Basic Information | |
---|---|
Family ID | F104843 |
Family Type | Metagenome |
Number of Sequences | 100 |
Average Sequence Length | 46 residues |
Representative Sequence | MDSPIIPFQKKKKRNHDVAILLILLAVLLGTFLFVTVAVNLLLRSIPIP |
Number of Associated Samples | 78 |
Number of Associated Scaffolds | 100 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Archaea |
% of genes with valid RBS motifs | 74.00 % |
% of genes near scaffold ends (potentially truncated) | 40.00 % |
% of genes from short scaffolds (< 2000 bps) | 70.00 % |
Associated GOLD sequencing projects | 71 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Archaea (82.000 % of family members) |
NCBI Taxonomy ID | 2157 |
Taxonomy | All Organisms → cellular organisms → Archaea |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (36.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (68.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (71.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 59.18% β-sheet: 0.00% Coil/Unstructured: 40.82% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 100 Family Scaffolds |
---|---|---|
PF01243 | Putative_PNPOx | 5.00 |
PF01037 | AsnC_trans_reg | 5.00 |
PF00583 | Acetyltransf_1 | 3.00 |
PF01546 | Peptidase_M20 | 3.00 |
PF00589 | Phage_integrase | 3.00 |
PF00004 | AAA | 3.00 |
PF07687 | M20_dimer | 3.00 |
PF06745 | ATPase | 2.00 |
PF14528 | LAGLIDADG_3 | 2.00 |
PF04930 | FUN14 | 2.00 |
PF07732 | Cu-oxidase_3 | 1.00 |
PF10604 | Polyketide_cyc2 | 1.00 |
PF04185 | Phosphoesterase | 1.00 |
PF01428 | zf-AN1 | 1.00 |
PF09851 | SHOCT | 1.00 |
PF01022 | HTH_5 | 1.00 |
PF00692 | dUTPase | 1.00 |
PF01053 | Cys_Met_Meta_PP | 1.00 |
PF13181 | TPR_8 | 1.00 |
PF03764 | EFG_IV | 1.00 |
PF03600 | CitMHS | 1.00 |
PF00150 | Cellulase | 1.00 |
PF01596 | Methyltransf_3 | 1.00 |
PF13432 | TPR_16 | 1.00 |
PF13091 | PLDc_2 | 1.00 |
COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
---|---|---|---|
COG2383 | Uncharacterized membrane protein, Fun14 family | Function unknown [S] | 2.00 |
COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 1.00 |
COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 1.00 |
COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 1.00 |
COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 1.00 |
COG3934 | Endo-1,4-beta-mannosidase | Carbohydrate transport and metabolism [G] | 1.00 |
COG3582 | CDC48-associated ubiquitin-like protein CUZ1, contains AN1-type Zn-finger (protection from As/Sb toxicity) | Defense mechanisms [V] | 1.00 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 1.00 |
COG2730 | Aryl-phospho-beta-D-glucosidase BglC, GH1 family | Carbohydrate transport and metabolism [G] | 1.00 |
COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 1.00 |
COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 1.00 |
COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 1.00 |
COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 1.00 |
COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 1.00 |
COG0756 | dUTP pyrophosphatase (dUTPase) | Defense mechanisms [V] | 1.00 |
COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 1.00 |
COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 1.00 |
COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 1.00 |
COG0480 | Translation elongation factor EF-G, a GTPase | Translation, ribosomal structure and biogenesis [J] | 1.00 |
COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 1.00 |
COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 1.00 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 90.00 % |
Unclassified | root | N/A | 10.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001867|JGI12627J18819_10498464 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 501 | Open in IMG/M |
3300002558|JGI25385J37094_10014252 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2850 | Open in IMG/M |
3300002560|JGI25383J37093_10061675 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1185 | Open in IMG/M |
3300002911|JGI25390J43892_10154202 | Not Available | 536 | Open in IMG/M |
3300002912|JGI25386J43895_10000435 | All Organisms → cellular organisms → Archaea | 8253 | Open in IMG/M |
3300002916|JGI25389J43894_1039016 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 817 | Open in IMG/M |
3300005166|Ga0066674_10026989 | All Organisms → cellular organisms → Archaea | 2519 | Open in IMG/M |
3300005167|Ga0066672_10076978 | All Organisms → cellular organisms → Bacteria | 1986 | Open in IMG/M |
3300005167|Ga0066672_10513552 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 777 | Open in IMG/M |
3300005171|Ga0066677_10359321 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 834 | Open in IMG/M |
3300005176|Ga0066679_10950567 | Not Available | 538 | Open in IMG/M |
3300005178|Ga0066688_10256232 | Not Available | 1121 | Open in IMG/M |
3300005180|Ga0066685_10271080 | All Organisms → cellular organisms → Archaea | 1172 | Open in IMG/M |
3300005445|Ga0070708_100209514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1826 | Open in IMG/M |
3300005445|Ga0070708_101511936 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 625 | Open in IMG/M |
3300005451|Ga0066681_10736009 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 598 | Open in IMG/M |
3300005536|Ga0070697_100009717 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 7509 | Open in IMG/M |
3300005540|Ga0066697_10051439 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2335 | Open in IMG/M |
3300005552|Ga0066701_10582639 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 683 | Open in IMG/M |
3300005554|Ga0066661_10036222 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2756 | Open in IMG/M |
3300005556|Ga0066707_10548899 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 745 | Open in IMG/M |
3300005556|Ga0066707_10823662 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 572 | Open in IMG/M |
3300005557|Ga0066704_10136960 | All Organisms → cellular organisms → Bacteria | 1635 | Open in IMG/M |
3300005576|Ga0066708_10352932 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 944 | Open in IMG/M |
