| Basic Information | |
|---|---|
| Family ID | F104943 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 44 residues |
| Representative Sequence | EDGQNVLLELMKEGVRFRSSGVFTKHVMKRLARKIRRNVQEPER |
| Number of Associated Samples | 73 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 10.00 % |
| % of genes near scaffold ends (potentially truncated) | 91.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.00 % |
| Associated GOLD sequencing projects | 71 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (39.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (69.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.50% β-sheet: 2.78% Coil/Unstructured: 59.72% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF02321 | OEP | 14.00 |
| PF13581 | HATPase_c_2 | 10.00 |
| PF16576 | HlyD_D23 | 8.00 |
| PF13533 | Biotin_lipoyl_2 | 7.00 |
| PF03544 | TonB_C | 4.00 |
| PF07992 | Pyr_redox_2 | 2.00 |
| PF13481 | AAA_25 | 1.00 |
| PF13589 | HATPase_c_3 | 1.00 |
| PF03693 | ParD_antitoxin | 1.00 |
| PF01381 | HTH_3 | 1.00 |
| PF00582 | Usp | 1.00 |
| PF01695 | IstB_IS21 | 1.00 |
| PF07885 | Ion_trans_2 | 1.00 |
| PF00296 | Bac_luciferase | 1.00 |
| PF13590 | DUF4136 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 28.00 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 4.00 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 1.00 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.00 |
| COG3609 | Transcriptional regulator, contains Arc/MetJ-type RHH (ribbon-helix-helix) DNA-binding domain | Transcription [K] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.00 % |
| Unclassified | root | N/A | 16.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_101536183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300002909|JGI25388J43891_1000456 | All Organisms → cellular organisms → Bacteria | 8133 | Open in IMG/M |
| 3300005171|Ga0066677_10029544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2613 | Open in IMG/M |
| 3300005446|Ga0066686_10089405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1965 | Open in IMG/M |
| 3300005541|Ga0070733_10748917 | Not Available | 656 | Open in IMG/M |
| 3300005554|Ga0066661_10063073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2149 | Open in IMG/M |
| 3300005576|Ga0066708_10215831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1209 | Open in IMG/M |
| 3300005586|Ga0066691_10572338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300005591|Ga0070761_10329336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 922 | Open in IMG/M |
| 3300005598|Ga0066706_10623676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 856 | Open in IMG/M |
| 3300005610|Ga0070763_10402990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 769 | Open in IMG/M |
| 3300005610|Ga0070763_10835176 | Not Available | 546 | Open in IMG/M |
| 3300005921|Ga0070766_10291684 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300005921|Ga0070766_11076356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 554 | Open in IMG/M |
| 3300006755|Ga0079222_10141349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1351 | Open in IMG/M |
| 3300007258|Ga0099793_10424722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
| 3300007265|Ga0099794_10712610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300009012|Ga0066710_101982986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 865 | Open in IMG/M |
