| Basic Information | |
|---|---|
| Family ID | F104739 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 51 residues |
| Representative Sequence | MNWNAELTVCFVSTSVVNVAFAASYHLPAAASPPTSCAAATISKFLSFSSA |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 6.06 % |
| % of genes near scaffold ends (potentially truncated) | 31.00 % |
| % of genes from short scaffolds (< 2000 bps) | 88.00 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (54.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 48.10% β-sheet: 0.00% Coil/Unstructured: 51.90% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF00578 | AhpC-TSA | 15.00 |
| PF00072 | Response_reg | 8.00 |
| PF13692 | Glyco_trans_1_4 | 2.00 |
| PF13428 | TPR_14 | 2.00 |
| PF01070 | FMN_dh | 2.00 |
| PF02515 | CoA_transf_3 | 1.00 |
| PF09360 | zf-CDGSH | 1.00 |
| PF02617 | ClpS | 1.00 |
| PF07719 | TPR_2 | 1.00 |
| PF00691 | OmpA | 1.00 |
| PF01408 | GFO_IDH_MocA | 1.00 |
| PF00725 | 3HCDH | 1.00 |
| PF00515 | TPR_1 | 1.00 |
| PF13360 | PQQ_2 | 1.00 |
| PF00230 | MIP | 1.00 |
| PF13620 | CarboxypepD_reg | 1.00 |
| PF13570 | PQQ_3 | 1.00 |
| PF00534 | Glycos_transf_1 | 1.00 |
| PF13191 | AAA_16 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 2.00 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 2.00 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 1.00 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 1.00 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 1.00 |
| COG2127 | ATP-dependent Clp protease adapter protein ClpS | Posttranslational modification, protein turnover, chaperones [O] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.00 % |
| Unclassified | root | N/A | 1.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459003|FZN2CUW02HGKUR | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300004479|Ga0062595_100949247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 732 | Open in IMG/M |
| 3300005184|Ga0066671_10664594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
| 3300005328|Ga0070676_10298048 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300005331|Ga0070670_101023620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
| 3300005331|Ga0070670_101673472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300005334|Ga0068869_100612246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 921 | Open in IMG/M |
| 3300005338|Ga0068868_100401965 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1182 | Open in IMG/M |
| 3300005353|Ga0070669_100535991 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300005354|Ga0070675_100642573 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300005471|Ga0070698_100893419 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300005518|Ga0070699_101889689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300005529|Ga0070741_10116868 | All Organisms → cellular organisms → Bacteria | 2769 | Open in IMG/M |
| 3300005543|Ga0070672_100136537 | All Organisms → cellular organisms → Bacteria | 2020 | Open in IMG/M |
| 3300005764|Ga0066903_100279421 | All Organisms → cellular organisms → Bacteria | 2616 | Open in IMG/M |
| 3300005840|Ga0068870_11252759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