3300005587|Ga0066654_10055849 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1762 | Open in IMG/M |
3300006031|Ga0066651_10756743 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 525 | Open in IMG/M |
3300006031|Ga0066651_10760169 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 524 | Open in IMG/M |
3300006046|Ga0066652_100772564 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 917 | Open in IMG/M |
3300006796|Ga0066665_10489742 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1009 | Open in IMG/M |
3300006796|Ga0066665_11045734 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 624 | Open in IMG/M |
3300006796|Ga0066665_11327099 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 553 | Open in IMG/M |
3300006800|Ga0066660_10038308 | All Organisms → cellular organisms → Archaea | 3022 | Open in IMG/M |
3300006800|Ga0066660_10710812 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 824 | Open in IMG/M |
3300006806|Ga0079220_10151006 | All Organisms → cellular organisms → Archaea | 1281 | Open in IMG/M |
3300007258|Ga0099793_10056281 | All Organisms → cellular organisms → Archaea | 1749 | Open in IMG/M |
3300009012|Ga0066710_102028116 | All Organisms → cellular organisms → Archaea | 851 | Open in IMG/M |
3300009012|Ga0066710_103143006 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 637 | Open in IMG/M |
3300009012|Ga0066710_103344959 | All Organisms → cellular organisms → Archaea | 611 | Open in IMG/M |
3300009137|Ga0066709_101416037 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1010 | Open in IMG/M |
3300010303|Ga0134082_10048300 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1629 | Open in IMG/M |
3300010323|Ga0134086_10506071 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 501 | Open in IMG/M |
3300010325|Ga0134064_10179812 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 748 | Open in IMG/M |
3300010329|Ga0134111_10418269 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 576 | Open in IMG/M |
3300010333|Ga0134080_10705586 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 501 | Open in IMG/M |
3300010335|Ga0134063_10508988 | All Organisms → cellular organisms → Archaea | 603 | Open in IMG/M |
3300010335|Ga0134063_10689733 | Not Available | 527 | Open in IMG/M |
3300010336|Ga0134071_10063058 | All Organisms → cellular organisms → Archaea | 1706 | Open in IMG/M |
3300010337|Ga0134062_10077133 | All Organisms → cellular organisms → Archaea → TACK group | 1399 | Open in IMG/M |
3300012199|Ga0137383_10332145 | All Organisms → cellular organisms → Archaea | 1114 | Open in IMG/M |
3300012201|Ga0137365_11184181 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 547 | Open in IMG/M |
3300012202|Ga0137363_10068767 | All Organisms → cellular organisms → Archaea | 2599 | Open in IMG/M |
3300012203|Ga0137399_10019565 | Not Available | 4395 | Open in IMG/M |
3300012204|Ga0137374_10081098 | All Organisms → cellular organisms → Archaea | 3141 | Open in IMG/M |