| 3300009089|Ga0099828_10779636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 857 | Open in IMG/M |
| 3300011120|Ga0150983_11684724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 874 | Open in IMG/M |
| 3300012199|Ga0137383_10061413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2698 | Open in IMG/M |
| 3300012351|Ga0137386_11088478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300012582|Ga0137358_10591392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 745 | Open in IMG/M |
| 3300012685|Ga0137397_11120539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300012685|Ga0137397_11140034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300012917|Ga0137395_10065020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2339 | Open in IMG/M |
| 3300012917|Ga0137395_10207334 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300012918|Ga0137396_10442824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 963 | Open in IMG/M |
| 3300012923|Ga0137359_10624179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 944 | Open in IMG/M |
| 3300012925|Ga0137419_10825336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 760 | Open in IMG/M |
| 3300012927|Ga0137416_11325198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300012930|Ga0137407_11566574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300012975|Ga0134110_10066510 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300014501|Ga0182024_11971082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300015051|Ga0137414_1209063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300015052|Ga0137411_1048139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2105 | Open in IMG/M |
| 3300015053|Ga0137405_1203640 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300018431|Ga0066655_10002469 | All Organisms → cellular organisms → Bacteria | 7003 | Open in IMG/M |
| 3300020579|Ga0210407_10070139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2631 | Open in IMG/M |
| 3300020579|Ga0210407_10277929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1306 | Open in IMG/M |
| 3300020579|Ga0210407_10395728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1081 | Open in IMG/M |
| 3300020581|Ga0210399_10367844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1200 | Open in IMG/M |
| 3300020581|Ga0210399_10461878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1057 | Open in IMG/M |
| 3300020582|Ga0210395_10155418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1708 | Open in IMG/M |
| 3300020582|Ga0210395_10373877 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300020583|Ga0210401_10542185 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300021046|Ga0215015_10934893 | Not Available | 513 | Open in IMG/M |
| 3300021088|Ga0210404_10679844 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300021088|Ga0210404_10687304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300021168|Ga0210406_10709228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
| 3300021171|Ga0210405_10425171 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300021178|Ga0210408_10315070 | Not Available | 1247 | Open in IMG/M |
| 3300021178|Ga0210408_10476730 | Not Available | 993 | Open in IMG/M |
| 3300021178|Ga0210408_11293975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300021180|Ga0210396_11099880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300021181|Ga0210388_10477992 | Not Available | 1094 | Open in IMG/M |
