NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F104747

Metagenome / Metatranscriptome Family F104747

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F104747
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 50 residues
Representative Sequence MTLTEAKQTLMLELVRATAGNYSVEELLELYYFMTEPEEDTKPNLTVLNNRT
Number of Associated Samples 78
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 81.00 %
% of genes near scaffold ends (potentially truncated) 32.00 %
% of genes from short scaffolds (< 2000 bps) 80.00 %
Associated GOLD sequencing projects 70
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Predicted Viral (43.000 % of family members)
NCBI Taxonomy ID 10239 (predicted)
Taxonomy All Organisms → Viruses → Predicted Viral

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(23.000 % of family members)
Environment Ontology (ENVO) Unclassified
(74.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(89.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.00%    β-sheet: 0.00%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF07087DUF1353 31.00
PF11351GTA_holin_3TM 30.00
PF02867Ribonuc_red_lgC 2.00
PF16778Phage_tail_APC 1.00
PF01391Collagen 1.00
PF12236Head-tail_con 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG0209Ribonucleotide reductase alpha subunitNucleotide transport and metabolism [F] 2.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms66.00 %
UnclassifiedrootN/A34.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10055934All Organisms → Viruses → Predicted Viral1933Open in IMG/M
3300000101|DelMOSum2010_c10098184All Organisms → Viruses → Predicted Viral1226Open in IMG/M
3300000101|DelMOSum2010_c10135765All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.933Open in IMG/M
3300000928|OpTDRAFT_10078377All Organisms → Viruses → Predicted Viral1770Open in IMG/M
3300000928|OpTDRAFT_10107726All Organisms → Viruses → Predicted Viral1269Open in IMG/M
3300000930|BpDRAFT_10360870Not Available736Open in IMG/M
3300000947|BBAY92_10153150All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.605Open in IMG/M
3300001348|JGI20154J14316_10072829All Organisms → Viruses → Predicted Viral1256Open in IMG/M
3300001352|JGI20157J14317_10007785Not Available7436Open in IMG/M
3300001352|JGI20157J14317_10078520All Organisms → Viruses → Predicted Viral1302Open in IMG/M
3300001948|GOS2228_1040423All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.1387Open in IMG/M
3300002524|JGI24927J35514_1002285All Organisms → Viruses → Predicted Viral1989Open in IMG/M
3300004448|Ga0065861_1216792All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300005613|Ga0074649_1089277All Organisms → Viruses → Predicted Viral1150Open in IMG/M
3300005747|Ga0076924_1115791Not Available11106Open in IMG/M
3300006029|Ga0075466_1044650All Organisms → Viruses → Predicted Viral1328Open in IMG/M
3300006803|Ga0075467_10216394All Organisms → Viruses → Predicted Viral1056Open in IMG/M
3300006810|Ga0070754_10056294All Organisms → Viruses → Predicted Viral2057Open in IMG/M
3300007229|Ga0075468_10042746All Organisms → Viruses → Predicted Viral1568Open in IMG/M
3300007276|Ga0070747_1226987All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.653Open in IMG/M
3300007276|Ga0070747_1304751Not Available547Open in IMG/M
3300007344|Ga0070745_1090883All Organisms → Viruses → Predicted Viral1203Open in IMG/M
3300007345|Ga0070752_1269368All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.657Open in IMG/M