| 3300006047|Ga0075024_100109351 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300006049|Ga0075417_10121244 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300006804|Ga0079221_10320635 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300006844|Ga0075428_100459356 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| 3300006914|Ga0075436_100132534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1748 | Open in IMG/M |
| 3300007004|Ga0079218_12289799 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 631 | Open in IMG/M |
| 3300007076|Ga0075435_100645703 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300007255|Ga0099791_10440236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
| 3300009088|Ga0099830_10152697 | All Organisms → cellular organisms → Bacteria | 1777 | Open in IMG/M |
| 3300009090|Ga0099827_10130861 | All Organisms → cellular organisms → Bacteria | 2033 | Open in IMG/M |
| 3300009093|Ga0105240_10415070 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1513 | Open in IMG/M |
| 3300009100|Ga0075418_10876684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 970 | Open in IMG/M |
| 3300009101|Ga0105247_11305672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300009176|Ga0105242_11422822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
| 3300009553|Ga0105249_11113268 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300009665|Ga0116135_1299467 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300010046|Ga0126384_10509765 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300010359|Ga0126376_10804949 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300010366|Ga0126379_11505093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
| 3300010376|Ga0126381_102991337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300010391|Ga0136847_11681114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4649 | Open in IMG/M |
| 3300010398|Ga0126383_10798326 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300010398|Ga0126383_11637730 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300010400|Ga0134122_10549740 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300010400|Ga0134122_13095148 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300010401|Ga0134121_10116212 | All Organisms → cellular organisms → Bacteria | 2256 | Open in IMG/M |
| 3300012094|Ga0136638_10518077 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300012189|Ga0137388_10697994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 942 | Open in IMG/M |
| 3300012212|Ga0150985_115271478 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300012358|Ga0137368_10197490 | All Organisms → cellular organisms → Bacteria | 1434 | Open in IMG/M |
| 3300012360|Ga0137375_10681322 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300012899|Ga0157299_10359311 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300012909|Ga0157290_10356830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300012922|Ga0137394_10866762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 755 | Open in IMG/M |
| 3300012929|Ga0137404_12167349 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium | 519 | Open in IMG/M |
