| Basic Information | |
|---|---|
| Family ID | F104745 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MTRASEVPVKKPYQPPKLIVYGDLTQLTMTVAMMGGQFDNMKLTKRT |
| Number of Associated Samples | 71 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 90.00 % |
| % of genes near scaffold ends (potentially truncated) | 13.00 % |
| % of genes from short scaffolds (< 2000 bps) | 38.00 % |
| Associated GOLD sequencing projects | 61 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (47.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.33% β-sheet: 0.00% Coil/Unstructured: 86.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF00733 | Asn_synthase | 25.00 |
| PF13537 | GATase_7 | 17.00 |
| PF05185 | PRMT5 | 8.00 |
| PF06325 | PrmA | 6.00 |
| PF14907 | NTP_transf_5 | 3.00 |
| PF13847 | Methyltransf_31 | 2.00 |
| PF08673 | RsbU_N | 1.00 |
| PF13442 | Cytochrome_CBB3 | 1.00 |
| PF12704 | MacB_PCD | 1.00 |
| PF01061 | ABC2_membrane | 1.00 |
| PF00005 | ABC_tran | 1.00 |
| PF02954 | HTH_8 | 1.00 |
| PF10531 | SLBB | 1.00 |
| PF13620 | CarboxypepD_reg | 1.00 |
| PF16363 | GDP_Man_Dehyd | 1.00 |
| PF12787 | EcsC | 1.00 |
| PF13646 | HEAT_2 | 1.00 |
| PF13349 | DUF4097 | 1.00 |
| PF13345 | Obsolete Pfam Family | 1.00 |
| PF13432 | TPR_16 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG4076 | Predicted RNA methylase | General function prediction only [R] | 8.00 |
| COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 6.00 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 6.00 |
| COG3897 | Protein N-terminal and lysine N-methylase, NNT1/EFM7 family | Posttranslational modification, protein turnover, chaperones [O] | 6.00 |
| COG2208 | Phosphoserine phosphatase RsbU, regulator of sigma subunit | Transcription [K] | 2.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10737262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300002910|JGI25615J43890_1082892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300002914|JGI25617J43924_10001148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 6637 | Open in IMG/M |
| 3300002914|JGI25617J43924_10007076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3506 | Open in IMG/M |
| 3300002914|JGI25617J43924_10022859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2177 | Open in IMG/M |
| 3300002914|JGI25617J43924_10042335 | All Organisms → cellular organisms → Bacteria | 1645 | Open in IMG/M |
| 3300002914|JGI25617J43924_10207544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300004114|Ga0062593_100342082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1302 | Open in IMG/M |
| 3300004479|Ga0062595_101134069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300005174|Ga0066680_10635421 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300005176|Ga0066679_10014257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 4047 | Open in IMG/M |
| 3300005181|Ga0066678_10450834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 855 | Open in IMG/M |
| 3300005536|Ga0070697_101399573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300005537|Ga0070730_10000685 | All Organisms → cellular organisms → Bacteria | 36660 | Open in IMG/M |
| 3300005549|Ga0070704_100072130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2511 | Open in IMG/M |