3300007346|Ga0070753_1126459All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.981Open in IMG/M
3300007540|Ga0099847_1019208All Organisms → Viruses → Predicted Viral2232Open in IMG/M
3300007540|Ga0099847_1030197All Organisms → Viruses → Predicted Viral1743Open in IMG/M
3300007540|Ga0099847_1105541Not Available856Open in IMG/M
3300007609|Ga0102945_1089092Not Available563Open in IMG/M
3300009001|Ga0102963_1156379All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.917Open in IMG/M
3300009074|Ga0115549_1045059All Organisms → Viruses → Predicted Viral1596Open in IMG/M
3300009076|Ga0115550_1054568All Organisms → Viruses → Predicted Viral1620Open in IMG/M
3300009434|Ga0115562_1258689All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium605Open in IMG/M
3300009606|Ga0115102_10759582All Organisms → Viruses → Predicted Viral2039Open in IMG/M
3300010316|Ga0136655_1076711All Organisms → Viruses → Predicted Viral1021Open in IMG/M
3300010368|Ga0129324_10079212All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.1446Open in IMG/M
3300010368|Ga0129324_10087423All Organisms → Viruses → Predicted Viral1360Open in IMG/M
3300010392|Ga0118731_100409644All Organisms → Viruses → Predicted Viral1642Open in IMG/M
3300010430|Ga0118733_101226198All Organisms → Viruses → Predicted Viral1498Open in IMG/M
3300011258|Ga0151677_1006880Not Available11406Open in IMG/M
3300013010|Ga0129327_10023288All Organisms → Viruses → Predicted Viral3246Open in IMG/M
3300013010|Ga0129327_10456771All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.686Open in IMG/M
3300016726|Ga0182045_1257200All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.1076Open in IMG/M
3300017697|Ga0180120_10135806All Organisms → Viruses → Predicted Viral1050Open in IMG/M
3300017697|Ga0180120_10220176Not Available780Open in IMG/M
3300017697|Ga0180120_10407985Not Available533Open in IMG/M
3300017713|Ga0181391_1052945Not Available954Open in IMG/M
3300017725|Ga0181398_1011135Not Available2293Open in IMG/M
3300017744|Ga0181397_1002521Not Available6358Open in IMG/M
3300017746|Ga0181389_1005524All Organisms → Viruses → Predicted Viral4442Open in IMG/M
3300017752|Ga0181400_1134583Not Available708Open in IMG/M
3300017757|Ga0181420_1200716Not Available579Open in IMG/M
3300017786|Ga0181424_10112698Not Available1173Open in IMG/M
3300017786|Ga0181424_10187344Not Available880Open in IMG/M
3300017824|Ga0181552_10460415Not Available603Open in IMG/M
3300017824|Ga0181552_10485022All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.583Open in IMG/M
3300017950|Ga0181607_10098950All Organisms → Viruses → Predicted Viral1846Open in IMG/M
3300017950|Ga0181607_10206970All Organisms → Viruses → Predicted Viral1150Open in IMG/M
3300017963|Ga0180437_10796511All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.682Open in IMG/M
3300018036|Ga0181600_10404347Not Available662Open in IMG/M
3300018041|Ga0181601_10219499All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.1102Open in IMG/M
3300018080|Ga0180433_10851764All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.670Open in IMG/M
3300018410|Ga0181561_10082332All Organisms → Viruses → Predicted Viral1825Open in IMG/M
3300018410|Ga0181561_10124605All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.1361Open in IMG/M
3300020166|Ga0206128_1000781Not Available34364Open in IMG/M
3300020166|Ga0206128_1056157All Organisms → Viruses → Predicted Viral1882Open in IMG/M
