NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F104825

Metagenome / Metatranscriptome Family F104825

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F104825
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 47 residues
Representative Sequence NIFNQVNFDIPNTAVNNQATLGRITRTDPGSGDPRILQFGLKFVF
Number of Associated Samples 87
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 96.00 %
% of genes from short scaffolds (< 2000 bps) 92.00 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.17

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(17.000 % of family members)
Environment Ontology (ENVO) Unclassified
(34.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(59.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.17
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF13432TPR_16 16.00
PF13620CarboxypepD_reg 6.00
PF10282Lactonase 6.00
PF13683rve_3 3.00
PF01070FMN_dh 3.00
PF03551PadR 2.00
PF13414TPR_11 2.00
PF02810SEC-C 2.00
PF13516LRR_6 2.00
PF07586HXXSHH 2.00
PF00515TPR_1 1.00
PF00202Aminotran_3 1.00
PF12704MacB_PCD 1.00
PF13424TPR_12 1.00
PF13855LRR_8 1.00
PF08450SGL 1.00
PF13385Laminin_G_3 1.00
PF02371Transposase_20 1.00
PF13561adh_short_C2 1.00
PF00106adh_short 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 3.00
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 3.00
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 2.00
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 2.00
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 2.00
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 1.00
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 1.00
COG3547TransposaseMobilome: prophages, transposons [X] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.00 %
UnclassifiedrootN/A4.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000559|F14TC_101769961All Organisms → cellular organisms → Bacteria → Acidobacteria694Open in IMG/M
3300004156|Ga0062589_101960598All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300005186|Ga0066676_10782745All Organisms → cellular organisms → Bacteria → Acidobacteria647Open in IMG/M
3300005332|Ga0066388_105382242All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300005338|Ga0068868_100598882All Organisms → cellular organisms → Bacteria → Acidobacteria976Open in IMG/M
3300005343|Ga0070687_100316650All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae995Open in IMG/M
3300005446|Ga0066686_10648612All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium717Open in IMG/M
3300005447|Ga0066689_10575035All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium711Open in IMG/M
3300005466|Ga0070685_10695899All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300005471|Ga0070698_100104541All Organisms → cellular organisms → Bacteria2802Open in IMG/M
3300005471|Ga0070698_101569578All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300005536|Ga0070697_101782338All Organisms → cellular organisms → Bacteria → Acidobacteria551Open in IMG/M
3300005539|Ga0068853_102199610All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300005545|Ga0070695_101290504All Organisms → cellular organisms → Bacteria → Acidobacteria603Open in IMG/M