| 3300012944|Ga0137410_12118756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300012948|Ga0126375_11865078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300012960|Ga0164301_11171229 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300012986|Ga0164304_11564582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300013297|Ga0157378_12081398 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300013306|Ga0163162_12367773 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300013308|Ga0157375_10508389 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300014150|Ga0134081_10293131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 582 | Open in IMG/M |
| 3300015052|Ga0137411_1357171 | All Organisms → cellular organisms → Bacteria | 3403 | Open in IMG/M |
| 3300015164|Ga0167652_1040277 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300015171|Ga0167648_1052726 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300015264|Ga0137403_10649248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 918 | Open in IMG/M |
| 3300015371|Ga0132258_12280366 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1358 | Open in IMG/M |
| 3300015372|Ga0132256_103202952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300015373|Ga0132257_100005469 | All Organisms → cellular organisms → Bacteria | 12181 | Open in IMG/M |
| 3300018476|Ga0190274_10798268 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300019890|Ga0193728_1096394 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
| 3300021073|Ga0210378_10099514 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300021861|Ga0213853_11026524 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300023077|Ga0247802_1065049 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300024347|Ga0179591_1068950 | All Organisms → cellular organisms → Bacteria | 2439 | Open in IMG/M |
| 3300024347|Ga0179591_1182041 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2453 | Open in IMG/M |
| 3300025907|Ga0207645_11162001 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300025908|Ga0207643_10114312 | All Organisms → cellular organisms → Bacteria | 1593 | Open in IMG/M |
| 3300025922|Ga0207646_11404446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300025923|Ga0207681_11324544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300025925|Ga0207650_10826250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 786 | Open in IMG/M |
| 3300025927|Ga0207687_10591789 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300025930|Ga0207701_10372238 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| 3300025961|Ga0207712_10121305 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1978 | Open in IMG/M |
| 3300025986|Ga0207658_10531122 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300026023|Ga0207677_10329417 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1272 | Open in IMG/M |
| 3300026035|Ga0207703_11320447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
| 3300026095|Ga0207676_11331473 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300027835|Ga0209515_10017907 | All Organisms → cellular organisms → Bacteria | 6974 | Open in IMG/M |
| 3300027875|Ga0209283_10927046 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300027915|Ga0209069_10195345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1029 | Open in IMG/M |
| 3300027915|Ga0209069_10604620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 632 | Open in IMG/M |
