 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F104757 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MLYLISITLSLLGGFVAGLLVARKHAERLKATEAEGRKLLDALKGK |
| Number of Associated Samples | 57 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 18.00 % |
| % of genes near scaffold ends (potentially truncated) | 26.00 % |
| % of genes from short scaffolds (< 2000 bps) | 70.00 % |
| Associated GOLD sequencing projects | 56 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (72.000 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater (15.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (47.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 89.13% β-sheet: 0.00% Coil/Unstructured: 10.87% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF06114 | Peptidase_M78 | 7.00 |
| PF01343 | Peptidase_S49 | 1.00 |
| PF05876 | GpA_ATPase | 1.00 |
| PF12684 | DUF3799 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 2.00 |
| COG5525 | Phage terminase, large subunit GpA | Mobilome: prophages, transposons [X] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.00 % |
| Unclassified | root | N/A | 25.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000882|FwDRAFT_10074082 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3490 | Open in IMG/M |
| 3300004240|Ga0007787_10089512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1427 | Open in IMG/M |
| 3300004240|Ga0007787_10371322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 711 | Open in IMG/M |
| 3300004481|Ga0069718_10140432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1470 | Open in IMG/M |
| 3300004481|Ga0069718_10175009 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1458 | Open in IMG/M |
| 3300005581|Ga0049081_10235580 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 646 | Open in IMG/M |
| 3300005582|Ga0049080_10210309 | Not Available | 641 | Open in IMG/M |
| 3300005662|Ga0078894_10089448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Idiomarinaceae → unclassified Idiomarinaceae → Idiomarinaceae bacterium | 2697 | Open in IMG/M |
| 3300005662|Ga0078894_10132550 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2226 | Open in IMG/M |
| 3300005662|Ga0078894_10160495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2024 | Open in IMG/M |
| 3300005662|Ga0078894_11296587 | Not Available | 613 | Open in IMG/M |
| 3300005805|Ga0079957_1126288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1343 | Open in IMG/M |
| 3300006802|Ga0070749_10353849 | Not Available | 816 | Open in IMG/M |
| 3300006802|Ga0070749_10749619 | Not Available | 520 | Open in IMG/M |
| 3300006875|Ga0075473_10217906 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 771 | Open in IMG/M |
| 3300007544|Ga0102861_1227132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
| 3300007972|Ga0105745_1310038 | Not Available | 517 | Open in IMG/M |
| 3300007973|Ga0105746_1072795 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1103 | Open in IMG/M |
| 3300008055|Ga0108970_10195737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1876 | Open in IMG/M |
| 3300008114|Ga0114347_1045184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1907 | Open in IMG/M |