3300005546|Ga0070696_100297644All Organisms → cellular organisms → Bacteria1235Open in IMG/M
3300005549|Ga0070704_101598570All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300005558|Ga0066698_10302845All Organisms → cellular organisms → Bacteria → Acidobacteria1107Open in IMG/M
3300005559|Ga0066700_10869256All Organisms → cellular organisms → Bacteria → Acidobacteria602Open in IMG/M
3300005568|Ga0066703_10275694All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1019Open in IMG/M
3300005615|Ga0070702_101649005All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300005617|Ga0068859_100147906All Organisms → cellular organisms → Bacteria2424Open in IMG/M
3300005719|Ga0068861_100270311All Organisms → cellular organisms → Bacteria1459Open in IMG/M
3300005719|Ga0068861_102301176All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300006046|Ga0066652_101098795All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300006049|Ga0075417_10015214All Organisms → cellular organisms → Bacteria2966Open in IMG/M
3300006049|Ga0075417_10636359All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium545Open in IMG/M
3300006796|Ga0066665_11554502All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300006797|Ga0066659_11534809All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium558Open in IMG/M
3300006852|Ga0075433_10320669All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1371Open in IMG/M
3300006854|Ga0075425_100071861All Organisms → cellular organisms → Bacteria3898Open in IMG/M
3300006903|Ga0075426_10310973All Organisms → cellular organisms → Bacteria → Acidobacteria1153Open in IMG/M
3300006903|Ga0075426_11568005All Organisms → cellular organisms → Bacteria → Acidobacteria501Open in IMG/M
3300006904|Ga0075424_101205705All Organisms → cellular organisms → Bacteria → Acidobacteria806Open in IMG/M
3300006969|Ga0075419_10855412All Organisms → cellular organisms → Bacteria → Acidobacteria654Open in IMG/M
3300007076|Ga0075435_101828770All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300009088|Ga0099830_10807672All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium774Open in IMG/M
3300009089|Ga0099828_11206762All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300009094|Ga0111539_11378808All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium818Open in IMG/M
3300009094|Ga0111539_11893511All Organisms → cellular organisms → Bacteria → Acidobacteria692Open in IMG/M
3300009094|Ga0111539_13394662All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300009147|Ga0114129_11188958All Organisms → cellular organisms → Bacteria → Acidobacteria950Open in IMG/M
3300009148|Ga0105243_10149610All Organisms → cellular organisms → Bacteria → Acidobacteria2001Open in IMG/M
3300009156|Ga0111538_12760771All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium615Open in IMG/M
3300009162|Ga0075423_12040618All Organisms → cellular organisms → Bacteria → Acidobacteria621Open in IMG/M
3300009176|Ga0105242_12469389Not Available568Open in IMG/M
3300009177|Ga0105248_13318623Not Available512Open in IMG/M
3300009553|Ga0105249_10715915All Organisms → cellular organisms → Bacteria → Acidobacteria1062Open in IMG/M