3300020166|Ga0206128_1079229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1483Open in IMG/M
3300020177|Ga0181596_10317711All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium620Open in IMG/M
3300020185|Ga0206131_10041865All Organisms → Viruses → Predicted Viral3220Open in IMG/M
3300020185|Ga0206131_10361006Not Available622Open in IMG/M
3300020187|Ga0206130_10147348All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1239Open in IMG/M
3300020187|Ga0206130_10237193Not Available839Open in IMG/M
3300020385|Ga0211677_10023404All Organisms → Viruses → Predicted Viral3062Open in IMG/M
3300020438|Ga0211576_10189457Not Available1099Open in IMG/M
3300021085|Ga0206677_10001679Not Available20235Open in IMG/M
3300021185|Ga0206682_10414250Not Available567Open in IMG/M
3300021389|Ga0213868_10045210All Organisms → Viruses → Predicted Viral3107Open in IMG/M
3300021959|Ga0222716_10053663All Organisms → Viruses → Predicted Viral2849Open in IMG/M
3300022053|Ga0212030_1037849Not Available678Open in IMG/M
3300022053|Ga0212030_1053580Not Available573Open in IMG/M
3300022061|Ga0212023_1015457All Organisms → Viruses → Predicted Viral1012Open in IMG/M
3300022169|Ga0196903_1022815All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.753Open in IMG/M
3300022413|Ga0224508_10168743All Organisms → Viruses → Predicted Viral1439Open in IMG/M
3300022925|Ga0255773_10370680All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.554Open in IMG/M
3300025508|Ga0208148_1006322All Organisms → Viruses → Predicted Viral3829Open in IMG/M
3300025543|Ga0208303_1026236All Organisms → Viruses → Predicted Viral1595Open in IMG/M
3300025543|Ga0208303_1026253All Organisms → Viruses → Predicted Viral1594Open in IMG/M
3300025543|Ga0208303_1049980All Organisms → Viruses → Predicted Viral1019Open in IMG/M
3300025570|Ga0208660_1120996Not Available556Open in IMG/M
3300025617|Ga0209138_1040630All Organisms → Viruses → Predicted Viral1770Open in IMG/M
3300025620|Ga0209405_1026330All Organisms → Viruses → Predicted Viral2323Open in IMG/M
3300025621|Ga0209504_1090751Not Available819Open in IMG/M
3300025671|Ga0208898_1124410Not Available738Open in IMG/M
3300025684|Ga0209652_1160110Not Available583Open in IMG/M
3300025806|Ga0208545_1090323Not Available818Open in IMG/M
3300025832|Ga0209307_1001890Not Available12812Open in IMG/M
3300025860|Ga0209119_1101730All Organisms → Viruses → Predicted Viral1273Open in IMG/M
3300028129|Ga0228634_1063150All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → unclassified Blastopirellula → Blastopirellula sp.901Open in IMG/M
3300031565|Ga0307379_10284830All Organisms → Viruses → Predicted Viral1639Open in IMG/M
3300031658|Ga0307984_1001093Not Available11470Open in IMG/M
3300031851|Ga0315320_10452617Not Available877Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous23.00%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh11.00%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient8.00%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater8.00%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater7.00%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine6.00%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine4.00%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine4.00%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater3.00%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine3.00%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine3.00%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine3.00%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.00%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine2.00%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water2.00%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment2.00%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine1.00%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment1.00%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.00%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.00%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.00%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment1.00%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment1.00%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil1.00%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000928Marine plume microbial communities from the Columbia River - 25 PSUEnvironmentalOpen in IMG/M
3300000930Marine microbial communities from the coastal margin of the Columbia River, USA - 33 PSU, 16mEnvironmentalOpen in IMG/M
3300000947Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92Host-AssociatedOpen in IMG/M
3300001348Pelagic Microbial community sample from North Sea - COGITO 998_met_04EnvironmentalOpen in IMG/M
3300001352Pelagic Microbial community sample from North Sea - COGITO 998_met_07EnvironmentalOpen in IMG/M
3300001948Marine microbial communities from Chesapeake Bay, Maryland, USA - GS012EnvironmentalOpen in IMG/M
3300002524Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C49A8_35EnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300005613Saline sediment microbial communities from Etoliko Lagoon, Greece - sedimentEnvironmentalOpen in IMG/M
3300005747Seawater microbial communities from Vineyard Sound, MA, USA - control T14EnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007609Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MGEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009074Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430EnvironmentalOpen in IMG/M
3300009076Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010316Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300011258Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeateEnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300016726Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011504BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017963Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaGEnvironmentalOpen in IMG/M
3300018036Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018041Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018080Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaGEnvironmentalOpen in IMG/M
3300018410Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020166Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1EnvironmentalOpen in IMG/M
3300020177Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041402US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020185Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1EnvironmentalOpen in IMG/M
3300020187Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1EnvironmentalOpen in IMG/M
3300020385Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300022053Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022061Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2)EnvironmentalOpen in IMG/M
3300022169Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022413Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_21EnvironmentalOpen in IMG/M