| 3300028799|Ga0307284_10396419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300028802|Ga0307503_10859663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300028828|Ga0307312_10661537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 692 | Open in IMG/M |
| 3300031366|Ga0307506_10194198 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300031538|Ga0310888_10974942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300031716|Ga0310813_11065056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
| 3300031834|Ga0315290_11256854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300032163|Ga0315281_10301712 | All Organisms → cellular organisms → Bacteria | 1749 | Open in IMG/M |
| 3300032163|Ga0315281_11261656 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300032275|Ga0315270_10404224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 871 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 6.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 5.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.00% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 4.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.00% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 2.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.00% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.00% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 1.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 1.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.00% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 1.00% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.00% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.00% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012094 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ858 (22.06) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015164 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4b, rock/ice/stream interface) | Environmental | Open in IMG/M |
| 3300015171 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3a, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6 | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4A_08813190 | 2170459003 | Grass Soil | MNWNAELTVCFVSTSVVNVAFAASYHLPAAASPPTSCAAATISKFLSFSSA |
| Ga0062595_1009492471 | 3300004479 | Soil | ELIVCFVSTSAVNVAPAASYHWPAAASPPVSCAAATISKFWSFSSP* |
| Ga0066671_106645941 | 3300005184 | Soil | QTPIGTLMNWKFELTVCWRSISVVNVAFAASYHLPAAASPPVSCAAATISKLLPFSS* |
| Ga0070676_102980483 | 3300005328 | Miscanthus Rhizosphere | LINWNAELTVCEVSTSVVKVAFAASYHLPAAASPPVSCAAAMISKFRSFSSA* |
| Ga0070670_1010236202 | 3300005331 | Switchgrass Rhizosphere | SSIQMPIGTLINWNAELMACVVSTSVVKVAFAASYHLPAAASPPVSCAAEMISKFRSFSSA* |
| Ga0070670_1016734721 | 3300005331 | Switchgrass Rhizosphere | QTPDGTFTNWNAELTLWRVSSSCVNVACAASYHLPASASPPMSWAAATISKFFPLSSS* |
| Ga0068869_1006122462 | 3300005334 | Miscanthus Rhizosphere | MNWKTELTVCLVSTSCVNVAFAASYHLPAAASPPTSCAAAMSSKFSSFSSA* |
| Ga0068868_1004019653 | 3300005338 | Miscanthus Rhizosphere | IQIPIGTLMNWYAELTPCFASISVVYVAFAASYHLPAAASPPTSCAAAMSSKFSSFSSA* |
| Ga0070669_1005359912 | 3300005353 | Switchgrass Rhizosphere | LINWNAELTVWVASTSVVNVAFAASYHLPAAGSPPVSCATAMISKFLSFSSA* |
| Ga0070675_1006425732 | 3300005354 | Miscanthus Rhizosphere | LINWNAELMACVVSTSVVKVAFAASYHLPAAASPPVSCAAAMISKFRSFSSA* |
| Ga0070698_1008934192 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LANWNAELTAWFASTSVVNVALAASYHGPAAASPPVSCAAATISRFACFSSL* |