| 3300008114|Ga0114347_1051901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1742 | Open in IMG/M |
| 3300008259|Ga0114841_1073822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1570 | Open in IMG/M |
| 3300008261|Ga0114336_1004428 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11454 | Open in IMG/M |
| 3300008261|Ga0114336_1343654 | Not Available | 538 | Open in IMG/M |
| 3300008266|Ga0114363_1019400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3019 | Open in IMG/M |
| 3300008266|Ga0114363_1023402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2692 | Open in IMG/M |
| 3300008266|Ga0114363_1081758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1203 | Open in IMG/M |
| 3300008266|Ga0114363_1109913 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 977 | Open in IMG/M |
| 3300008266|Ga0114363_1153375 | Not Available | 762 | Open in IMG/M |
| 3300008266|Ga0114363_1171019 | Not Available | 700 | Open in IMG/M |
| 3300008266|Ga0114363_1214824 | Not Available | 576 | Open in IMG/M |
| 3300008267|Ga0114364_1069236 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1193 | Open in IMG/M |
| 3300008448|Ga0114876_1095875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1195 | Open in IMG/M |
| 3300008450|Ga0114880_1047412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1833 | Open in IMG/M |
| 3300008450|Ga0114880_1082992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1274 | Open in IMG/M |
| 3300008450|Ga0114880_1100841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1116 | Open in IMG/M |
| 3300009051|Ga0102864_1193282 | Not Available | 555 | Open in IMG/M |
| 3300009165|Ga0105102_10775239 | Not Available | 544 | Open in IMG/M |
| 3300010354|Ga0129333_10636295 | Not Available | 923 | Open in IMG/M |
| 3300012013|Ga0153805_1005902 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2147 | Open in IMG/M |
| 3300012017|Ga0153801_1003691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2933 | Open in IMG/M |
| 3300013372|Ga0177922_10124113 | Not Available | 722 | Open in IMG/M |
| 3300017707|Ga0181363_1084012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300017754|Ga0181344_1002460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6559 | Open in IMG/M |
| 3300017754|Ga0181344_1016323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2330 | Open in IMG/M |
| 3300017766|Ga0181343_1001804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8355 | Open in IMG/M |
| 3300017766|Ga0181343_1016622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2306 | Open in IMG/M |
| 3300017785|Ga0181355_1033060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2229 | Open in IMG/M |
| 3300019784|Ga0181359_1052190 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1576 | Open in IMG/M |
| 3300020159|Ga0211734_10046750 | Not Available | 733 | Open in IMG/M |
| 3300020159|Ga0211734_10819389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
| 3300020161|Ga0211726_10351348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 870 | Open in IMG/M |
| 3300020172|Ga0211729_11061378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 820 | Open in IMG/M |