| 3300021181|Ga0210388_11808391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300021401|Ga0210393_10621596 | Not Available | 882 | Open in IMG/M |
| 3300021403|Ga0210397_10315261 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1152 | Open in IMG/M |
| 3300021403|Ga0210397_10627363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 823 | Open in IMG/M |
| 3300021420|Ga0210394_11570118 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300021420|Ga0210394_11635375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300021432|Ga0210384_11809557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300021432|Ga0210384_11843984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 510 | Open in IMG/M |
| 3300021432|Ga0210384_11859392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300021433|Ga0210391_10419249 | Not Available | 1051 | Open in IMG/M |
| 3300021433|Ga0210391_10782900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 746 | Open in IMG/M |
| 3300021478|Ga0210402_10774585 | Not Available | 884 | Open in IMG/M |
| 3300021559|Ga0210409_10416344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1201 | Open in IMG/M |
| 3300021559|Ga0210409_10570246 | Not Available | 999 | Open in IMG/M |
| 3300021559|Ga0210409_10691548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 891 | Open in IMG/M |
| 3300021559|Ga0210409_11100837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300021559|Ga0210409_11488549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300021559|Ga0210409_11728553 | Not Available | 502 | Open in IMG/M |
| 3300026329|Ga0209375_1223041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300026335|Ga0209804_1001925 | All Organisms → cellular organisms → Bacteria | 12942 | Open in IMG/M |
| 3300026356|Ga0257150_1035826 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300026475|Ga0257147_1012850 | Not Available | 1125 | Open in IMG/M |
| 3300027648|Ga0209420_1161404 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300027855|Ga0209693_10338414 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300027889|Ga0209380_10694964 | Not Available | 584 | Open in IMG/M |
| 3300027895|Ga0209624_10438975 | Not Available | 870 | Open in IMG/M |
| 3300028906|Ga0308309_10340977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum | 1276 | Open in IMG/M |
| 3300029636|Ga0222749_10335872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 788 | Open in IMG/M |
| 3300029636|Ga0222749_10731090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300031474|Ga0170818_104987670 | All Organisms → cellular organisms → Bacteria | 2002 | Open in IMG/M |
| 3300031715|Ga0307476_11259948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 540 | Open in IMG/M |
| 3300031720|Ga0307469_12324228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300031744|Ga0306918_10909478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
| 3300031753|Ga0307477_10361358 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300031753|Ga0307477_10453913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 874 | Open in IMG/M |
| 3300031754|Ga0307475_10381783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1132 | Open in IMG/M |
| 3300031754|Ga0307475_10628314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 859 | Open in IMG/M |
| 3300031823|Ga0307478_11697680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300031912|Ga0306921_12450439 | Not Available | 543 | Open in IMG/M |