3300012204|Ga0137374_10383601 | All Organisms → cellular organisms → Archaea | 1123 | Open in IMG/M |
3300012206|Ga0137380_10058302 | All Organisms → cellular organisms → Archaea | 3534 | Open in IMG/M |
3300012207|Ga0137381_10036903 | Not Available | 3975 | Open in IMG/M |
3300012207|Ga0137381_10037426 | All Organisms → cellular organisms → Archaea | 3949 | Open in IMG/M |
3300012207|Ga0137381_10317442 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1357 | Open in IMG/M |
3300012209|Ga0137379_11172994 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 674 | Open in IMG/M |
3300012210|Ga0137378_10116896 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2459 | Open in IMG/M |
3300012210|Ga0137378_11353048 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 627 | Open in IMG/M |
3300012211|Ga0137377_10077540 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 3121 | Open in IMG/M |
3300012349|Ga0137387_10041148 | All Organisms → cellular organisms → Archaea | 3038 | Open in IMG/M |
3300012349|Ga0137387_10087901 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2148 | Open in IMG/M |
3300012349|Ga0137387_10266567 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8 | 1236 | Open in IMG/M |
3300012356|Ga0137371_10017984 | All Organisms → cellular organisms → Archaea | 5425 | Open in IMG/M |
3300012532|Ga0137373_10986492 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 611 | Open in IMG/M |
3300012975|Ga0134110_10373725 | All Organisms → cellular organisms → Archaea | 628 | Open in IMG/M |
3300012977|Ga0134087_10074203 | All Organisms → cellular organisms → Archaea | 1384 | Open in IMG/M |
3300014150|Ga0134081_10190197 | All Organisms → cellular organisms → Archaea | 693 | Open in IMG/M |
3300015241|Ga0137418_10203150 | All Organisms → cellular organisms → Archaea | 1711 | Open in IMG/M |
3300017657|Ga0134074_1229382 | All Organisms → cellular organisms → Archaea | 664 | Open in IMG/M |
3300017659|Ga0134083_10312767 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 669 | Open in IMG/M |
3300018431|Ga0066655_10040799 | All Organisms → cellular organisms → Archaea | 2335 | Open in IMG/M |
3300018431|Ga0066655_11445415 | Not Available | 501 | Open in IMG/M |
3300018468|Ga0066662_10015075 | All Organisms → cellular organisms → Archaea | 4161 | Open in IMG/M |
3300018468|Ga0066662_10017414 | Not Available | 3934 | Open in IMG/M |
3300018482|Ga0066669_11412560 | All Organisms → cellular organisms → Archaea | 631 | Open in IMG/M |
3300026277|Ga0209350_1003021 | All Organisms → cellular organisms → Archaea | 6335 | Open in IMG/M |
3300026298|Ga0209236_1004093 | All Organisms → cellular organisms → Archaea | 8907 | Open in IMG/M |
3300026298|Ga0209236_1166690 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 902 | Open in IMG/M |
3300026307|Ga0209469_1003033 | Not Available | 7777 | Open in IMG/M |
3300026307|Ga0209469_1039394 | All Organisms → cellular organisms → Archaea | 1538 | Open in IMG/M |
3300026309|Ga0209055_1000311 | All Organisms → cellular organisms → Archaea | 34734 | Open in IMG/M |