| 3300020205|Ga0211731_10022213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5510 | Open in IMG/M |
| 3300020205|Ga0211731_11268468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1212 | Open in IMG/M |
| 3300020527|Ga0208232_1048384 | Not Available | 541 | Open in IMG/M |
| 3300021956|Ga0213922_1002392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6454 | Open in IMG/M |
| 3300021961|Ga0222714_10021039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5094 | Open in IMG/M |
| 3300021961|Ga0222714_10050842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2873 | Open in IMG/M |
| 3300021961|Ga0222714_10068074 | All Organisms → Viruses → Predicted Viral | 2372 | Open in IMG/M |
| 3300021961|Ga0222714_10106981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1756 | Open in IMG/M |
| 3300021961|Ga0222714_10373857 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 760 | Open in IMG/M |
| 3300021962|Ga0222713_10019358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5759 | Open in IMG/M |
| 3300021962|Ga0222713_10027316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4665 | Open in IMG/M |
| 3300021962|Ga0222713_10049537 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3219 | Open in IMG/M |
| 3300021963|Ga0222712_10003180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18108 | Open in IMG/M |
| 3300021963|Ga0222712_10017311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6148 | Open in IMG/M |
| 3300022179|Ga0181353_1165759 | Not Available | 500 | Open in IMG/M |
| 3300022190|Ga0181354_1023274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1984 | Open in IMG/M |
| 3300022214|Ga0224505_10301872 | Not Available | 607 | Open in IMG/M |
| 3300027608|Ga0208974_1115096 | Not Available | 707 | Open in IMG/M |
| 3300027899|Ga0209668_10314223 | Not Available | 1009 | Open in IMG/M |
| 3300027899|Ga0209668_10658422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
| 3300027900|Ga0209253_10080019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2691 | Open in IMG/M |
| 3300031758|Ga0315907_10014083 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7700 | Open in IMG/M |
| 3300031758|Ga0315907_10053899 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3528 | Open in IMG/M |
| 3300031758|Ga0315907_10483803 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 983 | Open in IMG/M |
| 3300031758|Ga0315907_10888836 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
| 3300031857|Ga0315909_10081272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2858 | Open in IMG/M |
| 3300031857|Ga0315909_10572982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 761 | Open in IMG/M |
| 3300031857|Ga0315909_10586033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 749 | Open in IMG/M |
| 3300031857|Ga0315909_10593094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 742 | Open in IMG/M |
| 3300031857|Ga0315909_10608659 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
| 3300031857|Ga0315909_10677766 | Not Available | 673 | Open in IMG/M |
| 3300031951|Ga0315904_10125509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2647 | Open in IMG/M |
| 3300031951|Ga0315904_11411948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