3300010303|Ga0134082_10517836All Organisms → cellular organisms → Bacteria → Acidobacteria522Open in IMG/M
3300010362|Ga0126377_12910692All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300010396|Ga0134126_13019027All Organisms → cellular organisms → Bacteria → Acidobacteria508Open in IMG/M
3300010399|Ga0134127_11919562All Organisms → cellular organisms → Bacteria → Proteobacteria669Open in IMG/M
3300010400|Ga0134122_13123743All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300010400|Ga0134122_13328309All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300011270|Ga0137391_10630768All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium896Open in IMG/M
3300012360|Ga0137375_10336703All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1346Open in IMG/M
3300012360|Ga0137375_10595045All Organisms → cellular organisms → Bacteria → Acidobacteria922Open in IMG/M
3300012582|Ga0137358_10624426All Organisms → cellular organisms → Bacteria → Acidobacteria722Open in IMG/M
3300012901|Ga0157288_10354151All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium533Open in IMG/M
3300012961|Ga0164302_11051484All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium639Open in IMG/M
3300012975|Ga0134110_10004493All Organisms → cellular organisms → Bacteria → Acidobacteria5132Open in IMG/M
3300015356|Ga0134073_10212882All Organisms → cellular organisms → Bacteria → Acidobacteria648Open in IMG/M
3300015371|Ga0132258_11551398All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1672Open in IMG/M
3300015371|Ga0132258_11885260All Organisms → cellular organisms → Bacteria → Acidobacteria1505Open in IMG/M
3300018031|Ga0184634_10332012All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium697Open in IMG/M
3300018081|Ga0184625_10345941All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium773Open in IMG/M
3300018468|Ga0066662_11876319All Organisms → cellular organisms → Bacteria → Acidobacteria627Open in IMG/M
3300019356|Ga0173481_10467228All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300019888|Ga0193751_1113614All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1021Open in IMG/M
3300020004|Ga0193755_1119253All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300020170|Ga0179594_10298761All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300023072|Ga0247799_1028159All Organisms → cellular organisms → Bacteria → Acidobacteria879Open in IMG/M
3300025315|Ga0207697_10095262All Organisms → cellular organisms → Bacteria1265Open in IMG/M
3300025324|Ga0209640_10153303All Organisms → cellular organisms → Bacteria → Acidobacteria1972Open in IMG/M
3300025923|Ga0207681_10248491All Organisms → cellular organisms → Bacteria → Acidobacteria1388Open in IMG/M
3300025923|Ga0207681_10913942All Organisms → cellular organisms → Bacteria → Acidobacteria735Open in IMG/M
3300025926|Ga0207659_11030831All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium708Open in IMG/M
3300025936|Ga0207670_10161420All Organisms → cellular organisms → Bacteria1673Open in IMG/M
3300025936|Ga0207670_10652794All Organisms → cellular organisms → Bacteria → Acidobacteria868Open in IMG/M