3300026313|Ga0209761_1112803 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1335 | Open in IMG/M |
3300026328|Ga0209802_1001871 | All Organisms → cellular organisms → Archaea | 15064 | Open in IMG/M |
3300026329|Ga0209375_1013162 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 5057 | Open in IMG/M |
3300026329|Ga0209375_1075052 | All Organisms → cellular organisms → Archaea | 1587 | Open in IMG/M |
3300026332|Ga0209803_1204302 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 722 | Open in IMG/M |
3300026335|Ga0209804_1148877 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1047 | Open in IMG/M |
3300026528|Ga0209378_1151137 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 925 | Open in IMG/M |
3300026532|Ga0209160_1030130 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 3436 | Open in IMG/M |
3300026537|Ga0209157_1042892 | All Organisms → cellular organisms → Archaea | 2475 | Open in IMG/M |
3300026538|Ga0209056_10189817 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1517 | Open in IMG/M |
3300026540|Ga0209376_1107804 | Not Available | 1411 | Open in IMG/M |
3300027655|Ga0209388_1087628 | All Organisms → cellular organisms → Archaea | 895 | Open in IMG/M |
3300028536|Ga0137415_10243002 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1610 | Open in IMG/M |
3300028536|Ga0137415_10390208 | All Organisms → cellular organisms → Archaea | 1196 | Open in IMG/M |
3300031720|Ga0307469_10055875 | All Organisms → cellular organisms → Archaea | 2515 | Open in IMG/M |
3300032180|Ga0307471_100278844 | All Organisms → cellular organisms → Archaea | 1744 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 36.00% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 18.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 14.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.00% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.00% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.00% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.00% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.00% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12627J18819_104984642 | 3300001867 | Forest Soil | KKRNHDVAYLLILLVILLGTFLFVTVAVNTLLRNIPIP* |
JGI25385J37094_100142523 | 3300002558 | Grasslands Soil | MDLPIIPFQKKKKRTHGVAILLILLAVLLGTFLFVSVAVNLLLRSIPIP* |
JGI25383J37093_100616752 | 3300002560 | Grasslands Soil | MDSPIIPFQKKKKRNHDVAILLILLAVLLGTFLFVTVAVNLLLRSIPIP* |
JGI25390J43892_101542022 | 3300002911 | Grasslands Soil | MDSPIVPFEKKKKWNHDMAYLLILLAILLGTFLFVTVAVNTLLRSIPIP* |
JGI25386J43895_100004359 | 3300002912 | Grasslands Soil | MDSPIIPFQKKKKRNHDVAILLILLAVLLGTFLFITVAVNLLLRSIPIP* |
JGI25389J43894_10390162 | 3300002916 | Grasslands Soil | MDSPIIPFQKKKKRNHDVAILLILLAVLLGTFFFVSVAVNLLLRSIPIP* |
Ga0066674_100269893 | 3300005166 | Soil | MDSPIISFQKKKKRNHDVAILLILLAVLLGTFLFVTVAVNLLLRGFPIP* |
Ga0066672_100769781 | 3300005167 | Soil | MDSPIVLFEKKKKRNHDVVYLLILLAILLGTFLFVTVAVKTLLRSLPIP* |