| 3300032046|Ga0315289_10228955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1996 | Open in IMG/M |
| 3300032046|Ga0315289_10410935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1341 | Open in IMG/M |
| 3300032050|Ga0315906_10201663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1871 | Open in IMG/M |
| 3300032050|Ga0315906_11308812 | Not Available | 516 | Open in IMG/M |
| 3300032092|Ga0315905_10917106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
| 3300033993|Ga0334994_0256595 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 911 | Open in IMG/M |
| 3300034102|Ga0335029_0121300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1821 | Open in IMG/M |
| 3300034102|Ga0335029_0470075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
| 3300034104|Ga0335031_0066388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2580 | Open in IMG/M |
| 3300034104|Ga0335031_0164186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1527 | Open in IMG/M |
| 3300034110|Ga0335055_0271852 | Not Available | 730 | Open in IMG/M |
| 3300034283|Ga0335007_0768137 | Not Available | 528 | Open in IMG/M |
| 3300034283|Ga0335007_0781250 | Not Available | 521 | Open in IMG/M |
| 3300034283|Ga0335007_0816032 | Not Available | 504 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 15.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 15.00% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 13.00% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 10.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.00% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.00% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 3.00% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.00% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 2.00% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.00% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 2.00% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.00% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.00% |
| Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 1.00% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 1.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.00% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.00% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.00% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022214 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FwDRAFT_100740824 | 3300000882 | Freshwater And Marine | MLYVISITLALLGGFVTGLLVARKHADRLKASEAEGRKLLDALKGK* |
| Ga0007787_100895121 | 3300004240 | Freshwater Lake | MLYLIAIVLSLLGGFVAGLLVARKHAERLKATESEGRKLLDALKGK* |
| Ga0007787_103713222 | 3300004240 | Freshwater Lake | MLYLISITLSLLGGFVAGLLVARRHGERLKATEAEGRKLLDALKGK* |
| Ga0069718_101404322 | 3300004481 | Sediment | MLYIISVTLSLLGGFVAGLLVARKHAERLKASEAEGRKLLDALKGK* |
| Ga0069718_101750092 | 3300004481 | Sediment | MLYLISITLSLLGGFVAGLLVARKHAERLKASEAEGRKLLDALKGK* |
| Ga0049081_102355803 | 3300005581 | Freshwater Lentic | MLYLISITLALLGGFVAGLLVARKHADRLKASEAEGRK |
| Ga0049080_102103091 | 3300005582 | Freshwater Lentic | MLYLISITLALLGGFVAGLLVARKHADRLKASEAEG |