3300025937|Ga0207669_11425363All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300025941|Ga0207711_10105300All Organisms → cellular organisms → Bacteria2501Open in IMG/M
3300025941|Ga0207711_10911336All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300025960|Ga0207651_10563825All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium992Open in IMG/M
3300025981|Ga0207640_11764631All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300026023|Ga0207677_11145413All Organisms → cellular organisms → Bacteria → Acidobacteria710Open in IMG/M
3300026035|Ga0207703_10284706All Organisms → cellular organisms → Bacteria1502Open in IMG/M
3300026088|Ga0207641_11192162Not Available761Open in IMG/M
3300026118|Ga0207675_102571516All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300026320|Ga0209131_1387533All Organisms → cellular organisms → Bacteria → Acidobacteria522Open in IMG/M
3300026552|Ga0209577_10052775All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3425Open in IMG/M
3300027723|Ga0209703_1185015All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium771Open in IMG/M
3300027873|Ga0209814_10135464Not Available1053Open in IMG/M
3300027873|Ga0209814_10402167All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300028145|Ga0247663_1089251All Organisms → cellular organisms → Bacteria → Acidobacteria555Open in IMG/M
3300028782|Ga0307306_10195348All Organisms → cellular organisms → Bacteria → Acidobacteria578Open in IMG/M
3300028784|Ga0307282_10494994All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300031366|Ga0307506_10154666All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium808Open in IMG/M
3300031421|Ga0308194_10112244All Organisms → cellular organisms → Bacteria → Acidobacteria799Open in IMG/M
3300031716|Ga0310813_10822874All Organisms → cellular organisms → Bacteria → Acidobacteria837Open in IMG/M
3300032012|Ga0310902_10277990All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium1021Open in IMG/M
3300034149|Ga0364929_0294834All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium553Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere17.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil10.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere6.00%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.00%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere4.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere4.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.00%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.00%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.00%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil1.00%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.00%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300023072Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027723Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028145Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300031366Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_SEnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300034149Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F14TC_10176996113300000559SoilEFFNVFNQVNFDIPNTAVNNQATLGRITXXXXXXXDPRILQFGLKFVF*