| Ga0070699_1018896892 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | AELTACVVSTSVVNVAFAASYHLPAAASPPTSCAAATIPKFLSLSSS* |
| Ga0070741_101168682 | 3300005529 | Surface Soil | MNWNAELTAWRTSMSVVNVAFAASYHLPAACSPAVSWAAATISKPRGFSSS* |
| Ga0070672_1001365372 | 3300005543 | Miscanthus Rhizosphere | MPIGTLIKWNAELTACVVSISVVKAAFAASYHLPAAASPPVSCAAAMISKFRSFSSA* |
| Ga0066903_1002794213 | 3300005764 | Tropical Forest Soil | MNWNAELIAWFASTSVVNVALAASYHRPAAASPPVSCATATISKFASFSSL* |
| Ga0068870_112527592 | 3300005840 | Miscanthus Rhizosphere | MPIGTLINWNAELMACVVSTSVVKVAFAASYHLPAAASPPVSCAAEMISKFRSFSSA* |
| Ga0075024_1001093512 | 3300006047 | Watersheds | MNWNTELTVCLVSTSVVNVAFAASYHFPAAASPPTSCAAATISKLRSFSSA* |
| Ga0075417_101212442 | 3300006049 | Populus Rhizosphere | LTNWNAELTAWVASTSVVNVALAASYHFPAAASPPVSCAAATISKFLSFSSL* |
| Ga0079221_103206352 | 3300006804 | Agricultural Soil | MNWYAVLTACWASISVVYVAFAASYHLPAAASPPVSCAAAMISKF* |
| Ga0075428_1004593561 | 3300006844 | Populus Rhizosphere | LLNWNAELTVWLASTSVVNVALAASYHFPAAASPPVSCAAATISKFASFSSV* |
| Ga0075436_1001325341 | 3300006914 | Populus Rhizosphere | NAELTAWLASTSVVKVALAASYQRPAAASPPVSCAAATISKFLSFSSV* |
| Ga0079218_122897992 | 3300007004 | Agricultural Soil | STQTPVGTLVNWNAELTACAGSISVVYVALAASYHLPAAASPPVSCAAAMISKFLPFSSS |
| Ga0075435_1006457031 | 3300007076 | Populus Rhizosphere | MNWYAVLTACWVSISVEYVAFAASYHLPAAASPPVSCAAAMISKF* |
| Ga0099791_104402362 | 3300007255 | Vadose Zone Soil | MNCKTELTVCFASTSVVNVAFAASYHLPAAASPPVSCAAATISKLLSFSSA* |
| Ga0099830_101526972 | 3300009088 | Vadose Zone Soil | LTNWNAELTVCFASTSAVKVAFAASYHLPAAASPPVSCAAAMISKFLSFSSV* |
| Ga0099827_101308613 | 3300009090 | Vadose Zone Soil | MNWNAELTVCFASTSAVKVAFAASYHLPAAASPPVSCAAAMISKFLSFSSV* |
| Ga0105240_104150702 | 3300009093 | Corn Rhizosphere | MNWNTELTVCLVSTSVVNVAFAASYHLPAAASPPTSCAAAISSKFLSFSSA* |
| Ga0075418_108766842 | 3300009100 | Populus Rhizosphere | LLNWNAELTAWLASTSVVNVALAASYHFPAAASPPVSCAAATISKFASFSSL* |
| Ga0105247_113056721 | 3300009101 | Switchgrass Rhizosphere | TVCRVSISCVNVASAASYQRPAAASPPTSCAAAMISMFLSFSSL* |
| Ga0105242_114228222 | 3300009176 | Miscanthus Rhizosphere | ELIVCFVSTSAVNVAPAASYHWPAAASPPVSCAAAIISKFRSFSSA* |
| Ga0105249_111132682 | 3300009553 | Switchgrass Rhizosphere | MPIGTLINWNAELTVWVASTSVVNVAFAASYHLPAAGSPPVSCATEMISKFLSFSSA* |
| Ga0116135_12994672 | 3300009665 | Peatland | MPIGTLMNWYAVLTLCWASISVVKVAFAASYHFPAAASPPVSCAAAIISKFWSCSSV* |
| Ga0126384_105097651 | 3300010046 | Tropical Forest Soil | TLMNWYAELTACCVSIKVVKVAFAASYHLPAAASPPVSCAAATISKF* |
| Ga0126376_108049493 | 3300010359 | Tropical Forest Soil | MPIGTLMNWYAELTACCVSIKVVKVAFAASYHLPAAASPPVSCAAATISKF* |
| Ga0126379_115050932 | 3300010366 | Tropical Forest Soil | MNWKAELTACCVSISVVNVALAASYHLPAAASPPVSWAAATISKFWSCSSV* |
| Ga0126381_1029913372 | 3300010376 | Tropical Forest Soil | WKAELTACCVSISVVNVALAASYDLPAAASPPVSWAAATISKFWSCSSV* |
| Ga0136847_116811143 | 3300010391 | Freshwater Sediment | LTNWNTELTVCFVSTSVVNVAFAASYHLPAAASPPVSSAAATISKFLSFSSS* |
| Ga0126383_107983262 | 3300010398 | Tropical Forest Soil | MGTLMNWYAELTACCVSIKVVKVALAASYHLPAAASPPVSCAAATISKF* |
| Ga0126383_116377302 | 3300010398 | Tropical Forest Soil | MPIGTLMNWKAELTACCVSISVVNVALAASYHLPAAASPPVSWAAATISKFWSCSSV* |
| Ga0134122_101444854 | 3300010400 | Terrestrial Soil | VCLVSISVVNVAFAASYHLPAAASPPTSCAASMISKFVLLSSA* |