| 3300005553|Ga0066695_10329412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 960 | Open in IMG/M |
| 3300005554|Ga0066661_10050420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2381 | Open in IMG/M |
| 3300005559|Ga0066700_10236075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1274 | Open in IMG/M |
| 3300005586|Ga0066691_10031435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2745 | Open in IMG/M |
| 3300006804|Ga0079221_10012473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3285 | Open in IMG/M |
| 3300006804|Ga0079221_11621470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300006903|Ga0075426_10889877 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300007255|Ga0099791_10006705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 4749 | Open in IMG/M |
| 3300007255|Ga0099791_10028346 | All Organisms → cellular organisms → Bacteria | 2443 | Open in IMG/M |
| 3300007258|Ga0099793_10000733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 9439 | Open in IMG/M |
| 3300007265|Ga0099794_10003695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 5887 | Open in IMG/M |
| 3300009038|Ga0099829_10000612 | All Organisms → cellular organisms → Bacteria | 18767 | Open in IMG/M |
| 3300009038|Ga0099829_10026685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 4059 | Open in IMG/M |
| 3300009038|Ga0099829_10088927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2381 | Open in IMG/M |
| 3300009088|Ga0099830_10011628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 5406 | Open in IMG/M |
| 3300009088|Ga0099830_10064858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2627 | Open in IMG/M |
| 3300009088|Ga0099830_10238767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1435 | Open in IMG/M |
| 3300009089|Ga0099828_10070424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2959 | Open in IMG/M |
| 3300011120|Ga0150983_12836432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
| 3300011270|Ga0137391_10023116 | All Organisms → cellular organisms → Bacteria | 5147 | Open in IMG/M |
| 3300012096|Ga0137389_10030563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3903 | Open in IMG/M |
| 3300012189|Ga0137388_11020058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 763 | Open in IMG/M |
| 3300012202|Ga0137363_10000249 | All Organisms → cellular organisms → Bacteria | 29906 | Open in IMG/M |
| 3300012202|Ga0137363_10013006 | All Organisms → cellular organisms → Bacteria | 5384 | Open in IMG/M |
| 3300012202|Ga0137363_10072200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2543 | Open in IMG/M |
| 3300012203|Ga0137399_10053361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2950 | Open in IMG/M |
| 3300012205|Ga0137362_10104967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2384 | Open in IMG/M |
| 3300012205|Ga0137362_10146782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2014 | Open in IMG/M |
| 3300012361|Ga0137360_10479226 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1057 | Open in IMG/M |
| 3300012361|Ga0137360_11801887 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300012363|Ga0137390_10033867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 4887 | Open in IMG/M |