Ga0062589_10196059823300004156SoilTSSYVQAKVEFFNIFNMVNLDIPNTAVNNQATLGRITRTDPSSGDPRILQFGLKFVF*
Ga0066676_1078274523300005186SoilNLNVPNTAVNNQATLGRITTTDPGSGDPRILQFGLKFVF*
Ga0066388_10538224223300005332Tropical Forest SoilRVEFFNIFNQVNFDIPNVAVNNQATLGRITRTDPANPDPRILQFGLKFVF*
Ga0068868_10059888223300005338Miscanthus RhizosphereASSYVQARVEFFNIFNQVNLDNPNTAVNNQATLGRITQTLAGGLGDPRILQFGLKFVF*
Ga0070687_10031665013300005343Switchgrass RhizosphereFNSSSYVQARVEFFNIFNQVNLDIPNTAVNNPATLGRITRTDPGSGDPRILQFGLKLVF*
Ga0066686_1064861223300005446SoilRVEFFNFFNQVNLDIPNTAVNNQSTLGRITRTDPSSGDPRILQFGLKLVF*
Ga0066689_1057503523300005447SoilIFNMVNFDLPGRAANNTASLGRITQTDLSTNGDPRIVQFGLKFVF*
Ga0070685_1069589913300005466Switchgrass RhizosphereSYVQARVEFFNIFNQVNLDNPNTAVNNQATLGRITQTLAGGLGDPRILQFGLKFVF*
Ga0070698_10010454143300005471Corn, Switchgrass And Miscanthus RhizosphereFNVFNMVNYDIPNTAVNNLATLGRITRTDPSSGDPRILQFGLKLVF*
Ga0070698_10156957823300005471Corn, Switchgrass And Miscanthus RhizosphereVEFFNIFNQVNLDIPNTAVNNQATLGRITRTDPSSGDPRILQFGLKFVF*
Ga0070697_10178233813300005536Corn, Switchgrass And Miscanthus RhizosphereRVEFFNVFNQVNFDVPNTAVNNQATLGRITRTDPNSGDPRVLQFGLKFVF*
Ga0068853_10219961023300005539Corn RhizosphereEFFNVFNQVNFDVPNTAVNNQATLGRITRTDPGSGDPRILQFGLKVVF*
Ga0070695_10129050423300005545Corn, Switchgrass And Miscanthus RhizosphereFNMVNLDIPNTAVNNQATLGRITRTDPSSGDPRILQFGLKFVF*
Ga0070696_10029764413300005546Corn, Switchgrass And Miscanthus RhizosphereIFNQVNFDIPNTAVNNPATLGRITRTDPGSGDPRILQFGLKFVF*
Ga0070704_10159857033300005549Corn, Switchgrass And Miscanthus RhizosphereVEFFNIFNQVNFDIPNVAVNNAATLGRITRTDPSSVDPRILQFGLKFVF*
Ga0066698_1030284523300005558SoilEFFNIFNMVNFGLLGMSANNTASFGRIIGVDGDLGDPRIIQFGLKFVF*
Ga0066700_1086925613300005559SoilDLPARAANNTASLGRITQTDLSTNGDPRIVQFGLKFVF*
Ga0066703_1027569423300005568SoilMINLDIPNTAVNNQSTLGRITRTDPISGDPRILQFGLKFVF*
Ga0070702_10164900523300005615Corn, Switchgrass And Miscanthus RhizosphereHLNTSSYVQAKVEFFNIFNMINLDIPNTAVNNQATLGRITRTDPSSGDPRILQFGLKFVF
Ga0068859_10014790623300005617Switchgrass RhizosphereIFNQVNLDNPNTAVNNQATLGRITQTLAGGLGDPRILQFGLKFVF*
Ga0068861_10027031133300005719Switchgrass RhizosphereFNSSSYVQMRVEFFNIFNQVNLDIPNTAVNNQATLGRITRTDPGSGDPRILQFGLKFVF*
Ga0068861_10230117613300005719Switchgrass RhizosphereVNFDVPNNAVNNQATLGRITRTDPSSGDPRILQFGLKFVF*
Ga0066652_10109879513300006046SoilRVEFFNIFNQVNLNVPNTATNNAATLGRITSTDPGSGDPRILQFGLKFVF*
Ga0075417_1001521433300006049Populus RhizosphereDIPNTAVNNQATLGRITRTDTSSGDPRILQFGLKFVF*
Ga0075417_1063635923300006049Populus RhizosphereVEFFNIFNQVNFDIPNTAVNNQATLGRITRTDPSSGDPRILQFGLKFVF*
Ga0066665_1155450223300006796SoilNFDLPGRAANNTASLGRITQTDPSLGDPRILQFGLKFVF*
Ga0066659_1153480913300006797SoilTSVSNAATLGRITTTDGTSNGNQGDPRIIQFGLKFVF*
Ga0075433_1032066933300006852Populus RhizosphereEFFNIFNQVNFDIPNTAVSNQSTLGRITRTDPSSGDPRILQFGLKFVF*
Ga0075425_10007186143300006854Populus RhizosphereVFNHVNLDIPNTAVNNQATLGRITRTDPSSGDPRILQFGLKFLF*
Ga0075426_1031097323300006903Populus RhizosphereDVPNTAVNNQATLGRITRTDPNSGDPRILQFGLKVVF*
Ga0075426_1156800513300006903Populus RhizosphereDIPNTAVNNQATLGRITRTDPGSGDPRILQFGLKVVF*
Ga0075424_10120570523300006904Populus RhizosphereEFFNVFNQVNFDVPNTAVNNQATLGRITRTDPSSGDPRVLQFGLKFVF*
Ga0075419_1085541223300006969Populus RhizosphereFNIFNQVNLDVPNTAVNNQATLGRITRTDPGSGDPRILQFGLKFVF*
Ga0075435_10182877023300007076Populus RhizosphereVEFFNIFNMVNLDVPNTAVNNQATLGRITRTDPSSGDPRILQFGLKVVF*
Ga0099830_1080767223300009088Vadose Zone SoilEFFNVFNQVNFDVPNTAVNNQSTLGRITRTDPSSGDPRILQFGLKFVF*
Ga0099828_1120676223300009089Vadose Zone SoilGSSYVQARVEFFNIFNQVNFDIPNTAVNNQATLGRITRTDPGSGDPRIPQFGLKFVF*
Ga0111539_1137880823300009094Populus RhizosphereFNASSYVQARIEFFNIFNQVNFDIPNTAVNNQATLGRITRTDPSSGDPRILQFGLKFVF*
Ga0111539_1189351123300009094Populus RhizosphereFNIFNQVNFDIPQTNRTSSTFGQITRTDPSFGDPRIIQFGLKFVF*
Ga0111539_1339466213300009094Populus RhizosphereNMVNLDIPNTAVNNQATLGRITRTDPSSGDPRILQFGLKFVF*
Ga0114129_1118895813300009147Populus RhizosphereEFFNVFNQVNLDIPKTAVNNQATLGRITNTDPSSGDPRILQFGLKFLF*
Ga0105243_1014961013300009148Miscanthus RhizosphereNIFNQVNFDIPNTAVNNQATLGRITRTDPGSGDPRILQFGLKFVF*
Ga0111538_1276077123300009156Populus RhizosphereSSYVQARVEFFNIFNQVNLDVPNTATNNQATLGRITRTDPGSGDPRILQFGLKFVF*
Ga0075423_1204061823300009162Populus RhizosphereVQAKVEFFNIFNMVNLDVPNTAVNNQATLGRITRTDPGSGDPRILQFGLKFVF*
Ga0105242_1246938913300009176Miscanthus RhizosphereNPNTAVNNQATLGRITQTLAGGLGDPRILQFGLKFVF*
Ga0105248_1331862313300009177Switchgrass RhizosphereFFNIFNQVNLDVPNTAVNNQATLGRITRTDPGSGDPRILQFGLKLVF*
Ga0105249_1071591513300009553Switchgrass RhizosphereKVEFFNIFNMVNLDIPNTAVNNQATLGRITRTDPGSGDPRILQFGLKFVF*
Ga0134082_1051783613300010303Grasslands SoilQVNLDIPNTAVNNQATLGRITRTDPSSGDPRILQFGLKFLF*
Ga0126377_1291069213300010362Tropical Forest SoilNFDVPNTAVNNQATLGRITSTDPGSGGPRILQFGLKFVF*
Ga0134126_1301902713300010396Terrestrial SoilNQVNFDVPNTAVNNQATLGRITRTDPGSGDPRILQFGLKVVF*
Ga0134127_1191956223300010399Terrestrial SoilVNFDVPNTAVNNQATLGRVTRTDPSSGDPRILQFGLKFTF*
Ga0134122_1312374313300010400Terrestrial SoilASYVQARVEFFNIFNQVNLDVPNTATNNQATLGRITRTDPGSGDPRILQFGLKFVF*
Ga0134122_1332830923300010400Terrestrial SoilVEFFNVFNQVNFDIPNTAVNNQATLGRITRTDPNSGDPRILQFGLKYVF*
Ga0137391_1063076823300011270Vadose Zone SoilNTAVNNPATLGRITRTDPGSGDPRILQFGLKFVF*
Ga0137375_1033670313300012360Vadose Zone SoilNTAVNNQATLGRITRTDPGSGDPRILQFGLKFVF*
Ga0137375_1059504523300012360Vadose Zone SoilPNTAVNNQSTLGRITRTDPSSGDPRILQFGLKYVF*
Ga0137358_1062442613300012582Vadose Zone SoilNFDVPNTAVNNQATLGRITRTDPSSGDPRILQFGLKLVF*
Ga0157288_1035415113300012901SoilFFNIFNMVNLDIPNTAVNNQATLGRITRTDPSSGDPRILQFGLKFVF*
Ga0164302_1105148423300012961SoilRVEFFNIFNQVNLDVPNNATNNQATLGRITRTDPGSGDPRILQFGLKFVF*
Ga0134110_1000449323300012975Grasslands SoilMVNFDIPNTAVNNPSTLGRITRTDPSSGDPRILQFGLKFVF*
Ga0134073_1021288223300015356Grasslands SoilEFFNIFNMVNFDIPNTAVNNPSTLGRITRTDPSSGDPRILQFGLKFVF*
Ga0132258_1155139843300015371Arabidopsis RhizosphereNQVNLDVPNNATNNQATLGRITRTDPGSGDPRILQFGLKFVF*
Ga0132258_1188526013300015371Arabidopsis RhizosphereRVEFFNVFNLVNLDVPNTAVNNQATLGRITRTDPSSGDPRILQFGLKLVF*
Ga0184634_1033201223300018031Groundwater SedimentARIEFFNIFNQVNFDIPNTAVNNQATLGRITRTDPSSGDPRILQFGLKFVF
Ga0184625_1034594123300018081Groundwater SedimentMGLSKNFRFNSSSYVQARVEFFNIFNQVNLDVPNTAVNNQATLGRITRTDPGSGDPRILQFGLKFVF
Ga0066662_1187631923300018468Grasslands SoilIFNMVNFDLPGRAANNTASLGRITQTDPSLGDPRILQFGLKFVF
Ga0173481_1046722813300019356SoilKNFRFNSSSYVQMRVEFFNIFNQVNLDIPNTAVNNQATLGRITRTDPGSGDPRILQFGLKFVF
Ga0193751_111361413300019888SoilIFNQVNFDFPKVAVNNASTLGKIVATDPNSGDPRIIQFGLKFVF
Ga0193755_111925313300020004SoilFNQVNFDVPNNAVNNLSTLGRITRTDPSSGDPRILQFGLKFVF
Ga0179594_1029876123300020170Vadose Zone SoilVPNNAVNNLSTLGRITRTDPSSGDPRILQFGLKLVF
Ga0247799_102815913300023072SoilNMVNLDIPNTAVNNQATLGRITRTDPSSGDPRILQFGLKFVF
Ga0207697_1009526213300025315Corn, Switchgrass And Miscanthus RhizosphereVSKNFRFNSSSYVQARVEFFNIFNQVNLDIPNTAVNNPATLGRITRTDPGSGDPRILQFGLKLVF
Ga0209640_1015330333300025324SoilVEFFNVFNQVNFDHPRNSGENAAVSGANFGRITRTDPSFGDPRIIQFGLKFVF
Ga0207681_1024849113300025923Switchgrass RhizosphereFDVPNTAVNNQATLGRITRTDPGSGDPRILQFGLKVVF
Ga0207681_1091394233300025923Switchgrass RhizosphereKVEFFNIFNMVNLDIPNTAVNNQATLGRITRTDPSSGDPRILKFGLKFVF
Ga0207659_1103083113300025926Miscanthus RhizosphereIPNTAVNNQATLGRITRTDPSSGDPRILQFGLKLVF
Ga0207670_1016142023300025936Switchgrass RhizosphereSKNFRFNSSSYVQARVEFFNIFNQVNLDIPNTAVNNPATLGRITRTDPGSGDPRILQFGLKLVF
Ga0207670_1065279433300025936Switchgrass RhizosphereQARVEFFNIFNQVNLDNPNTAVNNQATLGRITQTLAGGLGDPRILQFGLKFVF
Ga0207669_1142536313300025937Miscanthus RhizosphereRFNASSYVQARVEFFNIFNQVNLDNPNTAVNNQATLGRITQTLAGGLGDPRILQFGLKFV
Ga0207711_1010530013300025941Switchgrass RhizosphereFNIFNQVNLDNPNTAVNNQATLGRITQTLAGGLGDPRILQFGLKFVF
Ga0207711_1091133623300025941Switchgrass RhizosphereFRFNSSSYVHARVEFFNIFNQVNLDIPNNAVNNPATLGRITRTDPGSGDPRILQFGLKFV
Ga0207651_1056382523300025960Switchgrass RhizosphereNFRFNSSSYVQARVEFFNIFNQVNLDIPNTAVNNPATLGRITRTDPGSGDPRILQFGLKLVF
Ga0207640_1176463123300025981Corn RhizosphereVFNQVNFDVPNSAVNNQSTLGRITRTDPGSGDPRILQFGLKFVF
Ga0207677_1114541313300026023Miscanthus RhizosphereQVNLDNPNTAVNNQATLGRITQTLAGGLGDPRILQFGLKFVF
Ga0207703_1028470613300026035Switchgrass RhizosphereFRFNASSYVQARVEFFNIFNQVNLDNPNTAVNNQATLGRITQTLAGGLGDPRILQFGLKFVF
Ga0207641_1119216213300026088Switchgrass RhizosphereRVEFFNIFNQVSLDNPNTAVNNQATLGRITQTLAGGLGDPRILQFGLKFVF
Ga0207675_10257151613300026118Switchgrass RhizosphereVPNNAVNNQATLGRITRTDPSSGDPRILQFGLKFVF
Ga0209131_138753313300026320Grasslands SoilNVQFRAEIFNIFNQVNFDIPARGANNTSTLGKISQTDPNSGEPRIIQFGLKFVF
Ga0209577_1005277553300026552SoilFDIPNTAVNNQSTLGRITRTDPSSGDPRILQFGLKFVF
Ga0209703_118501523300027723Freshwater SedimentFNQVNFDLPNTNVSGGNFGRITRTDPSFGDPRILQFGLKFVF
Ga0209814_1013546413300027873Populus RhizospherePNTAVNNQATLGRITRTDTSSGDPRILQFGLKFVF
Ga0209814_1040216723300027873Populus RhizosphereRVEFFNIFNQVNFDIPNTAVSNQSTLGRITRTDPSSGDPRILQFGLKFVF
Ga0247663_108925113300028145SoilVEFINVFNLVNFDIPNTAVNNQSTLGRITRTDPGSGDPRILQFGLKVVF
Ga0307306_1019534813300028782SoilFNIFNQVNFDVPGTSVSNATTLGKFTATDPNSGDPRIIQFGLKFVF
Ga0307282_1049499423300028784SoilPNTAVNNLATLGRITSTDSGSGDPRILQFGLKFVF
Ga0307506_1015466623300031366SoilIPNRAVNNQATLGRITATNPDAGDPRIVQFGLKFVF
Ga0308194_1011224413300031421SoilNFNVPNTAVNNQATLGRITSTDPGSGDPRILQFGLKFVF
Ga0310813_1082287413300031716SoilNIFNMVNLDIPNTAVNNQATLGRITRTDPSSGDPRILQFGLKFVF
Ga0310902_1027799023300032012SoilNIFNQVNLDVPNTATNNLATLGRITRTDPGSGDPRILQFGLKFVF
Ga0364929_0294834_1_1863300034149SedimentFHFNGSSYVQARVEFFNIFNQVNFDIPNVAVNNAATLGRITRTDPGSGDPRILQFGLKFV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.