Ga0066672_105135522 | 3300005167 | Soil | MDSPIIPFQKKKKRNHDMAILLILLAVLLGTFLFVSVAVNLLLRSIPIP* |
Ga0066677_103593212 | 3300005171 | Soil | MDSPIIPFQKKKKRTHDVAVLLILLAVLLGTFLFVSVAVNLLLRSIPIP* |
Ga0066679_109505672 | 3300005176 | Soil | MDSPIVAFEKKKKRNHDMAYLLILLAVLLGTFLFVTVAVKT |
Ga0066688_102562321 | 3300005178 | Soil | MDSPIVPFEKKKKWNHDMAYLLILLAILLGTFLFVTVAVNTLLRS |
Ga0066685_102710802 | 3300005180 | Soil | MDSPIIPFQKKKKRNHDVAILLILLAVLLGTFLFVTVAVDLLLRGFPIP* |
Ga0070708_1002095143 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MGSPIVPFEKKKKRNHDVAYLLILLAILLGTFLFVTVAVNTLLRIIPIP* |
Ga0070708_1015119363 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MDSPFVPFEKKKKRNHDVAYLLLLLAILLGTFLFVTVAVNTLLRSIPIP* |
Ga0066681_107360091 | 3300005451 | Soil | TMDSPIIPFQKKKKRTHDVAILLILLAVLLGTFLFVSVAVNLLLRSIPIP* |
Ga0070697_1000097172 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MDSPIVPFEKKKKRNHDVAYLLLLLAILLGTFLFVTVAVNTLLRSIPIP* |
Ga0066697_100514393 | 3300005540 | Soil | MDSPIIPFQKKKKRNHDVAILLILLAVLLGTFLFVSVAVNLLLRSIPIP* |
Ga0066701_105826391 | 3300005552 | Soil | MDSPIIPFQKKKKRTHDVAILLILLAVLLGTFLFVSVAVNLLLRSIPIP* |
Ga0066661_100362222 | 3300005554 | Soil | MDSPIIPFQKKKKRTHDVAILLILLAVLLGTFLFVSVAVNLFLRSIPIP* |
Ga0066707_105488991 | 3300005556 | Soil | MDSPIIPFQKKKKRTHDVAILLILLAVLLGTFLFVSVAVN |
Ga0066707_108236622 | 3300005556 | Soil | MDSPIIPFQKKKKRNHDVAILLILLAVLLGTFLFVSVA |
Ga0066704_101369601 | 3300005557 | Soil | MDSPIVPFEKKKKRNHDMAYLLILLAILLGTFLFVTVAVNTLLRSIPIP* |
Ga0066708_103529321 | 3300005576 | Soil | MDSPIIPFQKKKKRTHDVAILLILLAVLLGTFLFVSV |
Ga0066654_100558491 | 3300005587 | Soil | MDSPIIPFQKKRKRNHDVAILLILLAVLLGTFLFVSVAVNLLLRSIPIP* |
Ga0066651_107567431 | 3300006031 | Soil | MDSPIIPFQKKKKRTHDVAILLILLAVLLGTFLFV |
Ga0066651_107601692 | 3300006031 | Soil | VDSPIIPFQRKRKRNHDVAILLILLAVLLGTFLFVTVAVNLLLRSIPIP* |
Ga0066652_1007725642 | 3300006046 | Soil | MDSPIIPFQKKKKRTHDVAILLILLAVLLGTFLFVSVA |
Ga0066665_104897422 | 3300006796 | Soil | MDSSIIPFQKKKKRNHDVAILLILLAVLLGTFLFVSVAVNLLLR |
Ga0066665_110457341 | 3300006796 | Soil | MDSPIIPFQKKKKRTHDVAILLILLAVLLGTFLFVS |
Ga0066665_113270992 | 3300006796 | Soil | MDSPIIPFQKKKKRNHNVAILLILLAVLLGTFLFVTVAVNLLLRSIPIP* |
Ga0066660_100383081 | 3300006800 | Soil | KKRNHDLAILLILLAVLLGTFLFVSVAVNLLLRSIPIP* |
Ga0066660_107108121 | 3300006800 | Soil | MDSPIIPFQKKKKRNHDLAILLILLAVLLGTFLFVSVAVNLLLRSIPIP* |
Ga0079220_101510063 | 3300006806 | Agricultural Soil | MDSPIVPFEKKKKRNHDVAYLLLILAILLGTFLFVTVAVNTLLRSIPIP* |
Ga0099793_100562813 | 3300007258 | Vadose Zone Soil | MDSPIVPFEKKKKRNHDVAYVLILLAILLGTFLFVTFAVNTLLRSIPIP* |
Ga0066710_1020281162 | 3300009012 | Grasslands Soil | QKKKKRNHDVAILLILLAVLLGTFLFVTVAVDLLLRGFPIP |
Ga0066710_1031430061 | 3300009012 | Grasslands Soil | MHSPIIPFQKKKKRNHDGAILLILLAVLLGTFLFVSVAVNLL |
Ga0066710_1033449592 | 3300009012 | Grasslands Soil | RLSVYTMDSPIIPFQKKKKRNHDVAILLILLAVLLGTFLFVTVAVNLLLRSIPIP |
Ga0066709_1014160371 | 3300009137 | Grasslands Soil | KRTHDVAILLILLAVLLGTFLFVSVAVNLLLRSIPIP* |
Ga0134082_100483002 | 3300010303 | Grasslands Soil | MDSPIIPFQRKKKRNHDVAILLVLLAVLLGTFLFVTVAVNLLLRGFPIP* |