| 3300012683|Ga0137398_10383044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 956 | Open in IMG/M |
| 3300012683|Ga0137398_10767311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300012685|Ga0137397_10066359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2608 | Open in IMG/M |
| 3300012685|Ga0137397_10076932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2421 | Open in IMG/M |
| 3300012922|Ga0137394_10071295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2895 | Open in IMG/M |
| 3300012923|Ga0137359_10101634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2539 | Open in IMG/M |
| 3300012925|Ga0137419_11463988 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300012929|Ga0137404_10222466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1609 | Open in IMG/M |
| 3300012929|Ga0137404_11228424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300012930|Ga0137407_10055997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3225 | Open in IMG/M |
| 3300012930|Ga0137407_11979270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300012960|Ga0164301_10720790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300015053|Ga0137405_1037903 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1072 | Open in IMG/M |
| 3300015242|Ga0137412_10008474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 8239 | Open in IMG/M |
| 3300019789|Ga0137408_1104288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 5436 | Open in IMG/M |
| 3300019789|Ga0137408_1384661 | All Organisms → cellular organisms → Bacteria | 2614 | Open in IMG/M |
| 3300019789|Ga0137408_1465087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2032 | Open in IMG/M |
| 3300020170|Ga0179594_10003090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3958 | Open in IMG/M |
| 3300020170|Ga0179594_10345419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300020199|Ga0179592_10003259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 6844 | Open in IMG/M |
| 3300020579|Ga0210407_10000415 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 49171 | Open in IMG/M |
| 3300020579|Ga0210407_11085025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300020580|Ga0210403_10016490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 5913 | Open in IMG/M |
| 3300021171|Ga0210405_10002133 | All Organisms → cellular organisms → Bacteria | 20921 | Open in IMG/M |
| 3300021171|Ga0210405_10014514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 6531 | Open in IMG/M |
| 3300021406|Ga0210386_11042685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300021474|Ga0210390_10009475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 7986 | Open in IMG/M |
| 3300024178|Ga0247694_1000089 | All Organisms → cellular organisms → Bacteria | 34272 | Open in IMG/M |
| 3300024178|Ga0247694_1003950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2144 | Open in IMG/M |
| 3300024186|Ga0247688_1024296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 904 | Open in IMG/M |
| 3300024323|Ga0247666_1001044 | All Organisms → cellular organisms → Bacteria | 6400 | Open in IMG/M |
| 3300026304|Ga0209240_1026192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2231 | Open in IMG/M |