| 3300031962|Ga0307479_10414180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_56_11 | 1332 | Open in IMG/M |
| 3300031962|Ga0307479_10680616 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300032174|Ga0307470_10446756 | Not Available | 928 | Open in IMG/M |
| 3300032180|Ga0307471_100591491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1268 | Open in IMG/M |
| 3300032180|Ga0307471_104310057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 39.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 12.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 8.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.00% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1015361831 | 3300002245 | Forest Soil | NVLLELMKEKARFRSGVFTKQVLKRLARNIRRNVQEEKK* |
| JGI25388J43891_10004566 | 3300002909 | Grasslands Soil | VIELRSVTCISEDGQNVLLELMKEGVTFRSSGVFRKHVMKQLARKIR* |
| Ga0066677_100295441 | 3300005171 | Soil | VTCISEDGQNVLLELMKEGVTFRSSGVFRKHVMKQLARKIR* |
| Ga0066686_100894054 | 3300005446 | Soil | LVIELRNVTCISEDGQNVLLELMKEGVRFRSSGVFTKHVMKQLARKIR* |
| Ga0070733_107489172 | 3300005541 | Surface Soil | MAVSFVINLEGLTAITKDGENILLELMQEGSSFRSSGVFTKQVLERLACVIRGNVQEAKT |
| Ga0066661_100630731 | 3300005554 | Soil | MKEGVRFRSSGVFTKHVMKRLAHKIRRNVKEPER* |
| Ga0066708_102158313 | 3300005576 | Soil | VIELRSVTCISEDGQNVLLELMKEGVTFRSSGVFRKHVMKQL |
| Ga0066691_105723384 | 3300005586 | Soil | MKEGVRFRSSGMFTKHVMKRLAHNIRGNVKEPGR* |
| Ga0070761_103293361 | 3300005591 | Soil | EDGENVLLELMKEGASFRSSGVFTKQILKRMARKIRQDV* |
| Ga0066706_106236763 | 3300005598 | Soil | VIELRSVTCISEDGQNVLLELMKEGVRFRSSGVFRKHVMKQLARKIR* |
| Ga0070763_104029903 | 3300005610 | Soil | LRNVTCISEDGQNVLLELMKEGVRFRSSGVFTKHVIKQLARKIRRNVQEPER* |
| Ga0070763_108351761 | 3300005610 | Soil | NVLLELMKEGASFRSSGVFTKHVLKRLACKIRREV* |
| Ga0070766_102916841 | 3300005921 | Soil | ENVLLELMKEGASFRSSGVFTRQVLKRMARKIHRDV* |
| Ga0070766_110763562 | 3300005921 | Soil | MKAGVRFRSSGVFTKQVLKRLARHIRRNVQEEKT* |
| Ga0079222_101413491 | 3300006755 | Agricultural Soil | EDGQNVLLELMKEGVKFRSSGVFTKHVIKQLAGKIRRNVQGPKK* |
| Ga0099793_104247222 | 3300007258 | Vadose Zone Soil | GQNVLLELMKEGVRFRSSGVFTKHVMKQLARKIRRNVQEPKK* |
| Ga0099794_107126101 | 3300007265 | Vadose Zone Soil | GKNVLLELMKGGVRFRSSGVFTKHVMKRLAHKIRRNVK* |
| Ga0066710_1019829861 | 3300009012 | Grasslands Soil | DGENVVLELMKEGARFRSSGVFTKQVLKRLARKVRSDVEEAKR |
| Ga0099828_107796364 | 3300009089 | Vadose Zone Soil | IELRNVTCISEDGQNVLLELMKEGVRFRSSGVFRKHVMKQLARKIR* |
| Ga0150983_116847244 | 3300011120 | Forest Soil | LELMKEGVRFRSSGVFTKHVMKRLAHKIRRNVQEPER* |
| Ga0137383_100614131 | 3300012199 | Vadose Zone Soil | VTCISEDGQNVLLELMKEGVRFRSSGVFTKHVMKQLARKIR* |
| Ga0137386_110884781 | 3300012351 | Vadose Zone Soil | ELRNVTCISEDGQNVLLELMKEGVRFRSSGVFTKHVMKRLAHNIRGNVKEPGR* |
| Ga0137358_105913924 | 3300012582 | Vadose Zone Soil | LLELMKEGVRFRSSGVFTKHVMKQLARRIRRDVQESEG* |
| Ga0137397_111205392 | 3300012685 | Vadose Zone Soil | ELVIELRNVTCISEDGQNVLLELMKEGVRFRSSGVFTKHVMKQLARKIR* |
| Ga0137397_111400342 | 3300012685 | Vadose Zone Soil | ELMKEGVRFRSSGVFTKHVMKQLARRIRRDVQESEG* |
| Ga0137395_100650206 | 3300012917 | Vadose Zone Soil | VTCISEDGQNVLLELMKEVVRFRSSGVFRKHVMKELARKIR* |
| Ga0137395_102073343 | 3300012917 | Vadose Zone Soil | GKNVLLELMKGGVRFRSSGVFTKHVMKRLAHKIRRNVKEPER* |
| Ga0137396_104428241 | 3300012918 | Vadose Zone Soil | GRELEIELRNVTCISEDGKNVLLELMKDGVRFRSSGVFTKHVMKRLARKIRRNVKEPER* |
| Ga0137359_106241791 | 3300012923 | Vadose Zone Soil | LLELMKEGVRFRSSGVFTKHVMKQLARKIRRNVQGPKK* |