Ga0134086_105060711 | 3300010323 | Grasslands Soil | IIPFQKKKKRNHDVAILLILLAVLLGTFLFVTVAVNLLLRSIPIP* |
Ga0134064_101798122 | 3300010325 | Grasslands Soil | MDSPIIPFQKKKKRTHDVAILLILLAVLLGTFLFVTVAVNLLLRSIPIP* |
Ga0134111_104182692 | 3300010329 | Grasslands Soil | MDSPIISFQKKKKRNHDVAILLILLAVLLGTFLFVTVAVNLLLRSIPIP* |
Ga0134080_107055861 | 3300010333 | Grasslands Soil | MDSPIIPFQKKKKRNHDVAILLILLAVLLGTFLFVTVAV |
Ga0134063_105089882 | 3300010335 | Grasslands Soil | QKKKKRNHDVAILLILLAVLLGTFLFVTVAVDLLLRGFPIP* |
Ga0134063_106897331 | 3300010335 | Grasslands Soil | KRKRNHDVAILLILLAVLLGTFLFVTVAVNLLLRSIPIP* |
Ga0134071_100630583 | 3300010336 | Grasslands Soil | MDSPIVSFEKKKKRNHDLAYLLILLAILLGTFLFVTVAVNTLLRSIPIP* |
Ga0134062_100771331 | 3300010337 | Grasslands Soil | MDSPIIPFQKKRKRNHDVAILLILLAVLLGTFLFVTVAVNLLLRSIPIP* |
Ga0137383_103321452 | 3300012199 | Vadose Zone Soil | MDSPIIPFQKKKKRNHDVAILLILLAVLLGTFLFVTVAVNLLLRSFLIP* |
Ga0137365_111841811 | 3300012201 | Vadose Zone Soil | MVPFEKKKKRSHDVAYLIIILAMLIGTFLFVAVAVNMLLRSLPIP* |
Ga0137363_100687674 | 3300012202 | Vadose Zone Soil | MDFPIVPFEKKKKRNHDVTYVLILLAILLGTFLFVTVAVNTLLRSIPIP* |
Ga0137399_100195653 | 3300012203 | Vadose Zone Soil | MDSPIIPFQKKKKRNHDVAILLILPAVLLGTFLFVTVAVNLLLRSILIP* |
Ga0137374_100810981 | 3300012204 | Vadose Zone Soil | MDSPVIPFEKRKRRSHDVAIFLILMAVLLGTFLFVTVAVNLLLRSIPIP* |
Ga0137374_103836011 | 3300012204 | Vadose Zone Soil | MDSPLISFQRKKKRNHDVAILLVLLAVLLGTFLFVTVAVNLLLRGFPIP* |
Ga0137380_100583024 | 3300012206 | Vadose Zone Soil | MDSPIILFQKKKKRNHDVAILLILLAVLLGTFLFVTVAVNMLLRSIPIP* |
Ga0137381_100369036 | 3300012207 | Vadose Zone Soil | HDVAILLILLAVLLGTFLFVSVAVNLLLRSIPIP* |
Ga0137381_100374263 | 3300012207 | Vadose Zone Soil | MDSPIIPFQKKKTRNHDVAILLILLAVLLGTFLFVTVAVNLLLRSIPIP* |
Ga0137381_103174422 | 3300012207 | Vadose Zone Soil | MDSPIILFQKKKKRNHDVAILLILLAVLLGTFLFVTVAVNMLLRSIPTP* |
Ga0137379_111729941 | 3300012209 | Vadose Zone Soil | MDSSIIPFQKKKKRNHDVAILLILLAVLLGTFLFVSVAVNLLLRSIPIP* |
Ga0137378_101168962 | 3300012210 | Vadose Zone Soil | MDSPIVPFEKKKKRSHDVAYLIIILTMLIGTFLFVAVAVNLLLRSLPIP* |
Ga0137378_113530481 | 3300012210 | Vadose Zone Soil | MVPFEKKKKRNHDVAYLIIILAMLIGTFLFVAVAVNMLLRSLPIP* |
Ga0137377_100775403 | 3300012211 | Vadose Zone Soil | MDSPIIPFQKKKTRNHDVAILLILLAVLLGTFLFVTVAVNLLLRS |
Ga0137387_100411481 | 3300012349 | Vadose Zone Soil | NHDVAILLILLAVLLGTFLFVTVAVNLLLRSIPIP* |
Ga0137387_100879015 | 3300012349 | Vadose Zone Soil | FQKKKKRNHDVAILLILLAVLLGTFLFVTVAVNMLLRSIPTP* |
Ga0137387_102665672 | 3300012349 | Vadose Zone Soil | MDSPIILFQKKKKRNHDVAILLILLAVLLGTFLFVTVAVNMLLRSIP |
Ga0137371_100179843 | 3300012356 | Vadose Zone Soil | VPFEKKKKRNHDIAYLIIILAMLIGTFLFVAVAVNMLLRSLPIP* |
Ga0137373_109864921 | 3300012532 | Vadose Zone Soil | MDSPIIPFQKKKKRNHDVAILLILLAVLLGTFLFVTVAVNLLLRGFPIP* |
Ga0134110_103737252 | 3300012975 | Grasslands Soil | IPFQRKRKRNHDVAILLILLAVLLGTFLFVTVAVNLLLRSIPIP* |
Ga0134087_100742033 | 3300012977 | Grasslands Soil | HDVAILLILLAVLLGTFLFVTVAVNLLLRSIPIP* |