| Ga0078894_100894484 | 3300005662 | Freshwater Lake | MLYLISITLSLLGGFVAGLLVARKHAERLKATEAEGRKLLDALKGK* |
| Ga0078894_101325504 | 3300005662 | Freshwater Lake | MLYLISITLALLGGFVAGLLVARKHAERLKATESEGRKLLDALKGK* |
| Ga0078894_101604953 | 3300005662 | Freshwater Lake | MLYIISITLSLLGGFVAGLLVARKHAERLKAGEAEGRKLLDALKGK* |
| Ga0078894_112965871 | 3300005662 | Freshwater Lake | YLISITLSLLGGFVAGLLVARRHGERLKATEAEGRKLLDALKGK* |
| Ga0079957_11262883 | 3300005805 | Lake | MLYLISIVLSLLGGFVAGLLFARKHAERLKATESEGRKLLDALKGK* |
| Ga0070749_103538493 | 3300006802 | Aqueous | MLYLISITLSLLGGFVAGLLVARKHGERLKASEAEGRRLLDALKGK* |
| Ga0070749_107496192 | 3300006802 | Aqueous | MLYVISIVLSLLGGFVAGLLVARKHAERLKATESEGRKLLDALKGK* |
| Ga0075473_102179062 | 3300006875 | Aqueous | MLYLISITLSLLGGFIAGLLVARKHGERLKASEAEGRKLLDALKGK* |
| Ga0102861_12271322 | 3300007544 | Estuarine | MLYLISITLALLGGFVCGLLVARKHADRLKASEAEGRKLLDALKGK* |
| Ga0105745_13100382 | 3300007972 | Estuary Water | MLYLISITLALLGGFVTGLLVARRHADRLKATEAEGRKLLDALKGK* |
| Ga0105746_10727951 | 3300007973 | Estuary Water | MLYLIAIVLSLLGGFVAGVLFARKHAERLKATESEGKRLLDALKGK* |
| Ga0108970_101957373 | 3300008055 | Estuary | MLYLIAIVLSLLGGFVAGVLFARKHAERLKATESEGRKLLDALKGK* |
| Ga0114347_10451842 | 3300008114 | Freshwater, Plankton | MLYIISITLSLLGGFVAGLLVARKHGERLKASEAEGRKLLDALKGK* |
| Ga0114347_10519012 | 3300008114 | Freshwater, Plankton | MLYLISVTLSLLGGFVAGLLVARKHGERLKASEAEGRKLLDALKGK* |
| Ga0114841_10738223 | 3300008259 | Freshwater, Plankton | MLYLISITLSLLGGFVAGLLVARKHGERLKASEAEGRKLLDALKGK* |
| Ga0114336_100442817 | 3300008261 | Freshwater, Plankton | MLYLISITLSLLAGFVAGLLVARKHGERLKASEAEGRKLLDALKGK* |
| Ga0114336_13436542 | 3300008261 | Freshwater, Plankton | MLYIISITLSLLAGFVAGLLVARKHAERLKASEAEGRKLLDALKGK* |
| Ga0114363_10194001 | 3300008266 | Freshwater, Plankton | MLYLIAIVLSLLGGFVAGVLFARKHAERLKATESEGKRLL |
| Ga0114363_10234022 | 3300008266 | Freshwater, Plankton | MLYLIAIVLSLLAGFVAGVLFARKHAERLKATESEGKRLLDALKGK* |
| Ga0114363_10817583 | 3300008266 | Freshwater, Plankton | MLYLIAIVLSLLGGFVAGVLFARKHAERLKATESEGKR |
| Ga0114363_11099131 | 3300008266 | Freshwater, Plankton | PTFGSSGTKLNTMLYLISITLSLLGGFVAGLLVARKHAERLKASEAEGRKLLDALKGK* |
| Ga0114363_11533752 | 3300008266 | Freshwater, Plankton | MIYLIAIVLSLLAGFVAGVLFARKHAERLKATESEGKRLLDALKGK* |
| Ga0114363_11710191 | 3300008266 | Freshwater, Plankton | MLYLIAIVLSLLGGFVAGVLFARKHAERLKATESEGK |
| Ga0114363_12148242 | 3300008266 | Freshwater, Plankton | FSPDFNPMLYIISSALCLLAGFVAGLLVARKHAERLKATESEGRKLLDALKGK* |
| Ga0114364_10692362 | 3300008267 | Freshwater, Plankton | MLYLIAIVLSFTAGLATGLLVFRRHAERLKAAESEGRKLLDALKNPPRG* |
| Ga0114876_10958754 | 3300008448 | Freshwater Lake | MLYIISITLSLLGGFVAGLLVARKHADRLKSTEDETRKLLDALKGK* |
| Ga0114880_10474122 | 3300008450 | Freshwater Lake | MLYIISITLSLLGGFVAGLLVARKHAERLKATEAEGRKLLDALKGK* |
| Ga0114880_10829922 | 3300008450 | Freshwater Lake | MLYIISSALCLLAGFVAGLLVARKHAERLKATESEGRKLLDALKGK* |
| Ga0114880_11008412 | 3300008450 | Freshwater Lake | MLYLISITLSLLGGFVAGLLVARKHAERLKATEAEGRKLLEALKGK* |
| Ga0102864_11932822 | 3300009051 | Estuarine | LYLISITLALLGGFVCGLLVARKHADRLKASEAEGRKLLDALKGK* |
| Ga0105102_107752391 | 3300009165 | Freshwater Sediment | MLYLISITLALLGGFVTGLLVARKHADRLKASEAEGRKLLD |