| Ga0137419_108253361 | 3300012925 | Vadose Zone Soil | SEDGQNVLLELMKEGVRFRSSGVFTKHVMKQLARRIRRDVQESEG* |
| Ga0137416_113251981 | 3300012927 | Vadose Zone Soil | NVLLELMKEGARFRSSGVFTKHVMKQLARKIRRNVQEPKK* |
| Ga0137407_115665741 | 3300012930 | Vadose Zone Soil | IELRNVTCISEDGQNVLLELMKEGVRFRSSGVFTKHVMKQLARKIR* |
| Ga0134110_100665101 | 3300012975 | Grasslands Soil | VIELRSVTCISEDGQNVLLELMKEGVTFRSSGVFRKHV |
| Ga0182024_119710822 | 3300014501 | Permafrost | SVTEDGENALLELMKEGARFRSGVFTEQVLKRLARKIPRNAQEEKK* |
| Ga0137414_12090631 | 3300015051 | Vadose Zone Soil | CISEDGQNVLLELMKEVVRFRSSGVFRKHVMKELARKIR* |
| Ga0137411_10481394 | 3300015052 | Vadose Zone Soil | ADLRGRELEIELRNVTCISEDGQNVLLELMKEGVRFRSSGVFTKHVMKQLARKIR* |
| Ga0137405_12036402 | 3300015053 | Vadose Zone Soil | VIELRNVTCISEDGQNVLLELMKEGVRFRSSGVFTKHVMKQLARRIRRDVQESEG* |
| Ga0066655_100024694 | 3300018431 | Grasslands Soil | VIELRSVTCISEDGQNVLLELMKEGVTFRSSGVFRKHVMKQLARKIR |
| Ga0210407_100701394 | 3300020579 | Soil | NVLLELMKEGVRFRSSGVFTKHVMKRLAHKIRRNVKEPER |
| Ga0210407_102779291 | 3300020579 | Soil | SVLLELMKEGARFHSSGVFTKQVLKRLARKIRGNVQEEK |
| Ga0210407_103957282 | 3300020579 | Soil | IFVKCLTAITEDGENVLLELMKEGARFHSSGVFTKQVLKRLARKIRGNVQEEK |
| Ga0210399_103678443 | 3300020581 | Soil | VIELRNVTCISEDGQNVLLELMKEGVKFRSSGVFTKHVMKQLARKIRRNVQELER |
| Ga0210399_104618783 | 3300020581 | Soil | ISEDGQNVLLELMKEGVRFRSSGVFTKHVMKRLAHKIRRNVKERRDEDRQY |
| Ga0210395_101554184 | 3300020582 | Soil | EAAADLRDRELVIELRNVTCISEDGKNVLLELMKEGVRFRSSGVFTKHVMKQLAHKIRRS |
| Ga0210395_103738771 | 3300020582 | Soil | TAITEDGENVLLELMKEGASFRSSGVFTKHVLKRLACKIRREFHRKG |
| Ga0210401_105421851 | 3300020583 | Soil | TEDGENILLELMQEAASFRSSGVFTKQVLERLACMTRGNVQEAKT |
| Ga0215015_109348932 | 3300021046 | Soil | VIELRNVTCISEEGKNVLLELMKEGVRFRSSGVFTKHVMKRLAREIRRNVKEPER |
| Ga0210404_106798442 | 3300021088 | Soil | TAITEDGENVLLELMKEGASFRSSGVFTKHVLKRLACKIRRDVS |
| Ga0210404_106873041 | 3300021088 | Soil | NVLLELMKEGVRFRSWGVFTKHVMKRLAHKIRRNVKEPER |
| Ga0210406_107092283 | 3300021168 | Soil | SEDGKNVLLELMKEGVRFRSSGVFTKHVMKRLAHKIRRNVRESER |
| Ga0210405_104251712 | 3300021171 | Soil | GLTAITEDGEQVLLELMKEGAHFRSSGVFTKWVLKCLAIKIRINAREGKR |
| Ga0210408_103150702 | 3300021178 | Soil | NVLLELMKTGVRFRASGVFTKHVVKRLAREIHRNDQEAKR |
| Ga0210408_104767301 | 3300021178 | Soil | AITEDGENVLLELMKEGARFHSSGVFTKQVLKRLARKIRGNVQEEK |
| Ga0210408_112939751 | 3300021178 | Soil | GENVLLELMKEGARFHSSGVFTKQVLKRLARKMRGNVQEEK |
| Ga0210396_110998801 | 3300021180 | Soil | VLLELMKEGARFHSSGVFTKQVLKRLARRIRGNVQEEK |
| Ga0210388_104779922 | 3300021181 | Soil | INDYGENVLQELMKEGASFRSSGVFTKHVLKRLAYKIRRDVS |
| Ga0210388_118083913 | 3300021181 | Soil | NVLLELMKDGVRFRSSGVFTKHVMKRLAHKIPRNVQDPER |
| Ga0210393_106215961 | 3300021401 | Soil | NVLLELMKEGVRFRSSGVFTKHVMKRLALKIRRNVKEPER |
| Ga0210397_103152611 | 3300021403 | Soil | DGENVLLDLMKEGASFRSSGVFTKQVLKRMARKIRRDL |
| Ga0210397_106273633 | 3300021403 | Soil | ELVIELRNVTCISEDGKNVLLELMKEGVRFRSSGVFTKHVMKRLAHKIRRNVQEPER |
| Ga0210394_115701181 | 3300021420 | Soil | ELMKEGVRFRSTGVFTRHVMKRLARKIRRNVQEPKK |
| Ga0210394_116353752 | 3300021420 | Soil | RNVTCISEDGQNVLLELMKEGVRFRSSGVFTRHVMKRLARKIRRNVQEPER |
| Ga0210384_118095573 | 3300021432 | Soil | NVLLELMKEGVRFRSSGVFTKHVMKRLAHKIRGTVKEPER |
| Ga0210384_118439842 | 3300021432 | Soil | ISEDGENVILELMKEGVRFRCSGVFTKDVLKRLARKIRIDGQTEKR |
| Ga0210384_118593921 | 3300021432 | Soil | KGLTAVSEDGENILLELMKERARFRSSGVFTKQVLKRLARKIRRNVQEERK |