3300022925Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaGEnvironmentalOpen in IMG/M
3300025508Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025570Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025617Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025620Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes)EnvironmentalOpen in IMG/M
3300025621Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025684Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025806Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025832Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 (SPAdes)EnvironmentalOpen in IMG/M
3300025860Pelagic Microbial community sample from North Sea - COGITO 998_met_03 (SPAdes)EnvironmentalOpen in IMG/M
3300028129Seawater microbial communities from Monterey Bay, California, United States - 42DEnvironmentalOpen in IMG/M
3300031565Soil microbial communities from Risofladan, Vaasa, Finland - UN-2EnvironmentalOpen in IMG/M
3300031658Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1005593433300000101MarineMTLDEAKQTLMLELVRATQGNYSIEELLELYYFIIEPEDDGKPNLTVLNNRT*
DelMOSum2010_1009818433300000101MarineMTVTEAKQTLMLELVRATAGNYNVEELLELYYFMIEPEEDIKPTLTVLKRGE*
DelMOSum2010_1013576523300000101MarineMTVTEAKQTLMLELVRATAGNYSIEELLELYYFMIEPEEDIKPTLTVLKRGE*
OpTDRAFT_1007837713300000928Freshwater And MarineLMTLDEAKQTLMLELVRATQGNYSVEELLELYYFMIEPEEDVKPNLTVLNNRT*
OpTDRAFT_1010772613300000928Freshwater And MarineMTLGEAKQTLMLELVRATQGNYNVEELLELYYFIIEPEEDVKPNLTVLNN
BpDRAFT_1036087023300000930Freshwater And MarineMTLDEAKQTLMLELVRATQGNYSVEELLELYYFMIEPEEDVKPNLTVLNNRT*
BBAY92_1015315013300000947Macroalgal SurfaceVTLTEAKQTLMLELVRATAGNYSIEELLELYYFMIEPEEDTKPTLTVLKTGE*
JGI20154J14316_1007282943300001348Pelagic MarineATQGNYSVEELLELYYFIIEPEEDVKPNLTVLNNRT*
JGI20157J14317_1000778543300001352Pelagic MarineMTLTEAKQVLMLELVRATAGNYSVEELLELYYFMTEPEEEIKPTLTVLSKKEVDKSC*
JGI20157J14317_1007852033300001352Pelagic MarineMTLDEAKQTLMLELVRATAGNYSIEELLELYYFIIEPEEDVKPNLTVLNNRT*
GOS2228_104042343300001948MarineMLELVRATAGNYSVEELLELYYFMTEPEEETKPTLTVLKTGE*
JGI24927J35514_100228533300002524MarineMTLDEAKQTLMLELVRATQGNYSVEELLELYYFIIEPEEDVKPNLTVLNNRT*
Ga0065861_121679223300004448MarineMTLTEAKQTLMLELVRATAGNYSIEELLELYYFMTEPEEETKPTLTVLKTGD*
Ga0074649_108927733300005613Saline Water And SedimentMTLTEAKQVLMLELVRATAGNYSVEELLELYYFMTEPEEDEKPKLTVLKTGE*
Ga0076924_111579143300005747MarineMTLGEAKQTLMLELVRATQGNYNVEELLELYYFIIEPEEDVKPNLTVLNNRT*
Ga0075466_104465043300006029AqueousMTLDEAKQTLMLELVRATQGNYSIEELLELYYFIIEPEEDVKPNLTVLKNRT*
Ga0075467_1021639423300006803AqueousMTLTEAKQVLMLELVRATAGNYSVEELLELYYFMVEPEEDTKPNLTVLNNRT*
Ga0070754_1005629433300006810AqueousMTLDEAKQTLILELVRATAGNYNIEELLELYYFIIEPEEDVKPNLTVLNNRT*
Ga0075468_1004274613300007229AqueousMTLTEAKQVLMLELVRATAGNYSVEELLELYYFMVEPEEDTKPNLTVLN
Ga0070747_122698713300007276AqueousELVRATAGNYSIEELLELYYFMTEPEEETKPTLTVLKTGD*
Ga0070747_130475113300007276AqueousEAKQTLMLELVRATQGNYSIEELLELYYFIIEPEDDGKPNLTVLNNRT*
Ga0070745_109088323300007344AqueousMTLTEAKQTLMLELVRATAGNYSVEELLELYYFMTEPEEDIKPTLTVLKTGE*
Ga0070752_126936833300007345AqueousQTLMLELVRATAGNYSVEELLELYYFMIEPEEETKPTLTVLKTGE*
Ga0070753_112645913300007346AqueousMTLTEAKQVLMLELVRATAGNYSVEELLELYYFMIEPEEETKPTLTVLKTGE*
Ga0099847_101920843300007540AqueousMTLTEAKQVLMLELVRATAGNYSVEELLELYYFMTEPEEETKPTLTVLKTGD*
Ga0099847_103019723300007540AqueousMTVADAKQVLVLEIVRATAGNYTVEEVLELYYFMIEPEEDIKPTLTVLSTK*
