| Basic Information | |
|---|---|
| Family ID | F104815 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 53 residues |
| Representative Sequence | LSPASKKIPIGLARVRKELPPPGKVFKSKAKDSRKRAKEKLQRELDETLPRHSR |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 76.84 % |
| % of genes near scaffold ends (potentially truncated) | 23.00 % |
| % of genes from short scaffolds (< 2000 bps) | 77.00 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (61.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil (12.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (29.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.71% β-sheet: 0.00% Coil/Unstructured: 68.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF10431 | ClpB_D2-small | 54.00 |
| PF07690 | MFS_1 | 28.00 |
| PF02771 | Acyl-CoA_dh_N | 1.00 |
| PF09084 | NMT1 | 1.00 |
| PF08281 | Sigma70_r4_2 | 1.00 |
| PF00903 | Glyoxalase | 1.00 |
| PF02515 | CoA_transf_3 | 1.00 |
| PF03061 | 4HBT | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.00 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 1.00 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 1.00 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 61.00 % |
| Unclassified | root | N/A | 39.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664022|INPgaii200_c0951041 | Not Available | 748 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101830124 | All Organisms → cellular organisms → Bacteria | 2238 | Open in IMG/M |
| 3300000596|KanNP_Total_noBrdU_T14TCDRAFT_1019295 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300003997|Ga0055466_10241658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300003999|Ga0055469_10217813 | Not Available | 600 | Open in IMG/M |
| 3300004009|Ga0055437_10108192 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300004019|Ga0055439_10259229 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 568 | Open in IMG/M |
| 3300004022|Ga0055432_10041139 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300004024|Ga0055436_10087662 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300004027|Ga0055459_10010110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 1829 | Open in IMG/M |
| 3300004463|Ga0063356_102383302 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300004463|Ga0063356_103516004 | Not Available | 675 | Open in IMG/M |
| 3300005332|Ga0066388_101695252 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300005356|Ga0070674_100629343 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300005366|Ga0070659_100699749 | Not Available | 876 | Open in IMG/M |
| 3300005444|Ga0070694_100521946 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300005444|Ga0070694_101750369 | Not Available | 529 | Open in IMG/M |
| 3300005445|Ga0070708_100153307 | All Organisms → cellular organisms → Bacteria | 2144 | Open in IMG/M |
| 3300005459|Ga0068867_102066550 | Not Available | 539 | Open in IMG/M |
| 3300005468|Ga0070707_101543601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 631 | Open in IMG/M |
| 3300005471|Ga0070698_102053792 | Not Available | 525 | Open in IMG/M |
| 3300005529|Ga0070741_10000262 | All Organisms → cellular organisms → Bacteria | 200108 | Open in IMG/M |
| 3300005545|Ga0070695_100654227 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300005546|Ga0070696_101860892 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300005549|Ga0070704_100480333 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300005560|Ga0066670_10811179 | Not Available | 567 | Open in IMG/M |