| Ga0134122_105497402 | 3300010400 | Terrestrial Soil | MNWKSELTVCFTSTSVVNVALAASYHLPAAASPPVSCAAAMISKFRPFSSA* |
| Ga0134122_130951482 | 3300010400 | Terrestrial Soil | LTNWNVELTACCRSISVVKVALAASYHLPAAASPPVSCAAATISKLRAFSSW* |
| Ga0134121_101162124 | 3300010401 | Terrestrial Soil | LTNWNTELTVCVASTRVVNVALAASYHLPAAASPPVSCAAATISKFLSFSSL* |
| Ga0136638_105180772 | 3300012094 | Polar Desert Sand | VNWNAELTACFASTNVVYVARATSYHFPAAVSPAVSWAAAMISKLLLFSSS* |
| Ga0137388_106979942 | 3300012189 | Vadose Zone Soil | LTNWNAELTVCFASTSAVKVAFAASYHLPAAASPPVSCAAAMISKFPSFSSV* |
| Ga0150985_1152714782 | 3300012212 | Avena Fatua Rhizosphere | MNWYSELMVCFVSTSCVNVAFAASYHLPAAASPPVSCAAAMSSKF* |
| Ga0137368_101974903 | 3300012358 | Vadose Zone Soil | MNWNAELIACFASTSVVNVAFAVSYHLPAAASPPVSWAAATIAKFRSLSSS* |
| Ga0137375_106813222 | 3300012360 | Vadose Zone Soil | MNWNAELIACFASTSVVNVAFAVSYHLPAAASPPVSSAAATISKFRSLSSS* |
| Ga0157299_103593112 | 3300012899 | Soil | LIKWNAELTACVVSISVVKAAFAASYHLPAAASPPVSCAAAMISKFRSFSSA* |
| Ga0157290_103568302 | 3300012909 | Soil | ELTACVVSTSVVYVAFAASYHLPAAASPPVSCAAAMISKFLPFSSS* |
| Ga0137394_108667621 | 3300012922 | Vadose Zone Soil | LRSWNAELTLCVASTSVVNVAFAASYHLPAAASPPVSCAAATISKLLSFSSA* |
| Ga0137404_121673492 | 3300012929 | Vadose Zone Soil | MNWKTELTVCLVSTSCVKVAFAASYHLPAAASPPTSCAAAMISKFLSFSSA* |
| Ga0137410_121187562 | 3300012944 | Vadose Zone Soil | LCVASTSVVNVAFAASYHLPAAASPPVSCAAATISKLLSFSSA* |
| Ga0126375_118650781 | 3300012948 | Tropical Forest Soil | NAELTAWLVSTSVVYVAFAASYHLPAAASPPVSCAAATISKFLSLSSL* |
| Ga0164301_111712292 | 3300012960 | Soil | VCLASTSVVNAAFAASYHLPAAASPPVSCAAAMISKFLSFSSA* |
| Ga0164304_115645822 | 3300012986 | Soil | WNVELTACCRSISVVKVALAASYHLPAAASPPVSCAAATISKLRAFSC* |
| Ga0157378_120813982 | 3300013297 | Miscanthus Rhizosphere | MPIGTLINWNTELTVCVVSTSVVKVAFAASYHLPAAASPPVSCAAAMISKFRSFSSA* |
| Ga0163162_123677732 | 3300013306 | Switchgrass Rhizosphere | MPIGTLINWNAELTVWVASTSVVNVAFAASYHLPAAASPPTSCAAATISKFLSFSSA* |
| Ga0157375_105083893 | 3300013308 | Miscanthus Rhizosphere | MPIGTLINWNAELTVWVASTSVVKVAFAASYHLPAAASPPVSCAAAMISKSLSFSSA* |
| Ga0134081_102931312 | 3300014150 | Grasslands Soil | NTELTVCFASTSVVKVAFAASYHWPAAASPPVSCAAAISSKFLSFSSA* |
| Ga0137411_13571714 | 3300015052 | Vadose Zone Soil | MPAGTLINWNAELTVCLVSTSVVNVAFAASYHLPAAAHRATSWAAATISKFLSLSSS* |
| Ga0167652_10402772 | 3300015164 | Glacier Forefield Soil | MNWNTELTVCFVSTSVVNVAFAASYHLPAAASPPVSWAAAMISKFRSFSSA* |
| Ga0167648_10527262 | 3300015171 | Glacier Forefield Soil | MNWNTELTVCFVSTSVVNVALAASYHLPAAASPPTSCAAATISKFLSFSSS* |
| Ga0137403_106492482 | 3300015264 | Vadose Zone Soil | MNWKTELTVCLVSTSCVNVAFAASYHLPAAASPPTSCAAAMISKFLSFSSA* |
| Ga0132258_122803661 | 3300015371 | Arabidopsis Rhizosphere | ELTVCRVSISCVNVALAASYQRPAAASPPTSCAAAMISMFLSFSSL* |
| Ga0132256_1032029521 | 3300015372 | Arabidopsis Rhizosphere | NAELTAWFASTSVVYVAFAASYHLPAAASPPVSCAAATISKFLSFSSV* |
| Ga0132257_10000546911 | 3300015373 | Arabidopsis Rhizosphere | WNAELTACFASTSVVKVAFAASYHLPAAASPPVSCATATISKFLPFSSS* |
| Ga0190274_107982682 | 3300018476 | Soil | MNWKTELTVCLVSTSCVNVAFAASYHLPAAASPPTSCAAAMISKFLSFSSV |
| Ga0193728_10963942 | 3300019890 | Soil | MNWKTELTVCFVSTSCVNVAFAASYHLPAAASPPTSCAAAMISKFWSFSSA |
| Ga0210378_100995142 | 3300021073 | Groundwater Sediment | MNWKTELTVCFVSTSVVNVALAASYHLPAAASPPVSCAAAMISKFWSFSSA |