Ga0099847_110554123300007540AqueousMTLIEAKQTLMLELVRATAGNYSVEELLELYYFMVEPEEDTKPNLTVLNNRT*
Ga0102945_108909223300007609Pond WaterMTTAEAKQTLMLELIRATGGIYGVEELIELFYFIIEPEEEAGATLKLIRKEQ*
Ga0102963_115637943300009001Pond WaterMTLTEAKQTLMLELVRATAGNYSIEELLELYYFMTEPEEDIKPTLTVFKTGE*
Ga0115549_104505943300009074Pelagic MarineMTLTEAKQTLMLELVRATAGNYSIEELLELYYFMIEPEEETKPTLTVLKTGE*
Ga0115550_105456833300009076Pelagic MarineMTLTEAKQTLMLELVRATAGNYSVEELLELYYFMTEPEEDTKPNLTVLNNRT*
Ga0115562_125868923300009434Pelagic MarineMTLTEAKQTLMLELVRATAGNYSIEELLELYYFMTEPEEDTKPNLTVLNNRT*
Ga0115102_1075958233300009606MarineMTLDEAKQTLMLELVRATQGNYSVEELLELYYFMIEPEEDNKPTLTVLNRTQT*
Ga0136655_107671133300010316Freshwater To Marine Saline GradientMTLTEAKQVLMLELVRATAGNYSVEELLELYYFMTEPEEETKPTLTVLKTGE*
Ga0129324_1007921213300010368Freshwater To Marine Saline GradientKQVLMLELVRATAGNYSVEELLELYYFMTEPEEETKPTLTVLKTGE*
Ga0129324_1008742333300010368Freshwater To Marine Saline GradientMTVTEAKQTLMLELVRATAGNYNVEELLELYYFMIEPEEDIKPTLTVLKR
Ga0118731_10040964433300010392MarineMTLGETKQTLMLELVRATQGNYNVEELLELYYFIIEPEDDGKPNLTVLNNRT*
Ga0118733_10122619843300010430Marine SedimentMTLGETKQTLMLELVRATQGNYSVEELLELYYFIIEPEEDVKPNLTVLNNRT*
Ga0151677_100688033300011258MarineMTVTEAKQTLMLELVRATAGNYSIEELLELYYFMIEPEEDIKPTLTVLKTGE*
Ga0129327_1002328833300013010Freshwater To Marine Saline GradientMTVAEAKQVLVLEIVRATAGNYTVEEVLELYYFMIEPEEDIKPTLTVLSTK*
Ga0129327_1045677113300013010Freshwater To Marine Saline GradientMTLVEAKQTLMLELVRATAGNYSVEELLELYYFMTEPEEETKPTLTVLKTGD*
Ga0182045_125720023300016726Salt MarshMTLTESKQVLMLELVRATAGNYSVEELLELYYFMIEPEEETKPTLTVLKIGE
Ga0180120_1013580613300017697Freshwater To Marine Saline GradientMTVAEAKQVLVLEIVRATAGNYTVEEVLELYYFMIEPEEDIKPTLTVLSTK
Ga0180120_1022017633300017697Freshwater To Marine Saline GradientMTLTEAKQTLMLELVRATAGNYSVEELLELYYFMIEPEEETKPTLTVLKTGD
Ga0180120_1040798513300017697Freshwater To Marine Saline GradientEAKQTLMLELVRATQGNYSIEELLELYYFIIEPEDDGKPNLTVLNNRT
Ga0181391_105294533300017713SeawaterMTLDEAKQTLMLELVRATQGNYSVEELLELYYFMIEPEEDSKPTLTVLNNRT
Ga0181398_101113523300017725SeawaterMTLGEAKQTLMLELVRATAGNYNIEELLELYYFIIEPEEDVKPNLTVLNNRT
Ga0181397_100252173300017744SeawaterMTLDEAKQTLMLELVRATAGNYNIEELLELYYFIIEPEEDVKPNLTVLNNRT
Ga0181389_100552443300017746SeawaterMTLDEAKQTLMLELVRATQGNYSVEELLELYYFMIEPEEDVKPNLTVLKNRT
Ga0181400_113458323300017752SeawaterMSLGEAKQTLMLELVRATQGNYNVEELLELYYFMIEPEEDVKPNLTVLNNRT
Ga0181420_120071613300017757SeawaterLGEAKQTLMLELVRATQGNYSVEELLELYYFIIEPEEDVKPNLTVLNNRT
Ga0181424_1011269843300017786SeawaterWYILMTLGEAKQTLMLELVRATQGNYSVEELLELYYFIIEPEEDVKPNLTVLNNRT
Ga0181424_1018734433300017786SeawaterMTLDEAKQTLMLELVRATAGNYSIEELLELYYFIIEHEEDVKPNLIVLINK
Ga0181552_1046041533300017824Salt MarshMTLTESKQVLMLELVRATAGNYSVEELLELYYFMIEPEEET
Ga0181552_1048502233300017824Salt MarshTLTESKQVLMLELVRATAGNYSVEELLELYYFMIEPEEETKPTLTVLKTGE
Ga0181607_1009895033300017950Salt MarshMTLIEAKQVLMLELVRATAGNYSVEELLELYYFMIEPEEETKPTLTVLKTGE
Ga0181607_1020697043300017950Salt MarshMTLTEAKQVLMLELVRATAGNYSVEELLELYYFMVEPEEDTKPNLTVLNNRT
Ga0180437_1079651133300017963Hypersaline Lake SedimentAKQTLMLELVRATAGNYSIEELLELYYFMTEPEEDIKPTLTVLKTGE
Ga0181600_1040434733300018036Salt MarshMTLTEAKQVLMLELVRATAGNYSVEELLELYYFMIEPEEETKPTLTVLKTGE
Ga0181601_1021949943300018041Salt MarshAKQVLMLELVRATAGNYSVEELLELYYFMIEPEEETKPTLTVLKTGE
Ga0180433_1085176423300018080Hypersaline Lake SedimentMTLTEAKQVLMLELVRATAGNYSVEELLELYYFMTEPEEETKPTLTVLKTGE