| 3300005713|Ga0066905_100688195 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300005836|Ga0074470_11281775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 8135 | Open in IMG/M |
| 3300005836|Ga0074470_11796103 | All Organisms → cellular organisms → Bacteria | 18229 | Open in IMG/M |
| 3300006797|Ga0066659_10159893 | All Organisms → cellular organisms → Bacteria | 1611 | Open in IMG/M |
| 3300006844|Ga0075428_100806140 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300006845|Ga0075421_100563968 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
| 3300006847|Ga0075431_100793397 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300006894|Ga0079215_10549958 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300009094|Ga0111539_11331932 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300009176|Ga0105242_10267790 | Not Available | 1546 | Open in IMG/M |
| 3300009678|Ga0105252_10000145 | All Organisms → cellular organisms → Bacteria | 55149 | Open in IMG/M |
| 3300009823|Ga0105078_1028126 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 678 | Open in IMG/M |
| 3300010154|Ga0127503_11165080 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300010362|Ga0126377_13256491 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 525 | Open in IMG/M |
| 3300010391|Ga0136847_12328358 | Not Available | 599 | Open in IMG/M |
| 3300010399|Ga0134127_13642808 | Not Available | 505 | Open in IMG/M |
| 3300010401|Ga0134121_11648029 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300010403|Ga0134123_10390192 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300010938|Ga0137716_10001192 | All Organisms → cellular organisms → Bacteria | 70673 | Open in IMG/M |
| 3300011423|Ga0137436_1116670 | Not Available | 708 | Open in IMG/M |
| 3300011429|Ga0137455_1148180 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300011431|Ga0137438_1130937 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300011437|Ga0137429_1289249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 505 | Open in IMG/M |
| 3300011443|Ga0137457_1351701 | Not Available | 502 | Open in IMG/M |
| 3300012034|Ga0137453_1017185 | Not Available | 1112 | Open in IMG/M |
| 3300012035|Ga0137445_1084990 | Not Available | 639 | Open in IMG/M |
| 3300012226|Ga0137447_1042239 | Not Available | 798 | Open in IMG/M |
| 3300012285|Ga0137370_10049015 | All Organisms → cellular organisms → Bacteria | 2261 | Open in IMG/M |
| 3300012480|Ga0157346_1009313 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 693 | Open in IMG/M |
| 3300012511|Ga0157332_1087314 | Not Available | 512 | Open in IMG/M |
| 3300014307|Ga0075304_1165070 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 539 | Open in IMG/M |
| 3300014872|Ga0180087_1056205 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300015252|Ga0180075_1034004 | Not Available | 792 | Open in IMG/M |
| 3300015371|Ga0132258_11807170 | All Organisms → cellular organisms → Bacteria | 1540 | Open in IMG/M |
| 3300017966|Ga0187776_11355251 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 540 | Open in IMG/M |
| 3300018031|Ga0184634_10117476 | Not Available | 1174 | Open in IMG/M |
| 3300018053|Ga0184626_10014321 | All Organisms → cellular organisms → Bacteria | 3148 | Open in IMG/M |