| Ga0210391_104192491 | 3300021433 | Soil | DDGENVLQELMKEGASFRSSGVFTKHVLKRLAYKIRRDVS |
| Ga0210391_107829003 | 3300021433 | Soil | ELRSVTCISEDGKNVLLELMKEGVRFRSSGVFTKHVMKQLAHKIRRSV |
| Ga0210402_107745852 | 3300021478 | Soil | DGENVLLELMKEGASFRSSGVFTKHVLKRLAGKIPRDV |
| Ga0210409_104163441 | 3300021559 | Soil | RELVIELRNVTCISEDGQNVLLELMKEGVRFRSSGVFTKHVMKRLAHKIRRNVQEPER |
| Ga0210409_105702461 | 3300021559 | Soil | EKVLMEQMKAGVRFRSSGVFTKQVLKRLARHIRRNVQEEKT |
| Ga0210409_106915481 | 3300021559 | Soil | GLTAFTEDGENVLLELMKEGARFRSSGVFTKQVLKRLARKIRRNVQEEKK |
| Ga0210409_111008371 | 3300021559 | Soil | AISEDGEKVLLELMKEGACFRSSGVFTKHVLKRLARKIRRGI |
| Ga0210409_114885492 | 3300021559 | Soil | LLELMKEGVRFRSSGVFTKHVMKRLAHKIRGTVKEPER |
| Ga0210409_117285531 | 3300021559 | Soil | EDGQNVLLELMKEGVRFRSSGVFTKHVMKRLARKIRRNVQEPER |
| Ga0209375_12230411 | 3300026329 | Soil | EDGENVILELMKEGAPFRSSGVFTKQVLKRLARKVRSDVEEAKR |
| Ga0209804_100192510 | 3300026335 | Soil | VTCISEDGQNVLLELMKEGVRFRSSGVFTKHVMKQLARKIR |
| Ga0257150_10358261 | 3300026356 | Soil | TEDGENVLLELMKEGASFRSSGVFTKQILKRMARKIRQDV |
| Ga0257147_10128501 | 3300026475 | Soil | LLELMKAGACFRCAGVFTKHVLKRLALKIRSNVLEEKA |
| Ga0209420_11614041 | 3300027648 | Forest Soil | TEDGENVLLELMKEGASFRSSGVFTRQVLKRMARKIHRDV |
| Ga0209693_103384142 | 3300027855 | Soil | AITEDGENVLLDLMKEGASFRSSGVFTKQVLKRMARKIRRDP |
| Ga0209380_106949642 | 3300027889 | Soil | IDLKGLTAITEDGENVLLELMKEGASFRSSGVFTKHVLKRLACKIRRDVS |
| Ga0209624_104389752 | 3300027895 | Forest Soil | EDGENVLLELMKEGASFRSSGVFTKQVLKRMTRKFRQDV |
| Ga0308309_103409774 | 3300028906 | Soil | LRNVTCISEDGKNVLLELMKEGVRFRSSGVFTKHVMKRLAHKIRGNVKEPER |
| Ga0222749_103358723 | 3300029636 | Soil | CISEDGQNVLLELMKEGVRFRSSGVFTKHVMKRLARKIRRNVQEPER |
| Ga0222749_107310901 | 3300029636 | Soil | ELMKEGFRFRSSGVFTKHVMKRLARKIHSNVQKPER |
| Ga0170818_1049876701 | 3300031474 | Forest Soil | NVLLDLMKEGVRFRSSGVFTKHVMKRLAHKIRRNVQEQER |
| Ga0307476_112599482 | 3300031715 | Hardwood Forest Soil | LTAITEDGENVLLELMKEGARFHSSGVFARQVLKQLARKIRGNVQEEKR |
| Ga0307469_123242281 | 3300031720 | Hardwood Forest Soil | ALLELMKDGVRFRSSGVFTKHVMKRLSRKIRSNVQEPER |
| Ga0306918_109094782 | 3300031744 | Soil | TAITEDGENVLLELMKEGARFRSAGVFTKHVLKRLARNIRSNAQEVKR |
| Ga0307477_103613583 | 3300031753 | Hardwood Forest Soil | NVLLELMKEGVRFRSTGVFTKHVMKQLARKIRRNVQEPKK |
| Ga0307477_104539131 | 3300031753 | Hardwood Forest Soil | RNVTCISEDGQNVLVELMKEGVRFRSSGVFTKHVMKRLAYKIRRNVQEPVR |
| Ga0307475_103817831 | 3300031754 | Hardwood Forest Soil | ELRNVTCISEDGQKVLLELMQEGVRFRSSGVFTKHVMKRLAREIRRNVKEPEG |
| Ga0307475_106283142 | 3300031754 | Hardwood Forest Soil | ENVLLELMKEGARFHSSGVFTKQVLKRLARKIRGNVQEEK |
| Ga0307478_116976801 | 3300031823 | Hardwood Forest Soil | VADLRGREFVIELRNVTCISEDGQNVLLELMKEGVRFRSSGVFTKHVMKQLARKIRRSVRDPKG |
| Ga0306921_124504392 | 3300031912 | Soil | LRELIKEGARFRSSGVFTKQVLKRLAREICRNFQEAKR |
| Ga0307479_104141802 | 3300031962 | Hardwood Forest Soil | LRNVTCISEDGKNVLLELIKEGVRFRSSGVFTKHVMKRLAHKIRRNVQEPER |
| Ga0307479_106806161 | 3300031962 | Hardwood Forest Soil | EDGENVLLELMKEGASFRSSGVFTKHVLKRLACKIRRDVS |
| Ga0307470_104467562 | 3300032174 | Hardwood Forest Soil | KKGARFHSSGVFTKEVLKRLARKIRREVQEERNEQRS |
| Ga0307471_1005914913 | 3300032180 | Hardwood Forest Soil | CISKDGENVLLELMKEGVRFRSSGVFTKHIMKRLARKSRRNAGEQRDERQY |
| Ga0307471_1043100571 | 3300032180 | Hardwood Forest Soil | ADLRNRELVIELRNVTCISEDGQNVLLELMKEGVRFRSSGVFTKHVMKRLARKIRRNVQEPER |
| ⦗Top⦘ |