLH
Ga0244775_1025550023300024346EstuarineVTEFDDKAAMDLEDEDLIMAIYWSDIFRACAIEFQPGLMQPRTVEERMRVQEVIVATMQCLEHALVRLDDQMVEVRSGAELLH
(restricted) Ga0255049_1031531423300024517SeawaterLTEFDDKAAMDLEDDDLIMAVYWSDIFRACAIEFEQGFMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH
(restricted) Ga0255048_1023653523300024518SeawaterVTEFDDKAAMDLEDEDLVMAIYWSDIFRACAIEFEPGLMQPRTVEERMRVQEVIVATMQCLEHALLRLDDQIVEVRSDADVLH
(restricted) Ga0255048_1059919523300024518SeawaterLTEFDDKAAMDLEDDDLIMAVYWSDILRACAIEFEPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH
(restricted) Ga0255044_1024772113300024529SeawaterGGRGRVDHWRRGGAVTEFDDKAAMDLEDEDLIMAIYWSDIFRACAIEFEPGLMQPRTVEERMRVQEIIVATMQCLEHALVRLDDQIVEVRSGAELLH
Ga0208667_101380023300025070MarineVTDFDDKAAMDLEDEDLIMAVYWSDIFRACAIEFQPDLMQPRTVEERMRVQEVIVATMQCLEHALVRLDGQMVEVRSGEELLH
Ga0208298_103286613300025084MarineVTEFDDKAAMDLEDEDLIMAVYWSDIFRACAIEFQPDLMQPRTVEERMRVQEVIVATMQCLEHALVRLDGQMVEVRSGEELLH
Ga0208792_102352523300025085MarineLTDFDDKAAMDLEDEDLIMAVYWSDIFRACAIEFEQGFMQPRTVEERMRVQEVIVATMQCLEHALVRLDDQIVEVRSGEELLH
Ga0208303_105573023300025543AqueousLTEFDDSGDMNLQDEDLIMAIYWSDILRACAIEFEPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH
Ga0209138_113278913300025617MarineMDLEDEDLIMAIYWSDIFRACAIEFEPGLMQPRTVEERMRVQEIIVATMQCLEHALVRLDDQIVEVRSGAELLH
Ga0209138_115671613300025617MarineLTEFDDSGDMNLEDEDLIMAIYWSDILRACAIEFEPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH
Ga0209194_102996223300025632Pelagic MarineVTEFDGSGDMNLQDEDLIMAVYWSDILRACAIEFEPELMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH
Ga0208898_110272923300025671AqueousVTEFDDKAAMDLEDDDLIMAIYWSDIFRACAIEFEPGFMQPRTVEEPMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH
Ga0209199_116311213300025809Pelagic MarineGRLTEFDDKAAMDLEDDDLIMAVYWSDIFRACAIEFEPDFMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH
Ga0208645_117529613300025853AqueousVTEFDDKAAMDLEDDDLIMAIYWSDILRACAIEFEPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH
Ga0209037_110239813300027612MarineVTEFDDSGDMNLQDEDLIMAIYWSDILRACAIEFEPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH
Ga0209092_1000041783300027833MarineVTDFDDKAAMDLEDDDLVMAIYWSDIFKACAIEFEQGFMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH
(restricted) Ga0255041_1017344213300027837SeawaterVTEFDDKAAMDLEDEDLIMAIYWSDIFRACAIEFEPGLMQPRTVEERMRVQEIIVATMQCLEHALVRLDDQIVEVRSGAELLH
(restricted) Ga0233415_1031434023300027861SeawaterVTEFDDEAAMDLEDEDLIMAIYWSDIFRACAIEFKPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQIVEVRSDADVLH
(restricted) Ga0233413_1011752423300027996SeawaterVTEFDDKAAMDLEDEDLVMAIYWSDIFRACAIEFEPGLMQPRTVEERMRVQEIIVTTMQCLEHALLRLDDQITEVRSDADVLH
(restricted) Ga0233414_1020691123300028045SeawaterVTEFDDKAAMDLEDEDLIMAVYWSDIFRACAIEFEPDLMQPRTVEERMRVQEVIVATMQCLEHALVRLDDQMVEVRSGAEMLH
Ga0228609_104570333300028133SeawaterVTEFDDKAAMDLEDEDLIMAIYWSDIFRACAIEFEPGLMQPRTVEERMRVQEVIVATMQCLEHALVRLDGQMVEVRS
Ga0135266_10165913300029632Marine HarborVTEFDDKAAMDLEDEDLVMAIYWSDIFRACAIEFEPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQIVEVRSGAELLH
Ga0307380_1019100333300031539SoilLTAFDDNGDINLQDEDLIMAIYWSDILRACAIEFEPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITELRSDADVLH
Ga0307379_1003124233300031565SoilLTAFDDSGDINLQDEDLIMAIYWSDILRACAIEFEPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITELRSDADVLH
Ga0307377_1005363113300031673SoilGDINLQDEDLIMAIYWSDILRACAIEFEPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITELRSDADVLH
Ga0316208_107479613300032254Microbial MatVIEFDESGQMDLDDDDLIMAIYWSDIFRACAVEFTPGLMHPRTIEERKRVQEVIVAAMQCMEQALVRLDGQLVEVRSDAELLH
Ga0316209_110046323300032255Microbial MatLTEFDDKAAMDLEDDDLIMAVYWSDIFRACAIEFEPGFMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH
Ga0316204_1092064613300032373Microbial MatLTEFDDKAAMDLEDDDLIMAVYWSDIFRACAIEFDPGLMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDAELLH
Ga0316204_1113318913300032373Microbial MatDHRRGGGRLTEFDDKAAMDLEDDDLIMAVYWSDIFRACAIEFEQGFMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQLTEVRSDADVLH
Ga0348335_024409_1561_18123300034374AqueousVTEFDDKAAMDLEDDDLIMAIYWSDIFRACAIEFEPGFMQPRTVEERMRVQEIIVATMQCLEHALLRLDDQITEVRSDADVLH

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.