| 3300026318|Ga0209471_1023819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3060 | Open in IMG/M |
| 3300026538|Ga0209056_10055501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3510 | Open in IMG/M |
| 3300026551|Ga0209648_10000009 | All Organisms → cellular organisms → Bacteria | 102308 | Open in IMG/M |
| 3300026551|Ga0209648_10001597 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 18392 | Open in IMG/M |
| 3300026551|Ga0209648_10020850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 5731 | Open in IMG/M |
| 3300027655|Ga0209388_1129066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300027671|Ga0209588_1001676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 5829 | Open in IMG/M |
| 3300027674|Ga0209118_1051319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1219 | Open in IMG/M |
| 3300027846|Ga0209180_10105120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1612 | Open in IMG/M |
| 3300027857|Ga0209166_10000184 | All Organisms → cellular organisms → Bacteria | 80636 | Open in IMG/M |
| 3300027862|Ga0209701_10034137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3295 | Open in IMG/M |
| 3300027862|Ga0209701_10073648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2159 | Open in IMG/M |
| 3300028792|Ga0307504_10369617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300031720|Ga0307469_11111732 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
| 3300031753|Ga0307477_10058179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2661 | Open in IMG/M |
| 3300031754|Ga0307475_10072015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2644 | Open in IMG/M |
| 3300031820|Ga0307473_10372696 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 926 | Open in IMG/M |
| 3300031820|Ga0307473_10577027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
| 3300031823|Ga0307478_10000493 | All Organisms → cellular organisms → Bacteria | 40395 | Open in IMG/M |
| 3300032180|Ga0307471_100038261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3807 | Open in IMG/M |
| 3300032180|Ga0307471_100068536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3046 | Open in IMG/M |
| 3300032205|Ga0307472_102479176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 47.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 10.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 9.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300024178 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35 | Environmental | Open in IMG/M |
| 3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_107372621 | 3300001593 | Forest Soil | MKRASEVPVKKPYHAPKLIVYGDLTQLTMARAFMGGMFDNMMLTKRT* |
| JGI25615J43890_10828921 | 3300002910 | Grasslands Soil | MKRAPEAPVKKPYQAPKLTVYGDLTQLTLTMVHMGAMFDNRKLTMRT* |
| JGI25617J43924_100011484 | 3300002914 | Grasslands Soil | MTRASEVPGKKPYHPPKLIVYGDLTQLTMTAAMMGGQFDNVKHTKRT* |
| JGI25617J43924_100070763 | 3300002914 | Grasslands Soil | MKRASEAPVKKPYQAPKLTVYGDLTQLTMTMAGMMGQFDNVKHTMRT* |
| JGI25617J43924_100228593 | 3300002914 | Grasslands Soil | MTRASEMPGKKPYHPPKLIVYGDLTQLTMTLPSGMGQFDNTKHNMRT* |
| JGI25617J43924_100423353 | 3300002914 | Grasslands Soil | MTRASRVPVKKPYQPPKLIAYGDLTQLTLTAMAGMGQPDNVKQTMRT* |