| Ga0129333_106362952 | 3300010354 | Freshwater To Marine Saline Gradient | MLYLISIVLSFTAGLATGLLVFRRHAERLKAAESEGKRLLDALKGK* |
| Ga0153805_10059022 | 3300012013 | Surface Ice | MLYLISITLSLLGGFVAGLLVARKHADRLKASEAEGRKLLDALKGK* |
| Ga0153801_10036913 | 3300012017 | Freshwater | MLYLISITLALLGGFVAGLLVARKHADRMKASEAEGRKLLDALKGK* |
| Ga0177922_101241132 | 3300013372 | Freshwater | MVSFFSLMLYLIAITLSLLGGFVAGVLFARKHAERLKATESEGKRLLDALKGK* |
| Ga0181363_10840122 | 3300017707 | Freshwater Lake | MLYLISITLSLLGGFVAGLLVARKHGERLKASEAEGRRLLDALKGK |
| Ga0181344_10024609 | 3300017754 | Freshwater Lake | MLYLISITLSLLGGFVAGLLVARKHAERLKATEAEGRKLLDALKGK |
| Ga0181344_10163234 | 3300017754 | Freshwater Lake | MLYLISITLALLGGFVAGLLVARKHAERLKAGEAEGRKLLDALKGK |
| Ga0181343_10018042 | 3300017766 | Freshwater Lake | MLYLISITLALLGGFVAGLLVARKHAERLKATESEGRKLLDALKGK |
| Ga0181343_10166222 | 3300017766 | Freshwater Lake | MLYIISITLSLLGGFVAGLLVARKHAERLKAGEAEGRKLLDALKGK |
| Ga0181355_10330603 | 3300017785 | Freshwater Lake | MLYLISITLSLLGGFVAGLLVARKHGERLKASEAEGRKLLEALKGK |
| Ga0181359_10521902 | 3300019784 | Freshwater Lake | MLYLIAIVLSLLGGFVAGVLFARKHAERLKATESEGKRLLDALKGK |
| Ga0211734_100467502 | 3300020159 | Freshwater | MLYLISITLSLLGGFVAGLLVARKHADRLKASEAEGRKLLDALKGK |
| Ga0211734_108193892 | 3300020159 | Freshwater | MLYLISIALSLLGGFVAGLLVARRHAERLKSAETEGRRLLEALKGK |
| Ga0211726_103513482 | 3300020161 | Freshwater | MLYLISITLSLLGGFLAGILVARKHADRLKASEAEGRKLLDALKGK |
| Ga0211729_110613782 | 3300020172 | Freshwater | MLYLISVTLSLLGGFVAGLLVARKHAERLKAGEAEGRKLLDALKGK |
| Ga0211731_100222131 | 3300020205 | Freshwater | MLYIISIALSILGGFVAGLLVARKHAERLKASEAEGRKLLDALKGK |
| Ga0211731_112684683 | 3300020205 | Freshwater | LISITLSLLGGFVAGLLVARKHADRMKAGEAEGRKLLDALKGK |
| Ga0208232_10483842 | 3300020527 | Freshwater | MLYLISTTLALLGGFVCGLLVARKHADRLKASEAEGRKLLDALKGK |
| Ga0213922_10023929 | 3300021956 | Freshwater | MLYLIAIVLSLLGGFVAGLLVARNNYNRLKAAESEGKRLLDALKGK |
| Ga0222714_1002103910 | 3300021961 | Estuarine Water | MLYIISVTLSLLGGFVAGLLVARKHAERLKSTEAEGKRLLDALKGK |
| Ga0222714_100508423 | 3300021961 | Estuarine Water | MLYLIAITLSLLGGFVAGVLVARKHAERLKATESEGRKLLDALKGK |
| Ga0222714_100680743 | 3300021961 | Estuarine Water | MLYLIAIILSLLAGFAAGALFYRKNSERLKATESEGKKLLEALKGK |
| Ga0222714_101069813 | 3300021961 | Estuarine Water | MLYLISITLSLLAGFVAGLLVARKHADRLKSTEAETRKLLDALKGK |
| Ga0222714_103738572 | 3300021961 | Estuarine Water | MLYLIAIVLSILGGFVAGLLVARKHGERLKATESEGKRLLDALKGK |
| Ga0222713_100193589 | 3300021962 | Estuarine Water | MLYLISVTLSLLGGFVAGLLVARKHAERLKASEAEGRKLLDALKGK |
| Ga0222713_100273167 | 3300021962 | Estuarine Water | MLYIIAITLSLLAGFVAGLLVARKHAERLKATESEGRKLLDALKGK |
| Ga0222713_100495375 | 3300021962 | Estuarine Water | MLYIISITLSLLGGFVAGLLVARKHGERLKASEAEGRKLLDALK |
| Ga0222712_100031808 | 3300021963 | Estuarine Water | MLYVISIVLSLLGGFVAGLLVARKHADRLKATESEGRKLLDALKGK |
| Ga0222712_1001731118 | 3300021963 | Estuarine Water | MLYLISITLSLLGGFVAGVLFARKHAERLKATESEGKRLLDALKGK |
| Ga0181353_11657591 | 3300022179 | Freshwater Lake | RISITLSLLGGFVAGLLVARRHGERLKATEAEGRKLLDALKGK |
| Ga0181354_10232743 | 3300022190 | Freshwater Lake | MLYLISITLSLLGGFVAGLLVARRHGERLKATEAEGRKLLDALKGK |