Ga0134081_101901972 | 3300014150 | Grasslands Soil | MDSPIIPFQKKKKRNHDVAILLILLAVLLGTFLFVTVAVDLLLRGLPIP* |
Ga0137418_102031502 | 3300015241 | Vadose Zone Soil | MDFPIVPFEKKKKRNHDVAYVLILLAILLGTFLFVTFAVNTLLRSIPIP* |
Ga0134074_12293821 | 3300017657 | Grasslands Soil | IIPFQKKRKRNHDVAILLILLAVLLGTFLFVTVAVNLLLRSIPIP |
Ga0134083_103127671 | 3300017659 | Grasslands Soil | MDSPIIPFQKKKKRNHDVAILLILLAVLLGTFLFVTVAVNLLLRGFPIP |
Ga0066655_100407992 | 3300018431 | Grasslands Soil | MDSPIIPFQKKKKRNHDVAILLILLAVLLGTFLFVTVAVDLLLRGFPIP |
Ga0066655_114454151 | 3300018431 | Grasslands Soil | KRNHDVAILLILLAVLLGTFLFVTVAVNLLLRSIPIP |
Ga0066662_100150751 | 3300018468 | Grasslands Soil | MDSPIVPFEKKKKWNHDMAYLLILLAILLGTFLFVTVA |
Ga0066662_100174143 | 3300018468 | Grasslands Soil | MDSPIIPFQKKKKRNHDMAILLILLAVLLGTFLFVSVAVNLLLRSIPIP |
Ga0066669_114125601 | 3300018482 | Grasslands Soil | YQMDSLIISFQKKKKRNHDVAILLILLAVLLGTFLFVTVAVNLLLRGFPIP |
Ga0209350_10030219 | 3300026277 | Grasslands Soil | MDSPIIPFQKKKKRNHDVAILLILLAVLLGTFLFVTVAVNLLLRSIPIP |
Ga0209236_10040932 | 3300026298 | Grasslands Soil | MDLPIIPFQKKKKRTHGVAILLILLAVLLGTFLFVSVAVNLLLRSIPIP |
Ga0209236_11666901 | 3300026298 | Grasslands Soil | MDSPIISFQKKKKRSHDVAILLTLLAILLGTFLFVTVAVNLLSRSIPIP |
Ga0209469_10030335 | 3300026307 | Soil | MDSPIISFQKKKKRNHDVAILLILLAVLLGTFLFVTVAVNLLLRGFPIP |
Ga0209469_10393942 | 3300026307 | Soil | MDSPIIPFQRKKKRNHDVAILLVLLAVLLGTFLFVTVAVNLLLRGFPIP |
Ga0209055_100031120 | 3300026309 | Soil | MDSPIVLFEKKKKRNHDVVYLLILLAILLGTFLFVTVAVKTLLRSLPIP |
Ga0209761_11128031 | 3300026313 | Grasslands Soil | KKRSHDVAILLTLLAILLGTFLFVTVAVNLLSRSIPIP |
Ga0209802_10018713 | 3300026328 | Soil | MDSPIIPFQKKKKRNHDVAILLILLAVLLGTFLFVSVAVNLLLRSIPIP |
Ga0209375_10131626 | 3300026329 | Soil | VDSPIIPFQRKRKRNHDVAILLILLAVLLGTFLFVTVAVNLLLRSIPIP |
Ga0209375_10750523 | 3300026329 | Soil | KKKKRNHDVAILLILLAVLLGTFLFVTVAVDLLLRGFPIP |
Ga0209803_12043021 | 3300026332 | Soil | MDSPIIPFQKKKKRNHNVAILLILLAVLLGTFLFVTVAVNLLLRSIPIP |
Ga0209804_11488771 | 3300026335 | Soil | MDSPIIPFQKKKKRNHDLAILLILLAVLLGTFLFVSVAVNLLLRSIPIP |
Ga0209378_11511372 | 3300026528 | Soil | MDSPIIPFQKKKKRTHDVAILLILLAVLLGTFLFVSVAVNLLLRSIPIP |
Ga0209160_10301304 | 3300026532 | Soil | MDSPIIPFQKKKKRNHDVAILLILLAVLLGTFLFVSVAINLLLRSIPIP |
Ga0209157_10428924 | 3300026537 | Soil | MDSPIIPFQKKKKRTHDVAILLILLAVLLGTFLFVSVAV |
Ga0209056_101898172 | 3300026538 | Soil | MDSSIIPFQKKKKRNHDVAILLILLAVLLGTFLFVSVAVNLLLRSIPIP |
Ga0209376_11078041 | 3300026540 | Soil | KKKKRNHDVAILLILLAVLLGTFLFVSVAVNLLLRSIPIP |
Ga0209388_10876281 | 3300027655 | Vadose Zone Soil | MDFPIVPFEKKKKRNHDVTYVLILLAILLGTFLFVTVAVNTLLRSIPIP |
Ga0137415_102430023 | 3300028536 | Vadose Zone Soil | MDSPIIPFQKKKKRNHDVAILLILPAVLLGTFLFVTVAVNLLLRSILIP |
Ga0137415_103902081 | 3300028536 | Vadose Zone Soil | MDFPIVPFEKKKKRNHDVAYLLILLAILLGTFLLATVAVNTLLRRIPIP |
Ga0307469_100558751 | 3300031720 | Hardwood Forest Soil | MDSPIVPFEKKKKRNHDVAYLLLLLAFLLGTFLFVTVAVNTLLRSIPIP |
Ga0307471_1002788441 | 3300032180 | Hardwood Forest Soil | SFEKKKKRNHDVAYLLLLLAILLGTFLFVTVAVNTLLRSIPIP |
⦗Top⦘ |