| JGI25617J43924_102075442 | 3300002914 | Grasslands Soil | MTHASKIRIKKPYHAPKLIVYGDLTQLTLTTTSPKGQPDNAKHNMRT* |
| Ga0062593_1003420822 | 3300004114 | Soil | MKQVSELPVKKPYQAPKLTVYGDLTQLTMTSPKGRGMPDNTKMFQT* |
| Ga0062595_1011340692 | 3300004479 | Soil | MKRVSELPVKKPYQAPKLTVYGDLTQLTMTSSKGMGMADNLKMFQT* |
| Ga0066680_106354212 | 3300005174 | Soil | MTRASEVPVKKPYQAPKLIVYGDLTQLTRAIAKGKGQPDNVMAKRT* |
| Ga0066679_100142573 | 3300005176 | Soil | VARPPEAPGKKPYHPPKLVAYGELTQLTMTVAMMGGQFDNMMLTKRT* |
| Ga0066678_104508342 | 3300005181 | Soil | MKRAPEVLVKTPYHPPKLIVYGDLTQLTRAIAKGKGQPDNVMAKRT* |
| Ga0070697_1013995732 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MKQVSELPVKKPYQAPKLTVYGDLTQLTMTSSKGKGMPDGTMKFQT* |
| Ga0070730_1000068510 | 3300005537 | Surface Soil | MKRQAADFPAKRPYYPPKLTVYGDLTELTMTKMTKTGQFDNVKKTRRT* |
| Ga0070704_1000721303 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MKQVSELPVKKPYQAPKLTVYGDLTQLTMTSSKGKGMPDNTKMFQT* |
| Ga0066695_103294121 | 3300005553 | Soil | MTRASKVPEKKPYHPPKLIVYGDLTQLTRAAMKGTGSFDNVKHTKRT* |
| Ga0066661_100504202 | 3300005554 | Soil | MTRASEVTGKRPYHPPKLIVYGDLTQLTMGGGMKGMIDHLKPTTRT* |
| Ga0066700_102360752 | 3300005559 | Soil | MTRAVKAPPKKPYRAPKLIVYGDLTQLTLTSQKGMGQPDNVKQNMRT* |
| Ga0066691_100314353 | 3300005586 | Soil | MTRASEVPVKKPYQPPKLIVYGDLTQLTMTVAMMGGQFDNMMLTKRT* |
| Ga0079221_100124733 | 3300006804 | Agricultural Soil | MKRVSELPVKKPYQAPKLTVYGNLTQLTLTIPMGKGRPDGIMMFQT* |
| Ga0079221_116214702 | 3300006804 | Agricultural Soil | MSKVAEVPVKKPYHAPQLTVYGDLNQLTMATGRMKGTIDHVKPTQRT* |
| Ga0075426_108898772 | 3300006903 | Populus Rhizosphere | MTRASEVPGKKPYHPPKLIVYGDLTQLTMTTAMMGGQFDNVMLTKRT* |
| Ga0099791_100067052 | 3300007255 | Vadose Zone Soil | MTRASEVPVKKPYQAPKLIVYGDLTQLTMGLAKGKGQLDGLKTKRT* |
| Ga0099791_100283463 | 3300007255 | Vadose Zone Soil | MNRAPEVPLKAPYHPPKLIVYGDLTQLTMARAMMGGQIDNMMLTKRT* |
| Ga0099793_100007338 | 3300007258 | Vadose Zone Soil | MKRESEAPVKKPYQAPKLIVYGDLTQLTMTVAMMGGQFDNMMLTKRT* |
| Ga0099794_100036954 | 3300007265 | Vadose Zone Soil | MKRVSKVPAKKPYHAPKLIVYGDLTQLTMTKARGGMFDNMMASMRT* |
| Ga0099829_100006126 | 3300009038 | Vadose Zone Soil | MKRPSKVPVKKLYKAPKLIVYGDLTQLTMTTPSGMGQFDNTKHNMRT* |
| Ga0099829_100266854 | 3300009038 | Vadose Zone Soil | MTRASEVTGKKPYHPPKLIVYGDLTQLTMAASAGKGMLDGSMSKRT* |
| Ga0099829_100889272 | 3300009038 | Vadose Zone Soil | MARASEVPVKKPYRPPKLIVYGDLTQLTMTLPSGMGQFDNVKHNMRT* |
| Ga0099830_100116284 | 3300009088 | Vadose Zone Soil | MKRASKVPVKKPYHAPKLIVYGDLTQLTMGTASMGGRIDNVKPQRRT* |
| Ga0099830_100648581 | 3300009088 | Vadose Zone Soil | MKRASEVRVKKPYHAPKLTVYGDLTQLTMTLPSGMGQFDNVKHNMRT* |
| Ga0099830_102387672 | 3300009088 | Vadose Zone Soil | MKRAPEVPVKKPYRSPKLIVYGDLTQLTMTLPSGMGQFDNVKHNMRT* |
| Ga0099828_100704242 | 3300009089 | Vadose Zone Soil | MARASEVPVKKPYRPPKLIVYGDLTQLTMTTPSGMGQFDNVKHNMRT* |
| Ga0150983_128364321 | 3300011120 | Forest Soil | MKRASEVRAKKPYQAPKLIVYGDLTQLTMTVAMMGGQFDNMKLTKRT* |
| Ga0137391_100231161 | 3300011270 | Vadose Zone Soil | MKRAPEAPVKKPYQAPKLTVYGDLTQLTLTMVHMGAMF |
| Ga0137389_100305633 | 3300012096 | Vadose Zone Soil | MTRASEVLGKKPYQPPKLIVYGDLTQLTQSKLSGGAPDNGIKSSRRT* |
| Ga0137388_110200581 | 3300012189 | Vadose Zone Soil | RNPYQVPKLIVYGDLTQLTTTRAMMGGHFDNKRLTKRT* |
| Ga0137363_1000024917 | 3300012202 | Vadose Zone Soil | MKRASKVRVKKPYHAPKLIVYGDLTQLTMTMGTTGQTDNPGKMART* |
| Ga0137363_100130062 | 3300012202 | Vadose Zone Soil | MKRAAEVRLKKPYQAPKLIVYGGLTQLTMASGSMKGQIDHVKPTTRT* |
| Ga0137363_100722002 | 3300012202 | Vadose Zone Soil | MTRASEVPVKKPYQAPKLIVYGDLTQLTMGLAKGKGQLDNLKTKRT* |
| Ga0137399_100533612 | 3300012203 | Vadose Zone Soil | MTRASEVTGKKPYHLPKLIVYGDLTQLTMGGGMKGMIDHVKPTTRT* |
| Ga0137362_101049673 | 3300012205 | Vadose Zone Soil | MTRVSEVPVKKPYQPPKLIVYGDLTQLTLTTMAGMGQPDNVKQTMRT* |
| Ga0137362_101467822 | 3300012205 | Vadose Zone Soil | MTRVSEVPVKKPYQPPKLIVYGDLTQLTMASGSMMGNVDHVKPTQRT* |
| Ga0137360_104792262 | 3300012361 | Vadose Zone Soil | MTRASEVPVKKPYQPPKLIVYGDLTQLTMTVAMMGGQFDNMKLTKRT* |
| Ga0137360_118018872 | 3300012361 | Vadose Zone Soil | TRVSEVPVKKPYQPPKLIVYGDLTQLTMASGSMMGNVDHVKPTQRT* |
| Ga0137390_100338673 | 3300012363 | Vadose Zone Soil | MTRASEVTGKKPYHPPKLIVYGDLTQLTMGGGMKGMIDGVKPTTRS* |
| Ga0137398_103830442 | 3300012683 | Vadose Zone Soil | LEFQVETMDKRTSEAPVRKPYQVPKLIVYGDLTQLTQTSQKGMGQPDNVKQNMRT* |
| Ga0137398_107673112 | 3300012683 | Vadose Zone Soil | MTRASEVTGKKPYHPPKLIVYGDLTQLTMTAAMMGGQFDNVKHTKRT* |
| Ga0137397_100663592 | 3300012685 | Vadose Zone Soil | MKRASEVPLKTPYHPPKLIVYGDLTQLTMTAQKGMGQPDNVKLNMRT* |
| Ga0137397_100769322 | 3300012685 | Vadose Zone Soil | MKRASEVPVKKPYQAPRLIVYGDLTQLTMTRAMMGGRFDNVMLTKRT* |
| Ga0137394_100712954 | 3300012922 | Vadose Zone Soil | MNRAPEVPLKAPYHPPKLIVYGDLTQLTMARAMMGGRIDNMMLTKRT* |
| Ga0137359_101016343 | 3300012923 | Vadose Zone Soil | MKRAPEVLVKTPYHPPKLIVYGDLTQLTLTAQKGMGQFDNIKLNMRT* |
| Ga0137419_114639882 | 3300012925 | Vadose Zone Soil | MKRESEAPVKKPYQTPKLIVYGDLTQLTMTVAMMGGQFDNMMLTKRT* |
| Ga0137404_102224662 | 3300012929 | Vadose Zone Soil | MNRAPEVPLKASYHPPKLIVYGDLTQLTMARAMMGGQIDNMMLTKRT* |
| Ga0137404_112284241 | 3300012929 | Vadose Zone Soil | EVPVKKPYQAPKLIVYGDLTRLTMTRANGKGNLDGTMNKRT* |
| Ga0137407_100559972 | 3300012930 | Vadose Zone Soil | MKRASEVHVKKPYQAPKLIVYGDLTQLTMAMAGGKGHPDGVMNKRT* |
| Ga0137407_119792702 | 3300012930 | Vadose Zone Soil | YHPPKLIVYGDLTQLTMNNMSGMGKPDNVKLNMRT* |
| Ga0164301_107207901 | 3300012960 | Soil | MKQVSELPVKKPYQAPKLTVYGDLTQLTMTMAKGMGKLDNLKMFQT* |
| Ga0137405_10379032 | 3300015053 | Vadose Zone Soil | MKRASEVPLKTPYHPPKLIVYGDLTQLTMTAQKGMGQPDNVKL |
| Ga0137412_100084745 | 3300015242 | Vadose Zone Soil | MTRASEVPGKKAYHPPKLIVYGDLSQLTMATGSMKGQIDHVKPTNRT* |
| Ga0137408_11042882 | 3300019789 | Vadose Zone Soil | MKRASEVPLKTPYHPPKLIVYGDLTQLTMTAQKGMGQPDNVKLNMRT |
| Ga0137408_13846614 | 3300019789 | Vadose Zone Soil | MNDASVRVPVKKPYQPPKLIVYGDLTQLTMTVAMMGGQFDNMKLTKRT |
| Ga0137408_14650874 | 3300019789 | Vadose Zone Soil | MKRAPEVPLKTPYHPPKLIVYGDLTQLTLTAQKGMGKPDNVKLNMRT |
| Ga0179594_100030904 | 3300020170 | Vadose Zone Soil | MTRVSEVPVKKPYQPPKLIVYGDLTQLTLTTMAGMGQPDNVKQTMRT |
| Ga0179594_103454192 | 3300020170 | Vadose Zone Soil | MKRESEAPVKKPYQAPKLIVYGDLTQLTMTVAMMGGQFDNMMLTKRT |
| Ga0179592_100032594 | 3300020199 | Vadose Zone Soil | MTRASEVTGKKPYHPPKLIVYGDLTQLTMTAAMMGGQFDNVKHTKRT |
| Ga0210407_1000041532 | 3300020579 | Soil | MKRASEVRAKKPYQAPKLIVYGDLTQLTMTVAMMGGQFDNMKLTKRT |
| Ga0210407_110850252 | 3300020579 | Soil | MKQVSELPVKKPYQAPKLTVYGDLTQLTMAMAKGMGKLDNLKMFQT |