Ga0181561_1008233233300018410Salt MarshMTLTESKQVLMLELVRATAGNYSVEELLELYYFMIEPEEE
Ga0181561_1012460533300018410Salt MarshMTLTESKQVLMLELVRATAGNYSVEELLELYYFMIEPEEETKPTLTVLKTGE
Ga0206128_1000781503300020166SeawaterMTLTEAKQTLMLELVRATAGNYNVEELLELYYFMIEPEEDIKPTLTVLKRGE
Ga0206128_105615733300020166SeawaterMTLTEAKQTLMLELVRATAGNYSIEELLELYYFMTEPEEDTKPNLTVLNNRT
Ga0206128_107922923300020166SeawaterMTLTEAKQVLMLELVRATAGNYSIEELLELYYFMTEPEEEIKPTLTVLSKKEVDKSC
Ga0181596_1031771113300020177Salt MarshMTLTEAKQVLMLELVRATAGNYSVEELLELYYFMIEPEEETKPTLTV
Ga0206131_1004186553300020185SeawaterMTLGEAKQTLMLELVRATQGNYNVEELLELYYFIIEPEEDVKPNLTVLNNRT
Ga0206131_1036100623300020185SeawaterMTLDEAKQTLMLELVRATAGNYSIEELLELYYFIIEPEEDVKPNLTVLNNRT
Ga0206130_1014734843300020187SeawaterTEAKQVLMLELVRATAGNYSIEELLELYYFMTEPEEEIKPTLTVLSKKEVDKSC
Ga0206130_1023719313300020187SeawaterMLELVRATAGNYSIEELLELYYFMTEPEEDTKPNLTVLNNRT
Ga0211677_1002340413300020385MarineMTTAEAKQTLMLELVRATQGNYSIEELLELYYFMIEPEEDSKPTLTVLNNRT
Ga0211576_1018945743300020438MarineMTLDEAKQTLMLELVRATQGNYSVEELLELYYFIIEPEEDVKPNLTVLNNRT
Ga0206677_10001679273300021085SeawaterMTLDEAKQTLMLELVRATQGNYSVEELLELYYFMIEPEEDVKPNLTVLNNRT
Ga0206682_1041425023300021185SeawaterMTLTEAKQTLMLELVRATAGNYSVEELLELYYFMTEPEEDIKPTLTVLKTGE
Ga0213868_1004521013300021389SeawaterMTLTEAKQVLMLELVRATAGNYSVEELLELYYFMTEPEEETKPT
Ga0222716_1005366343300021959Estuarine WaterMTLDEAKQTLMLELVRATQGNYSVEELLELYYFMIEPEEDNKPTLTVLNRTQT
Ga0212030_103784923300022053AqueousMTLDEAKQTLMLELVRATQGNYSIEELLELYYFIIEPEDDGKPNLTVLNNRT
Ga0212030_105358033300022053AqueousMTVTEAKQTLMLELVRATAGNYNVEELLELYYFMIEPEEDIKPTLTVLK
Ga0212023_101545733300022061AqueousMTLDEAKQTLMLELVRATQGNYSIEELLELYYFIIEPEEDVKPNLTVLKNRT
Ga0196903_102281523300022169AqueousMTLTEAKQTLMLELVRATAGNYSVEELLELYYFMIEPEEETKPTLTVLKTGE
Ga0224508_1016874333300022413SedimentMTLDEAKQTLMLELVRATQGNYSVEELLELYYFMIEPEE
Ga0255773_1037068013300022925Salt MarshELVRATAGNYSVEELLELYYFMIEPEEETKPTLTVLKIGE
Ga0208148_100632273300025508AqueousMTVTEAKQTLMLELVRATAGNYNVEELLELYYFMIEPEEDIKPTLTVLKRGE
Ga0208303_102623633300025543AqueousMTVAEAKQVLVLEIVRATAGNYTVEEVLELYYFMIEPEEDIKPTLTV
Ga0208303_102625323300025543AqueousMTVADAKQVLVLEIVRATAGNYTVEEVLELYYFMIEPEEDIKPTLTVLSTK
Ga0208303_104998033300025543AqueousMTLIEAKQTLMLELVRATAGNYSVEELLELYYFMVEPEEDTKPNLTVLNNRT
Ga0208660_112099613300025570AqueousEAKQTLMLELVRATAGNYNIEELLELYYFIIEPEEDVKPNLTVLNNRT
Ga0209138_104063033300025617MarineMTLTEAKQTLMLELVRATAGNYSIEELLELYYFMIEPEEDIKPTLTVLKTGE
Ga0209405_102633033300025620Pelagic MarineMTLGEAKQTLMLELVRATQGNYSVEELLELYYFIIEPEEDVKPNLTVLNNRT
Ga0209504_109075133300025621Pelagic MarineMTLTEAKQTLMLELVRATAGNYSVEELLELYYFMTEPEEDTKPNLTVLNNRT
Ga0208898_112441013300025671AqueousMTLTEAKQTLMLELVRATAGNYSVEELLELYYFMTEPEEDIKPTLTVL
Ga0209652_116011013300025684MarineLELVRATAGNYSVEELLELYYFMVEPEEDTKPNLTVLNNRT
Ga0208545_109032333300025806AqueousMTLTEAKQVLMLELVRATAGNYSVEELLELYYFMVEPEEDTKPNLTVLNN
Ga0209307_100189043300025832Pelagic MarineMTLTEAKQVLMLELVRATAGNYSVEELLELYYFMTEPEEEIKPTLTVLSKKEVDKSC
Ga0209119_110173033300025860Pelagic MarineMTLTEAKQTLMLELVRATAGNYSIEELLELYYFMIEPEEETKPTLTVLKTGE
Ga0228634_106315043300028129SeawaterLELVRATAGNYSIEELLELYYFMIEPEEDIKPTLTVLKRGE
Ga0307379_1028483033300031565SoilMTLTEAKQVLMLELVRATAGNYSVEELLELYYFMTEPEEETKPTLTVLKTGD
Ga0307984_100109363300031658MarineMTLNEAKQTLMLELVRATAGNYSIEELLELYYFIIEPEEDVKPTLTVLTRED
Ga0315320_1045261733300031851SeawaterMTLDEAKQTLMLELVRATQGNYSVEELLELYYFMIEPEEDV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.