| 3300018063|Ga0184637_10133190 | Not Available | 1533 | Open in IMG/M |
| 3300018064|Ga0187773_10038819 | All Organisms → cellular organisms → Bacteria | 2136 | Open in IMG/M |
| 3300018073|Ga0184624_10002454 | All Organisms → cellular organisms → Bacteria | 5522 | Open in IMG/M |
| 3300018074|Ga0184640_10518076 | Not Available | 523 | Open in IMG/M |
| 3300018079|Ga0184627_10680885 | Not Available | 505 | Open in IMG/M |
| 3300018082|Ga0184639_10048850 | All Organisms → cellular organisms → Bacteria | 2184 | Open in IMG/M |
| 3300018083|Ga0184628_10010900 | All Organisms → cellular organisms → Bacteria | 4384 | Open in IMG/M |
| 3300018466|Ga0190268_12002746 | Not Available | 532 | Open in IMG/M |
| 3300019245|Ga0187791_1320381 | Not Available | 968 | Open in IMG/M |
| 3300019362|Ga0173479_10154958 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 920 | Open in IMG/M |
| 3300019884|Ga0193741_1160341 | Not Available | 550 | Open in IMG/M |
| 3300021051|Ga0206224_1000134 | Not Available | 5971 | Open in IMG/M |
| 3300022534|Ga0224452_1024483 | All Organisms → cellular organisms → Bacteria | 1704 | Open in IMG/M |
| 3300025324|Ga0209640_10628742 | Not Available | 863 | Open in IMG/M |
| 3300026320|Ga0209131_1022009 | All Organisms → cellular organisms → Bacteria | 3817 | Open in IMG/M |
| 3300027071|Ga0209214_1052241 | Not Available | 554 | Open in IMG/M |
| 3300027548|Ga0209523_1119771 | Not Available | 544 | Open in IMG/M |
| 3300027573|Ga0208454_1000099 | All Organisms → cellular organisms → Bacteria | 64105 | Open in IMG/M |
| 3300027815|Ga0209726_10235884 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 935 | Open in IMG/M |
| 3300027862|Ga0209701_10459395 | Not Available | 699 | Open in IMG/M |
| 3300027875|Ga0209283_10269281 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300027909|Ga0209382_10415413 | Not Available | 1496 | Open in IMG/M |
| 3300031538|Ga0310888_10066451 | All Organisms → cellular organisms → Bacteria | 1741 | Open in IMG/M |
| 3300031538|Ga0310888_10252397 | Not Available | 991 | Open in IMG/M |
| 3300031716|Ga0310813_10184309 | All Organisms → cellular organisms → Bacteria | 1702 | Open in IMG/M |
| 3300031908|Ga0310900_10788216 | Not Available | 768 | Open in IMG/M |
| 3300031908|Ga0310900_11429324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300031965|Ga0326597_10004621 | All Organisms → cellular organisms → Bacteria | 19307 | Open in IMG/M |
| 3300032180|Ga0307471_100043308 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 3634 | Open in IMG/M |
| 3300032180|Ga0307471_100511945 | Not Available | 1349 | Open in IMG/M |
| 3300032205|Ga0307472_102214950 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 555 | Open in IMG/M |
| 3300032828|Ga0335080_10753972 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 12.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 8.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.00% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 7.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.00% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 2.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.00% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 1.00% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.00% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 1.00% |