| Ga0210403_100164904 | 3300020580 | Soil | MKRAAQVPLKKPYQAPKLIVYGDLTQLTMARAMIGGMLDGNMAKRT |
| Ga0210405_1000213314 | 3300021171 | Soil | MKRASDGPGKKPYQPPKLTIYGDLTLLTLTTVQKGAQFDNVKHTMRT |
| Ga0210405_100145148 | 3300021171 | Soil | MTRGSKVPLKKPYQAPKLIVYGDLTQLTMTRAVMMGQFDNMMLVKRT |
| Ga0210386_110426851 | 3300021406 | Soil | LKKPYQAPKLIVYGDLTQLTMARAMIGGMLDGNMAKRT |
| Ga0210390_100094755 | 3300021474 | Soil | MKRASQVSAKKPYHPPKLIVYGDLTQLTMAGGKMGATDNIVKPPTRS |
| Ga0247694_10000892 | 3300024178 | Soil | MKRGAEVPVKKPYQAPKLIVYGDLTELTMASGTKKGTIDNTTKPTTRT |
| Ga0247694_10039501 | 3300024178 | Soil | MKRVSELPVKKPYQAPKLTVYGDLTQLTMTSSKGMGMADNLKMFQT |
| Ga0247688_10242961 | 3300024186 | Soil | MKRVSELPVKKPYQAPKLTVYGDLTQLTMTSSKGMGMADNLK |
| Ga0247666_10010442 | 3300024323 | Soil | MKQVSELPVKKPYQAPKLTVYGDLTQLTMTSSKGKGMPDNTKMFQT |
| Ga0209240_10261923 | 3300026304 | Grasslands Soil | MKRAPEAPVKKPYQAPKLTVYGDLTQLTLTMVHMGAMFDNRKLTMRT |
| Ga0209471_10238193 | 3300026318 | Soil | VARPPEAPGKKPYHPPKLVAYGELTQLTMTVAMMGGQFDNMMLTKRT |
| Ga0209056_100555013 | 3300026538 | Soil | MTRASEVPVKKPYQAPKLIVYGDLTQLTRAIAKGKGQPDNVMAKRT |
| Ga0209648_1000000943 | 3300026551 | Grasslands Soil | MKRASEAPVKKPYQAPKLTVYGDLTQLTMTMAGMMGQFDNVKHTMRT |
| Ga0209648_1000159714 | 3300026551 | Grasslands Soil | MTHASKIRIKKPYHAPKLIVYGDLTQLTLTTTSPKGQPDNAKHNMRT |
| Ga0209648_100208503 | 3300026551 | Grasslands Soil | MTRASEVPGKKPYHPPKLIVYGDLTQLTMTAAMMGGQFDNVKHTKRT |
| Ga0209388_11290662 | 3300027655 | Vadose Zone Soil | MNRAPEVPLKAPYHPPKLIVYGDLTQLTMARAMMGGQIDNMMLTKRT |
| Ga0209588_10016764 | 3300027671 | Vadose Zone Soil | MKRVSKVPAKKPYHAPKLIVYGDLTQLTMMKARGGMFDNMMASMRT |
| Ga0209118_10513192 | 3300027674 | Forest Soil | MKRASEVPLKKPYHAPKLIVYGDLTQLTMVRAMMGGQFDNMMLTKRT |
| Ga0209180_101051202 | 3300027846 | Vadose Zone Soil | MARASEVPVKKPYRPPKLIVYGDLTQLTMTLPSGMGQFDNVKHNMRT |
| Ga0209166_1000018423 | 3300027857 | Surface Soil | MKRQAADFPAKRPYYPPKLTVYGDLTELTMTKMTKTGQFDNVKKTRRT |
| Ga0209701_100341372 | 3300027862 | Vadose Zone Soil | MKRASKVPVKKPYHAPKLIVYGDLTQLTMGTASMGGRIDNVKPQRRT |
| Ga0209701_100736482 | 3300027862 | Vadose Zone Soil | MKRAPEVPVKKPYRSPKLIVYGDLTQLTMTLPSGMGQFDNVKHNMRT |
| Ga0307504_103696172 | 3300028792 | Soil | RASKVPVKRPYNAPKLIRYGDLTQLTMVRAMMGGQFDNMMLTKRT |
| Ga0307469_111117322 | 3300031720 | Hardwood Forest Soil | MKQVSQLPVKKPYQAPKLTVYGDLTQLTMSSAKGKGMPDGTMKFQT |
| Ga0307477_100581793 | 3300031753 | Hardwood Forest Soil | MTRASKVPVKKPYHAPKLIVYGDLTQLTLTMVQKGAMFDNPKHTMRT |
| Ga0307475_100720153 | 3300031754 | Hardwood Forest Soil | MTRASRVPVKKPYQPPKLIVYGDLTQLTLTMVQKGAMFDNPKHTMRT |
| Ga0307473_103726962 | 3300031820 | Hardwood Forest Soil | MTRASKVPVKKPYHAPKLIVYGDLTQLTTSLAKGKGRPDGTKNRRT |
| Ga0307473_105770272 | 3300031820 | Hardwood Forest Soil | VKKPYQPPKLIVYGDLTQLTMAAMMGTGNFDNVKHTKRT |
| Ga0307478_1000049330 | 3300031823 | Hardwood Forest Soil | MKRAAQVPLKKPYQAPKLIVYGDLTQLTMTKAKGGMFDNKMASMRT |
| Ga0307471_1000382612 | 3300032180 | Hardwood Forest Soil | MKRAPEVPLKTTYHPPKLIVYGDLTQLTLTAQKGMGQPDNVKLNMRT |
| Ga0307471_1000685363 | 3300032180 | Hardwood Forest Soil | MKRASEVRAKKPYQAPKLIVYGDLTQLTMTVAMKGGQFDNMKLTKRT |
| Ga0307472_1024791761 | 3300032205 | Hardwood Forest Soil | MKRAPEVPLKAPYHPPKLIVYGDLSQLTMTSAKGKGQLD |
| ⦗Top⦘ |