| Ga0213853_110265242 | 3300021861 | Watersheds | MNWKTELTVCLVSTSWVNAAFAASYHLPAAASPPTSWAAAMISKFLFFSSA |
| Ga0247802_10650492 | 3300023077 | Soil | MPIGTLIKWNAELTACVVSISVVKAAFAASYHLPAAASPPVSCAAAMISKFRSFSSA |
| Ga0179591_10689503 | 3300024347 | Vadose Zone Soil | MNWKTELTVCLVSTSCVNVAFAASYHLPAAASPPTSCAAAMISKFLSFSSA |
| Ga0179591_11820412 | 3300024347 | Vadose Zone Soil | MNWNSELTVCFVSTSCVNVAFAASYHLPAAASPPTSCAAAMISKLRSFSSA |
| Ga0207645_111620012 | 3300025907 | Miscanthus Rhizosphere | LINWNAELTVCEVSTSVVKVAFAASYHLPAAASPPVSCAAAMISKFRSFSSA |
| Ga0207643_101143121 | 3300025908 | Miscanthus Rhizosphere | NAELTACVVSTSVVKVAFAASYHFPAAASPPVSCAAATISKFRSFSSA |
| Ga0207646_114044461 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | TVCFGSTSVVNVAFAASYHFPAAASPPESCAAATISKFLSFSSS |
| Ga0207681_113245442 | 3300025923 | Switchgrass Rhizosphere | ELTVWVASTSVVNVAFAASYHLPAAGSPPVSCATAMISKFLSFSSA |
| Ga0207650_108262501 | 3300025925 | Switchgrass Rhizosphere | INWNAELMACVVSTSVVKVAFAASYHLPAAASPPVSCAAATISKFRSFSSA |
| Ga0207687_105917892 | 3300025927 | Miscanthus Rhizosphere | MNWKTELTVCLVSTSCVNVAFAASYHLPAAASPPTSCAAAMSSKFLSFSSA |
| Ga0207701_103722382 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVGTFTNWNRELTVWFASTSVVKVALAASYHLPAAASPPVSCAAAMISKFRDLSSV |
| Ga0207712_101213054 | 3300025961 | Switchgrass Rhizosphere | LINWNAELTVWVASTSVVNVAFAASYHLPAAGSPPVSCATEMISKFLSFSSA |
| Ga0207658_105311222 | 3300025986 | Switchgrass Rhizosphere | LINWNAELTACVVSTSVVKVAFAASYHLPAAASPPVSCAAATISKFRSFSSA |
| Ga0207677_103294171 | 3300026023 | Miscanthus Rhizosphere | TPIGTLMNWKTELTVCLVSTNCVNVAFAASYHLPAAASPPTSCAAAMSSKFSSFSSA |
| Ga0207703_113204472 | 3300026035 | Switchgrass Rhizosphere | MNWKTELTVCLVSTSCVNVAFAASYHLPAAASPPTSCAAAMSSKFSSFSSA |
| Ga0207676_113314732 | 3300026095 | Switchgrass Rhizosphere | LINWNAELTLCKVSTSVVKVAFAASYHLPAAASPPVSCAAAMISKFRSFSSA |
| Ga0209515_100179072 | 3300027835 | Groundwater | MHWNTELTECVVSTSVVNVAFAASYHVPAAASPPTSCAAATISKFLSFSSA |
| Ga0209283_109270462 | 3300027875 | Vadose Zone Soil | LTNWNAELTVCFASTSAVKVAFAASYHLPAAASPPVSCAAAMISKFLSFSSV |
| Ga0209069_101953452 | 3300027915 | Watersheds | MNWNTELTVCLVSTSVVNVAFAASYHFPAAASPPTSCAAATISKLRSFSSA |
| Ga0209069_106046202 | 3300027915 | Watersheds | MNWKSELISCFASTSVVNVAFAASYHLPAAASPPVSCAAETISKFLSFSSP |
| Ga0307284_103964192 | 3300028799 | Soil | TPIGTLANWNTELTVCFVSTSVVNVAPAASYHLPAAASPPMSCAAATISKWWPLSSA |
| Ga0307503_108596632 | 3300028802 | Soil | IQMPVGTLISWNAELTACVVSTSVVKVAFAASYHLPAAASPPVSCAAAMISKFRSFSSA |
| Ga0307312_106615372 | 3300028828 | Soil | LINWNAELTACVVSTSVVKVALAASYHLPAAASPPVSCAAAMISKFRSFSSA |
| Ga0307506_101941982 | 3300031366 | Soil | MNWNSELTVCFVSTSCVNVAFAASYHLPAAASPPTSCAAAMISKFWPFSSA |
| Ga0310888_109749422 | 3300031538 | Soil | LTVWFVSTSVVKVALAASYHLPAAASPPVSCAAAMISKFRDFSSV |
| Ga0310813_110650561 | 3300031716 | Soil | PASSIQMPVGTLINWNAELTACVVSTSVVKVAFAASYHLPAAASPPVSCAAATISRFRSFSSA |
| Ga0315290_112568541 | 3300031834 | Sediment | ELTVCFTSTSVVKVACAASYHFPAAASPPVSCAAATISKFVPLSAA |
| Ga0315281_103017122 | 3300032163 | Sediment | MNWNTELTVCFVSMSAVNVAFAASYHAPAAASPPVSCAAAMISKFLSFSCA |
| Ga0315281_112616562 | 3300032163 | Sediment | MNWNTELTVWLVSTSVVNVAFAASYHLPAAASPPTSCAAATISKCLSFSSA |
| Ga0315270_104042242 | 3300032275 | Sediment | LLNWNTELTVCLVSTSVVYVAFAASYHLPAAGSPSVSCAAVTISRFLSFSSA |
| ⦗Top⦘ |