| Hot Spring Fe-Si Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Fe-Si Sediment | 1.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.00% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.00% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.00% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.00% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000596 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA no BrdU F1.4TC | Environmental | Open in IMG/M |
| 3300003997 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 | Environmental | Open in IMG/M |
| 3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004027 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLC_D2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009823 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010938 | Sediment microbial community from Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA. Combined Assembly of Gp0156111, Gp0156114, Gp0156117 | Environmental | Open in IMG/M |
| 3300011423 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2 | Environmental | Open in IMG/M |
| 3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
| 3300011431 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2 | Environmental | Open in IMG/M |
| 3300011437 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2 | Environmental | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300012034 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2 | Environmental | Open in IMG/M |
| 3300012035 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012226 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2 | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012511 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300014307 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D1 | Environmental | Open in IMG/M |
| 3300014872 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10D | Environmental | Open in IMG/M |
| 3300015252 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT399_16_10D | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300019245 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
| 3300021051 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027573 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPgaii200_09510411 | 2228664022 | Soil | LTAACKKIPPGLARVRKEIPRPGKIFESKRNVTRKRAKEKLQQELKETVPRKS |
| INPhiseqgaiiFebDRAFT_1018301242 | 3300000364 | Soil | LTAACKKIPPGLARVRKEIPRPGKIFESKRNVTRKRAKEKLQQELKETVPRKS* |
| KanNP_Total_noBrdU_T14TCDRAFT_10192952 | 3300000596 | Soil | LSSSAKKIPLGLARVRKQLPPPGRIFKSKKTEQRKRSKERLRRELNETLPLKSS* |
| Ga0055466_102416582 | 3300003997 | Natural And Restored Wetlands | MPPKRIPPGLARVRKGIPPPGKIIESKKTERRKRAKERLLRELEEALPAKSA* |
| Ga0055469_102178132 | 3300003999 | Natural And Restored Wetlands | MPPKRIPPGLVRVRKEIPPPGKIIKSKKTERRKRAKERLLRELKEALPAKSA* |
| Ga0055437_101081922 | 3300004009 | Natural And Restored Wetlands | LSPLAKKIPIGLARVRKELPPPGKVFKSKAKDSRKRAKEKLQRELDETLSRHSR* |
| Ga0055439_102592292 | 3300004019 | Natural And Restored Wetlands | RTLRAKDGSLNAPSKKIPVGLARVRKEIPPPGKIFKSKKNEARKLARERLRRELQETLTSKSS* |
| Ga0055432_100411392 | 3300004022 | Natural And Restored Wetlands | LKAPSKKIPVGLARVRKEIPPPGKIFKSKKNEARKLARERLRRELQETLTSKSS* |
| Ga0055436_100876622 | 3300004024 | Natural And Restored Wetlands | LNAPSKKIPVGLARVRKEIPPPGKIFKSKKNEARKLARERLRRELQETLTSKSS* |
| Ga0055459_100101101 | 3300004027 | Natural And Restored Wetlands | LKSPSKKIPVGLARVRKGIPPPGKIFKSKKNETRKLARERLRRDLQETVLLKSS* |
| Ga0063356_1023833022 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LISSKRIPPGLARLRKALPPPGSVVKSKKTERRQRAKETLLRELKETLPPKSA* |
| Ga0063356_1035160042 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LSPAVKKIPIGLARVRKALPPPSKVFKSKHKDSRKRAKEKLQREIDETLPRHSR* |
| Ga0066388_1016952522 | 3300005332 | Tropical Forest Soil | LSSAAKQVPPGLARVRKQLPPPGRIFKSKKAEQRKRSKERLRRELNETLPLRSF* |
| Ga0070674_1006293431 | 3300005356 | Miscanthus Rhizosphere | LSPEAKKIPIGLARVRKELPPPSKVFKSRHQDSRKRAKEKLQREIDETLPRHSQ* |
| Ga0070659_1006997492 | 3300005366 | Corn Rhizosphere | LSAAVKRKIPPGLKQVRKELPPPGKVFGSKKAERRKQAKEHLRRELKESLPLKSS* |
| Ga0070694_1005219462 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | LSPPVKKIPIGLARVRKELPPPSKVFKSKHKDSRKRAMEKLQREIDETLSRNSR* |
| Ga0070694_1017503691 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | LKSSSKKIPVGLARVRKEIPPPGKIFKSKKIEARTLVKERLRRELKETQPSKSS* |
| Ga0070708_1001533072 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LTAAPKRIPPGLARVRKEIPPPGKVFKSKRNDTRKRAKEKLQQELKESGRHKS* |
| Ga0068867_1020665502 | 3300005459 | Miscanthus Rhizosphere | LNAPPKRIPLGLARVRKELPPPGKVFESKKADQRKRAKEKLRRELKETLPPKSS* |
| Ga0070707_1015436011 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MGSRDITLTAAPKRIPPGLARVRKEIPPPGKVFKSKRNDTRKQAKEKLQQELKESGRHKS |
| Ga0070698_1020537922 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LSPISKRIPRGLALVRKELPPPGKIFKSKKADRRKLAKELLRRELKEVLSAKLS* |
| Ga0070741_10000262114 | 3300005529 | Surface Soil | LSAALKRKIPLGLKRVRKELPPPGKVFQSKRSAPRQRAKEQLRRELKEGRPLNFS* |
| Ga0070695_1006542271 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LSPVSKKIPIGLARVRKELPPPSKVFKSKHKDSRKRAMEKLQREIDETLSRNSR* |
| Ga0070696_1018608921 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | KRIPPGLARLRKALPPPGSVVKSKKTERRQRAKETLLRELKETLPPKSA* |
| Ga0070704_1004803332 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | LSPAAKKIPIGLARVRKELPPPSKVFRSKDKDSRKRAKEKLQREIDETLPSNSR* |
| Ga0066670_108111792 | 3300005560 | Soil | VPPGLARVRKEVPPPGTIFKSKKTDRRKQAKEEIRRELKETLPRKFS* |
| Ga0066699_104950881 | 3300005561 | Soil | RKEVPPPGKIFKSKKTDRRKQAKEEIRRELKETLPRKFS* |
| Ga0066905_1006881951 | 3300005713 | Tropical Forest Soil | LSSAAKQVPPGLARVRKQLPSPGRIFKSKKTEQRKRSKERLRRELNETLPL |
| Ga0074470_112817754 | 3300005836 | Sediment (Intertidal) | LKSPSKKIPIGLVRGRKEIPPPGQIFKSEKNDTRKLASERFRRDLQETLLLKSS* |
| Ga0074470_117961035 | 3300005836 | Sediment (Intertidal) | LKSPSKKIPVGLARVRKEIPPPGKIFKSKKNEARKLARERLRRELQETLTSKSS* |
| Ga0066659_101598932 | 3300006797 | Soil | LRSSSRKVPPGLARVRKEVPPPGKIFKSKKTDRRKQAKEEIRRELKETLPRKFS* |
| Ga0075428_1008061403 | 3300006844 | Populus Rhizosphere | LSPAVKKIPIGLARVRKELPPPSKVFKSKHKDSRKRAKEKLQRELVETLPRHSQ* |
| Ga0075421_1005639682 | 3300006845 | Populus Rhizosphere | LSPAVKKIPIGLARVRKELPPPSKVFKSKHKDSRKRAKEKLQREIDETLPRHSR* |
| Ga0075431_1007933972 | 3300006847 | Populus Rhizosphere | LSPAAKKIPIGLARVRKELPPPSKVFKSKHKDSRKRAKEKLQREIDETLPRHSR* |
| Ga0079215_105499581 | 3300006894 | Agricultural Soil | IGLARVRKELPPPSKVFKSKHKDSRKRAKEKLQREIDETLPRHSR* |
| Ga0111539_113319322 | 3300009094 | Populus Rhizosphere | LSPPVKKIPIGLARVRKELPPPSKVFKSKHKDSRKRAKEKLQREIDETLPRHSR* |
| Ga0105242_102677901 | 3300009176 | Miscanthus Rhizosphere | LNASPKRIPLGLARVRKELPPPGKVFKSKKIDQRKRAKEKLRRELKETLPPKSS* |
| Ga0105252_1000014528 | 3300009678 | Soil | LSPLAKKIPIGLARVRKELPPPGKVFKSKARDSRKRAKEKLQRELDETLSRHSR* |
| Ga0105078_10281261 | 3300009823 | Groundwater Sand | RIPQGLARVRKELPPPGKIFKSKKKDNRKQSREELRRELRESQPGKPS* |
| Ga0127503_111650802 | 3300010154 | Soil | LNASPKRIPLGLARVRKELPPPGKVFESKKADQRKRAKEKLRREL |
| Ga0126377_132564911 | 3300010362 | Tropical Forest Soil | IPRGLARVRKELPPPGRIFKSKKTDRRKLAKEKLRRELKEVLSSKLS* |
| Ga0136847_123283581 | 3300010391 | Freshwater Sediment | LSPASKKIPLGLARVRKELPPPGKVFKSKAKDSRKRAKEKLQRELNETLPRHYR* |
| Ga0134127_136428082 | 3300010399 | Terrestrial Soil | LSPEAKKIPIGLARVRKELPPPSKVFKSRHQDSRKRAKEKLQREIDETLPRHSR* |
| Ga0134121_116480291 | 3300010401 | Terrestrial Soil | SLRGADHSLKSSSKKIPVGLARVRKEIPPPGKIFKSKKIEARTLVKERLRRELKETQPSKSS* |
| Ga0134123_103901922 | 3300010403 | Terrestrial Soil | DPLISSKRIPPGLARLRKAPPPPGSVVKSKKTERRQHAKDTLLRELKETLPPKSA* |
| Ga0137716_1000119241 | 3300010938 | Hot Spring Fe-Si Sediment | MPPGLARVRKPLPPPGRVFKSKKTDPRARAKEKLRRELKEILSREVS* |
| Ga0137436_11166702 | 3300011423 | Soil | LSPASKKIPIGLARVRKELPPPSKVFKTKHKDSRKRAKEKLQREIDETSPRHTR* |
| Ga0137455_11481802 | 3300011429 | Soil | LSPASKKIPIGLARVRKELPPPGKVFKSKHKDSRKRAKEKLQREIDETSPRHTR* |
| Ga0137438_11309372 | 3300011431 | Soil | LKSSSKKIPVGLARVRKEIPPPGKIFKSKKIEARKLVKEQLRRELQETQPSKSS* |
| Ga0137429_12892492 | 3300011437 | Soil | LSPAAKKIPIGLARVRKELPPPGKVFKSKARDSRKRAKEKLQRELDETLSRHSR* |
| Ga0137457_13517012 | 3300011443 | Soil | LSPASKKIPIGLARVRKELPPPGKVFKSNHKDSRKRAKEKLQREIDETLPRHTR* |
| Ga0137453_10171852 | 3300012034 | Soil | LSPASKKIPIGLARVRKELPPPSKVFKSKHKDSRKRAKEKLQREIDETLPRHSR* |
| Ga0137445_10849902 | 3300012035 | Soil | LSPASKKIPIGLARVRKALPPPGKVFKSKHKDSRKRAKEKLQREIDETSPRHTR* |
| Ga0137382_100404973 | 3300012200 | Vadose Zone Soil | MARVRKEVPPPGKIFKSKKTDRRKQAKEEIRRELKETLPRKSS* |
| Ga0137378_111724072 | 3300012210 | Vadose Zone Soil | MARVRKEVPPPGKIFKSKKTDRRKQAKEEIRRELKETLPRKFS* |
| Ga0137447_10422392 | 3300012226 | Soil | LSPASKKIPIALARVRKALPPPGKVFKSKHKDSRKRAKEKLQRELEESSPRHSR* |
| Ga0137370_100490152 | 3300012285 | Vadose Zone Soil | VPPGLARVRKEVPPPGKIFKSKKTDRRKQAKEEIRRELKETLPRKSS* |
| Ga0157346_10093131 | 3300012480 | Arabidopsis Rhizosphere | IPLGLARVRKALPRPGKVFESKKTDQRKRTKEKLRRELKEILPLKSS* |
| Ga0157332_10873141 | 3300012511 | Soil | LNASPKRIPLGLARVRKALPPPGKVFESKKTDQRKRTKEKLRRELKEILPLKSS* |
| Ga0126375_104657401 | 3300012948 | Tropical Forest Soil | RVRKELPPPGRIFKSKKTDRRKLAKEKLRRELKEVLSSKLS* |
| Ga0075304_11650701 | 3300014307 | Natural And Restored Wetlands | SKRIPVGLARVRKDVPPPGKIFKSKKNETRKLARERLRRDLQETVLLKSS* |
| Ga0180087_10562052 | 3300014872 | Soil | LSPAAKKIPIGLARVRKELPPPGKVFKSKAKDSRKRAKEKLQRELDETLPRHSR* |
| Ga0180075_10340041 | 3300015252 | Soil | LSPASKKIPIGLARVRKELPPPSKVFKSKHKDSRKRAKEKLQREIDETSPRHTR* |
| Ga0132258_118071702 | 3300015371 | Arabidopsis Rhizosphere | IPPGLARVRKELPPPVSIIQSKKSERRKRAKERLLRELKETFPPKSL* |
| Ga0187776_113552512 | 3300017966 | Tropical Peatland | ASSKKIPLGLARVRKEVPPPSKIFKSKKSEARKQAKQQLRREIQESQLAKPS |
| Ga0184634_101174761 | 3300018031 | Groundwater Sediment | LSPASKKIPIGLARVRKELPPPSKVFKSKAKDSRKRAKEKLQRELDETLPRHFR |
| Ga0184626_100143212 | 3300018053 | Groundwater Sediment | LSPASKKIPIGLARVRKELPPPGKVFKSKHKDSRKRAKEKLQRELEESLPRHSR |
| Ga0184637_101331902 | 3300018063 | Groundwater Sediment | LSPASKKIPIGLARVRKELPPPSKVFKSKHKDTRKRAKEKLQREIDETLPRHTR |
| Ga0187773_100388191 | 3300018064 | Tropical Peatland | HSLRASSKKIPLGLARVRKEVPPPSKIFKSKKSEARKQAKQQLRREIQESQLAKPS |
| Ga0184624_100024543 | 3300018073 | Groundwater Sediment | LNASPKRIPLGLARVRKELPPPGKVFKSKQIDQRKRAKEKLRRELKETLPPKSS |
| Ga0184640_105180761 | 3300018074 | Groundwater Sediment | LSPASKKISIGLARVRKELPPPGKVFKSKAKDSRKRAKEKLQRELDETLPRHSR |
| Ga0184627_106808852 | 3300018079 | Groundwater Sediment | LSPASKKIPIGLARVRKELPPPGKVFKSKAKDSRKRAKEKLQRELDETLPRHSR |
| Ga0184639_100488502 | 3300018082 | Groundwater Sediment | LSPASKKIPIGLARVRKELPPPSKVFKSKAKDSRKRAKEKLQRELDETLPRHSR |
| Ga0184628_100109002 | 3300018083 | Groundwater Sediment | LSPEAKKIPIGLARVRKELPPPSKVFKSRHQDSRKRAKEKLQREIDETLPRHSQ |
| Ga0190268_120027461 | 3300018466 | Soil | KIPIGLARVRKELPPPSKVFKSKHKDSRKRAKEKLQREIDETLPRHSR |
| Ga0187791_13203811 | 3300019245 | Peatland | LRASSKKIPLGLARVRKEVPPPSKIFKSKKSEARKQAKQQLRREIQESQL |
| Ga0173479_101549582 | 3300019362 | Soil | LSPEAKKIPIGLARVRKELPPPSKVFKSRHQDSRKRAKEKLQREIDETLPRHSR |
| Ga0193741_11603411 | 3300019884 | Soil | LSPAAKKIPIGLARVRKELPPPSKVFKSKHKDSRKRAKEKLQREIDETLPRH |
| Ga0206224_10001344 | 3300021051 | Deep Subsurface Sediment | LSPASKKIPIGLARVRKELPPPSKVFKSKHKDSRKRAKEKLQREIDETLPRHSQ |
| Ga0224452_10244831 | 3300022534 | Groundwater Sediment | LSPISKRIPRRLALVRKELPPPGKIFKSKKADRRKLAKELLRRELKEVLSAKLS |
| Ga0209640_106287421 | 3300025324 | Soil | LSPALKKIPIGLARVRKELPPPSKVFKSKHKDSRKRAKEKLQREIDETLPRHSQ |
| Ga0209131_10220092 | 3300026320 | Grasslands Soil | LKSSSKKIPVGLARVRKEIPPPGKIFKSKKIEARNLVKERLRRELKETQPSKSS |
| Ga0209214_10522412 | 3300027071 | Forest Soil | LTAASKRKRIPPALARVRKEIPRPGKIFESKMIITRKRAKEKLQQEWKESIPRKS |
| Ga0209523_11197711 | 3300027548 | Forest Soil | LTAASKKKRITPALARVRKEIPRPGKIFESKRIITRKRAKEKFQQEWKESI |
| Ga0208454_100009929 | 3300027573 | Soil | LSPLAKKIPIGLARVRKELPPPGKVFKSKARDSRKRAKEKLQRELDETLSRHSR |
| Ga0209726_102358842 | 3300027815 | Groundwater | LRPSSKKIPVGLARVRKEIPPPGKIFKSKKNEARKRAKEKLRRELQETQPSTSS |
| Ga0209701_104593952 | 3300027862 | Vadose Zone Soil | MGSRDITLTAAPKRIPPGLARVRKEIPPPGKVFKSKRNDTRKRAKEKLQQELKESGRHKS |
| Ga0209283_102692812 | 3300027875 | Vadose Zone Soil | LTAAPKRIPPGLARVRKEIPPPGKVFKSKRNDTRKRAKEKLQQELKESGRHKS |
| Ga0209382_104154132 | 3300027909 | Populus Rhizosphere | LSPAVKKIPIGLARVRKELPPPSKVFKSKHKDSRKRAKEKLQREIDETLPRHSR |
| Ga0209382_104320522 | 3300027909 | Populus Rhizosphere | RVRKEIPPPGKIFKSKKNEARKLARERLRRELQETLSSKSS |
| Ga0310888_100664512 | 3300031538 | Soil | KNAPLNASPKRIPLGLARVRKALPRPGKVFESKKTDQRKRTKEKLRRELKEILPPKSS |
| Ga0310888_102523972 | 3300031538 | Soil | LSPAVKKIPIGLARVRKELPPPSKVFKSRHQDSRKRAKEKLQREIDETLPRHSQ |
| Ga0310813_101843092 | 3300031716 | Soil | LKASLKKIPVGLARVRKEIPPPGKIFKSKRIEARQLVKEQLRRELQETQTSKSS |
| Ga0310900_107882162 | 3300031908 | Soil | LISSKRIPPGLARLRKALPPPGSVVKSKKTERRQRAKETLLRELKETLPPKSA |
| Ga0310900_114293241 | 3300031908 | Soil | LSPEAKKIPIGLARVRKELPPPGKVYKSKHKDSRKRAKEKLQREIDETLPRHSR |
| Ga0326597_100046215 | 3300031965 | Soil | LNAPSKKISIGLARVRKEIPPPGKIFVSKKHEARKLAKEQLRRELKESLPSQSP |
| Ga0307471_1000433081 | 3300032180 | Hardwood Forest Soil | TAACKKIPPGLARVRKEIPRPGKIFESKRNVTRKRAKEKLQQELKETVPRKS |
| Ga0307471_1005119452 | 3300032180 | Hardwood Forest Soil | LTAACKKIPPGLARVRKEIPRPGKIFESKRNVTRKRAKEKLQQELKET |
| Ga0307472_1022149502 | 3300032205 | Hardwood Forest Soil | LGLARVRKALPRPGKVFESKKTDQRKRTKEKLRRELKEILPFKSS |
| Ga0335080_107539721 | 3300032828 | Soil | LRAAAKKVPPGLARVRKEIPRPGKIFASKRTISRKRAKENLRRELEDSISPEP |
| ⦗Top⦘ |