| Ga0224505_103018721 | 3300022214 | Sediment | MLYLISITLSLLAGFVAGLLVARKHADRLKSTEAEGRK |
| Ga0208974_11150962 | 3300027608 | Freshwater Lentic | MLYLISITLALLGGFVAGLLVARKHADRLKASEAEGRKLLDALKGK |
| Ga0209668_103142232 | 3300027899 | Freshwater Lake Sediment | MLYLIAITLSLLGGFVGGILFARKHAERLKATESEGRKLLDALKGK |
| Ga0209668_106584222 | 3300027899 | Freshwater Lake Sediment | MLYVISIVLSLLGGFVAGLLVARKHAERLKATESEGKRLLDALKGK |
| Ga0209253_100800197 | 3300027900 | Freshwater Lake Sediment | MLYLISVTLSLLGGFVCGLLVARKHADRLKATESEGRKLLDALKGK |
| Ga0315907_100140832 | 3300031758 | Freshwater | MLYIISSALCLLAGFVAGLLVARKHAERLKATESEGRKLLDALKGK |
| Ga0315907_100538994 | 3300031758 | Freshwater | MLYLIAIVLSLLAGFVAGVLFARKHAERLKATESEGKRLLDALKGK |
| Ga0315907_104838032 | 3300031758 | Freshwater | MLYLIAIVLSLLGGFVAGVLFARKHAERLKATESEGKRL |
| Ga0315907_108888361 | 3300031758 | Freshwater | LYLIAIVLSLLGGFVAGVLFARRHAERLKATETEGRKLLDALKGK |
| Ga0315909_100812722 | 3300031857 | Freshwater | VVRFYLISMLYIISITLSLLGGFVAGLLVARKHAERLKATEAEGRKLLDALKGK |
| Ga0315909_105729822 | 3300031857 | Freshwater | LSLLGGFVAGLLVARKHAERLKASEAEGRKLLEALKGK |
| Ga0315909_105860332 | 3300031857 | Freshwater | LDLYLISMLYLISITLSLLGGFVAGLLVARKHAERLKATEAEGRKVLDALKGT |
| Ga0315909_105930941 | 3300031857 | Freshwater | IVLSLLGGFVAGVLFARKHAERLKATESEGKRLLDALKGK |
| Ga0315909_106086592 | 3300031857 | Freshwater | YIISITLSLLGGFVAGLLVARKHGERLKASEAEGRKLLDALKGK |
| Ga0315909_106777662 | 3300031857 | Freshwater | MLYLIAITLSLLGGFVAGVLFARKHADRLKATESEGKRLLDALKGK |
| Ga0315904_101255092 | 3300031951 | Freshwater | MLYLIAIVLSLLGGFVAGVLFARKHAERLKATESEGKRLLDALKGKQ |
| Ga0315904_114119482 | 3300031951 | Freshwater | MLYVISIVLSLLGGFVAGVLFARRHAERLKATETEGRKLLDALKGK |
| Ga0315289_102289552 | 3300032046 | Sediment | MLYVISITLALLGGFVTGLLVARKHADRLKATESEGRKLLDALKGK |
| Ga0315289_104109352 | 3300032046 | Sediment | MLYLISITLALLGGFVTGLLVARKHADRLKASEAEGRKLLDALKGK |
| Ga0315906_102016631 | 3300032050 | Freshwater | MLYLIAIVLSLLGGFVAGVLFARKHAERLKATESEGKRLLDAL |
| Ga0315906_113088122 | 3300032050 | Freshwater | SMLYIISITLSLLGGFVAGLLVARKHGERLKASEAEGRKLLDALKGK |
| Ga0315905_109171062 | 3300032092 | Freshwater | LYLIAIVLSLLGGFVAGVLFARKHAERLKATESEGKRLLDALKGK |
| Ga0334994_0256595_128_268 | 3300033993 | Freshwater | MLYVISTTLALLGGFVCGLLVARKHADRLKASEAEGRKLLDALKGK |
| Ga0335029_0121300_408_548 | 3300034102 | Freshwater | MLYLISVTLSLLGGFVAGLLVARKHADRLKASEAEGRKLLDALKGK |
| Ga0335029_0470075_623_736 | 3300034102 | Freshwater | ALLGGFVCGLLVARKHADRLKASEAEGRKLLDALKGK |
| Ga0335031_0066388_1179_1319 | 3300034104 | Freshwater | MLYVISITLALLGGFVCGLLVARKHADRLKASEAEGRKLLDALKGK |
| Ga0335031_0164186_779_919 | 3300034104 | Freshwater | MLYLISVTLSLLGGFVAGLLVARRHGDRLKASEAEGRKLLDALKGK |
| Ga0335055_0271852_67_207 | 3300034110 | Freshwater | MLYLISITLALLGGFVCGLLVARRHADRLKASEAEGRKLLDALKGK |
| Ga0335007_0768137_51_191 | 3300034283 | Freshwater | MLYITSITLALLGGFVCGLLVARKHADRLKASEAEGRKLLDALKGK |
| Ga0335007_0781250_222_362 | 3300034283 | Freshwater | MLYLISITLALLGGFVTGLLVARKHAERLKATEAEGRKLLDALKGK |
| Ga0335007_0816032_264_404 | 3300034283 | Freshwater | MLYVISITLALRGGFVCGLLVARKHADRLKASEAEGRKLLDALKGK |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |