Basic Information | |
---|---|
Family ID | F104723 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 100 |
Average Sequence Length | 42 residues |
Representative Sequence | QGYVRVDEPEVTIESVDSERTDTAFAPVIPTIKRMGRPRKVANV |
Number of Associated Samples | 75 |
Number of Associated Scaffolds | 100 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 95.00 % |
% of genes from short scaffolds (< 2000 bps) | 95.00 % |
Associated GOLD sequencing projects | 68 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (72.000 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (28.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (63.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (72.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.36% β-sheet: 11.36% Coil/Unstructured: 77.27% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 100 Family Scaffolds |
---|---|---|
PF05065 | Phage_capsid | 3.00 |
PF13884 | Peptidase_S74 | 1.00 |
PF13392 | HNH_3 | 1.00 |
COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
---|---|---|---|
COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 3.00 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 90.00 % |
Unclassified | root | N/A | 10.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001843|RCM34_1135610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
3300003412|JGI25912J50252_10140664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
3300005992|Ga0073924_1031317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 754 | Open in IMG/M |
3300006805|Ga0075464_10064401 | All Organisms → cellular organisms → Bacteria | 2053 | Open in IMG/M |
3300007363|Ga0075458_10187326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
3300007540|Ga0099847_1110153 | Not Available | 834 | Open in IMG/M |
3300007540|Ga0099847_1184554 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
3300007542|Ga0099846_1278536 | Not Available | 576 | Open in IMG/M |
3300007636|Ga0102856_1075361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
3300007974|Ga0105747_1348202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
3300008448|Ga0114876_1081806 | All Organisms → Viruses → Predicted Viral | 1338 | Open in IMG/M |
3300009155|Ga0114968_10050609 | All Organisms → Viruses → Predicted Viral | 2678 | Open in IMG/M |
3300009155|Ga0114968_10351845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 813 | Open in IMG/M |
3300009155|Ga0114968_10472438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 676 | Open in IMG/M |
3300009159|Ga0114978_10139634 | All Organisms → Viruses → Predicted Viral | 1568 | Open in IMG/M |
3300009159|Ga0114978_10733506 | Not Available | 561 | Open in IMG/M |
3300009160|Ga0114981_10545368 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
3300009161|Ga0114966_10161068 | All Organisms → Viruses → Predicted Viral | 1453 | Open in IMG/M |
3300009163|Ga0114970_10110076 | All Organisms → Viruses → Predicted Viral | 1695 | Open in IMG/M |
3300009163|Ga0114970_10200790 | All Organisms → Viruses → Predicted Viral | 1173 | Open in IMG/M |
3300009163|Ga0114970_10254023 | Not Available | 1015 | Open in IMG/M |
3300009164|Ga0114975_10199310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1131 | Open in IMG/M |
3300009180|Ga0114979_10593884 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 633 | Open in IMG/M |
3300009183|Ga0114974_10221849 | All Organisms → Viruses → Predicted Viral | 1144 | Open in IMG/M |
3300009184|Ga0114976_10192947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1125 | Open in IMG/M |
3300009184|Ga0114976_10463080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
3300009184|Ga0114976_10528858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
3300012720|Ga0157613_1184244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 800 | Open in IMG/M |
3300013006|Ga0164294_11156709 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
3300013295|Ga0170791_15811519 | Not Available | 539 | Open in IMG/M |
3300013372|Ga0177922_10562134 | Not Available | 698 | Open in IMG/M |
3300013372|Ga0177922_10577392 | All Organisms → Viruses → Predicted Viral | 1282 | Open in IMG/M |
3300013372|Ga0177922_10731188 | Not Available | 663 | Open in IMG/M |
3300013372|Ga0177922_11192408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1086 | Open in IMG/M |
3300015050|Ga0181338_1046152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
3300017700|Ga0181339_1036844 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
3300017701|Ga0181364_1049791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
3300017716|Ga0181350_1075739 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 858 | Open in IMG/M |
3300017723|Ga0181362_1058399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 794 | Open in IMG/M |
3300017736|Ga0181365_1147487 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
3300017774|Ga0181358_1187059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
3300017777|Ga0181357_1161819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 819 | Open in IMG/M |
3300017777|Ga0181357_1276749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
3300017780|Ga0181346_1109078 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1069 | Open in IMG/M |
3300017784|Ga0181348_1226384 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 658 | Open in IMG/M |
3300017785|Ga0181355_1358803 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300018416|Ga0181553_10762525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
3300018420|Ga0181563_10569032 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
3300019784|Ga0181359_1148420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 807 | Open in IMG/M |
3300019784|Ga0181359_1152707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
3300019784|Ga0181359_1212011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
3300021960|Ga0222715_10216256 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1136 | Open in IMG/M |
3300022190|Ga0181354_1074424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1124 | Open in IMG/M |
3300022407|Ga0181351_1140912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 879 | Open in IMG/M |
3300022407|Ga0181351_1151540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 833 | Open in IMG/M |
3300022407|Ga0181351_1264449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
3300022407|Ga0181351_1279381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
3300023184|Ga0214919_10480823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 773 | Open in IMG/M |
3300024306|Ga0255148_1059958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
3300024513|Ga0255144_1042857 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
3300024533|Ga0256299_1102850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
3300024562|Ga0256336_1109196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
3300025635|Ga0208147_1109372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
3300025896|Ga0208916_10263782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 749 | Open in IMG/M |
3300025896|Ga0208916_10381909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
3300027134|Ga0255069_1001090 | All Organisms → Viruses → Predicted Viral | 2492 | Open in IMG/M |
3300027144|Ga0255102_1080755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
3300027368|Ga0255133_1020781 | All Organisms → Viruses → Predicted Viral | 1472 | Open in IMG/M |
3300027659|Ga0208975_1031383 | All Organisms → Viruses → Predicted Viral | 1696 | Open in IMG/M |
3300027707|Ga0209443_1141460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 882 | Open in IMG/M |
3300027734|Ga0209087_1128685 | All Organisms → Viruses → Predicted Viral | 1040 | Open in IMG/M |
3300027734|Ga0209087_1182529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 818 | Open in IMG/M |
3300027734|Ga0209087_1248977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
3300027736|Ga0209190_1120967 | All Organisms → Viruses → Predicted Viral | 1175 | Open in IMG/M |
3300027754|Ga0209596_1079437 | All Organisms → Viruses → Predicted Viral | 1604 | Open in IMG/M |
3300027754|Ga0209596_1135027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1115 | Open in IMG/M |
3300027756|Ga0209444_10207538 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
3300027759|Ga0209296_1244881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 741 | Open in IMG/M |
3300027760|Ga0209598_10117808 | All Organisms → Viruses → Predicted Viral | 1221 | Open in IMG/M |
3300027785|Ga0209246_10221693 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 736 | Open in IMG/M |
3300027798|Ga0209353_10133878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1111 | Open in IMG/M |
3300027798|Ga0209353_10249238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 764 | Open in IMG/M |
3300027798|Ga0209353_10277966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
3300027808|Ga0209354_10110600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1121 | Open in IMG/M |
3300027969|Ga0209191_1333517 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
3300027974|Ga0209299_1008043 | Not Available | 5176 | Open in IMG/M |
3300031707|Ga0315291_10427843 | All Organisms → Viruses → Predicted Viral | 1250 | Open in IMG/M |
3300031857|Ga0315909_10713572 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
3300031952|Ga0315294_10237207 | Not Available | 1788 | Open in IMG/M |
3300031952|Ga0315294_11432590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
3300031997|Ga0315278_11086614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 791 | Open in IMG/M |
3300031999|Ga0315274_11753913 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
3300032046|Ga0315289_11218764 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
3300032156|Ga0315295_10583371 | All Organisms → Viruses → Predicted Viral | 1133 | Open in IMG/M |
3300032156|Ga0315295_12266989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
3300032275|Ga0315270_11153800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
3300033981|Ga0334982_0008547 | Not Available | 6150 | Open in IMG/M |
3300034101|Ga0335027_0413173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 871 | Open in IMG/M |
3300034104|Ga0335031_0629178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
3300034122|Ga0335060_0491578 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 28.00% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 26.00% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 9.00% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.00% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.00% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 7.00% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.00% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.00% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.00% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.00% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.00% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.00% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.00% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.00% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.00% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 1.00% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001843 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM34, ROCA_DNA218_2.0um_bLM_C_2b | Environmental | Open in IMG/M |
3300003412 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD | Environmental | Open in IMG/M |
3300005992 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_14-Oct-14 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007636 | Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300012720 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES141 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017700 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024306 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h | Environmental | Open in IMG/M |
3300024513 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h | Environmental | Open in IMG/M |
3300024533 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024562 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027134 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8h | Environmental | Open in IMG/M |
3300027144 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_0h | Environmental | Open in IMG/M |
3300027368 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepB_8d | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
RCM34_11356101 | 3300001843 | Marine Plankton | EPQEVTTESFDSVRTDTAFAPVIPTFRKIGRPRKVQNVGH* |
JGI25912J50252_101406641 | 3300003412 | Freshwater Lake | QGYVRVDEPEVTIESVDSERTDTAFAPVIPTIKRMGRPRKVANV* |
Ga0073924_10313174 | 3300005992 | Sand | QGYVRIDEEEVTIESLDSERTDTAFAPVIPSIKRMGRPRKVANV* |
Ga0075464_100644011 | 3300006805 | Aqueous | GYVRVDEPEVTIESVESEIRTDTAFTAPVIPTIKRMGRPRKAENVGS* |
Ga0075458_101873261 | 3300007363 | Aqueous | RVDEPEVTIESVESEIRTDTAFRAPVIPTIKRMGRPRKVANV* |
Ga0099847_11101531 | 3300007540 | Aqueous | MRGHQGYVRVDEPEVTIESVESKIRTDTAFTAPVIPTI |
Ga0099847_11845544 | 3300007540 | Aqueous | TIESVESETRTDTAFAPVIPTFKRMGRPRKVANV* |
Ga0099846_12785362 | 3300007542 | Aqueous | MEGHQGYVRVDEPEVTIESAESEIRTDTAFTAPVIP |
Ga0102856_10753611 | 3300007636 | Estuarine | VTIESVESETRTDTAFRAPVIPTIKRMGRPRKVLTNV* |
Ga0105747_13482021 | 3300007974 | Estuary Water | MKGHQGYVRIDEAEVTTESVESETRTDTAFAPVIPTFKRMGRP |
Ga0114876_10818063 | 3300008448 | Freshwater Lake | MKGHQGYVRIDEPEVTIESVESETRTDTAFAPVIPTI |
Ga0114968_100506094 | 3300009155 | Freshwater Lake | MKGHQGYELVDEEEVTIESVDSERTDTAFAPVIPSVKRMGRPRKVANV* |
Ga0114968_103518453 | 3300009155 | Freshwater Lake | MDGHQGYELVDEEEVTIESVDSERTDTAFAPVIPTIKRMGRPRKVANV* |
Ga0114968_104724383 | 3300009155 | Freshwater Lake | VDEPEVTIESETRTDTAFAPVMPTIKRMGRPRKVVNG* |
Ga0114978_101396341 | 3300009159 | Freshwater Lake | EPEVTIESETRTDTAFAPVMPTIKRMGRPRKVANG* |
Ga0114978_107335061 | 3300009159 | Freshwater Lake | MEGHQGYVLVDEPEVTIESVESETRTDTAFAPVIPTIKRMGRPRKVAN |
Ga0114981_105453681 | 3300009160 | Freshwater Lake | MEGHQGYVRLDEPEITIESDNSVRTDTAFAPVIPTIKRLGRPRKVANV* |
Ga0114966_101610687 | 3300009161 | Freshwater Lake | DEPEVTIESETRTDTAFAPVMPTIKRMGRPRKVANG* |
Ga0114970_101100761 | 3300009163 | Freshwater Lake | MKGHQGYVRIDEPEVTTESVESETRTDTAFAPVIPTFKRMGR |
Ga0114970_102007901 | 3300009163 | Freshwater Lake | HQGYVRVDEPEVTIESETRTDTAFAPVMPTIKRMGRPRKVANG* |
Ga0114970_102540231 | 3300009163 | Freshwater Lake | MKGHQGYVRVDEPEVTIESETRTDTAFAPVMPTIK |
Ga0114975_101993101 | 3300009164 | Freshwater Lake | GHQGYVRVDEPEVTIESLDSERTDTAFAPVIPTIKRMGRPRKVANV* |
Ga0114979_105938842 | 3300009180 | Freshwater Lake | MKGHQGYVRVDEPEVTIESDNPVRTDTAFRAPVIPTIKRMGRPRKVVANV* |
Ga0114974_102218491 | 3300009183 | Freshwater Lake | MKGHQGYVRVDEPEVTIESETRTDTAFAPVMPTIKRMGRPRKV |
Ga0114976_101929471 | 3300009184 | Freshwater Lake | GHQGYVRVDEPEVTIESVESELRTDTAFAPVIPSIKRMGRPRKVANV* |
Ga0114976_104630803 | 3300009184 | Freshwater Lake | KGHQGYVRVDEPEVTIESETRTDTAFAPVMPTIKRMGRPRKVANV* |
Ga0114976_105288581 | 3300009184 | Freshwater Lake | KGHQGYVRVDEPEVTIESETRTDTAFAPVMPTIKRMGRPRKVVNG* |
Ga0157613_11842441 | 3300012720 | Freshwater | QGYMRIDEPEVTIESDDSVRTDTAFRAPVIPTIKRMGRPRKVVNV* |
Ga0164294_111567091 | 3300013006 | Freshwater | MEGHQGYVLVDEPEVTIESVESETKTDTAFAPVIPTIKRMGRPRKVANV* |
Ga0170791_158115192 | 3300013295 | Freshwater | MKGHQGYVRIDEPEVTIESVESETRTDTAFAPVIPTFRKMGR |
Ga0177922_105621341 | 3300013372 | Freshwater | MKGHQGYVRIDEEEVTIESLDSERTDTAFAPVIPTIK |
Ga0177922_105773927 | 3300013372 | Freshwater | HQGYVRIDEAEVTTESETRTDTAFAPVIPTMKRMGRPRKVANV* |
Ga0177922_107311882 | 3300013372 | Freshwater | MKSHQGYVRIDEAEVTTESETRTDTAVAPVIPTMKRMGRPR |
Ga0177922_111924081 | 3300013372 | Freshwater | IDEPEVTTESVESETRTDTAFAPVIPTFKRMGRPRKVANV* |
Ga0181338_10461521 | 3300015050 | Freshwater Lake | VRIDEPEVTIESVDSERTDTAFAPVIPTIKRMGRPRKVANV* |
Ga0181339_10368443 | 3300017700 | Freshwater Lake | VTIESVDSERTDTAFRAPVIPTIKRMGRPRKVANV |
Ga0181364_10497911 | 3300017701 | Freshwater Lake | RGHQGYVRVDEPEVTIESEVRTDTAFRAPVIPTIKRMGRPRKVANG |
Ga0181350_10757391 | 3300017716 | Freshwater Lake | YVRLEEPEVTIESVESDTRTDTAFAPVIKRMGRPRKVANV |
Ga0181362_10583991 | 3300017723 | Freshwater Lake | MRGHQGYVRVDEPEVTIESEVRTDTAFRAPVIPTIKRMGRPRKVANG |
Ga0181365_11474871 | 3300017736 | Freshwater Lake | EPEVTIESEVRTDTAFRAPVIPTIKRMGRPRKVANG |
Ga0181358_11870591 | 3300017774 | Freshwater Lake | GYELVDEEEVTIESVNSMRTDTAFAPVIPTIKRMGRLRKVANV |
Ga0181357_11618191 | 3300017777 | Freshwater Lake | VRVDEPEVTIESEVRTDTAFRAPVIPTIKRMGRPRKVANG |
Ga0181357_12767491 | 3300017777 | Freshwater Lake | RVEEPEVTIESVESETRTDTAFAPVIKRMGRPRKVANG |
Ga0181346_11090781 | 3300017780 | Freshwater Lake | HQGYVRVDEPEVTIESETRTDTAFRAPVIPTIKRMGRPRKVANG |
Ga0181348_12263841 | 3300017784 | Freshwater Lake | GHQGYVRVEEPEVTIESVESETRTDTAFAPVIKRMGRPRKVANV |
Ga0181355_13588033 | 3300017785 | Freshwater Lake | YVRIDEPEVTIESVDSERTDTAFAPVIPTIKRMGRPRKVANV |
Ga0181553_107625251 | 3300018416 | Salt Marsh | EVTIESVESETRTDTAFAPVIPTFKRMGRPRQVANV |
Ga0181563_105690323 | 3300018420 | Salt Marsh | QGYVRIDEVEVTIESKNSVRTDTAFTAPVIPTIKRLGRPRKEYVGH |
Ga0181359_11484201 | 3300019784 | Freshwater Lake | YVRVEEPEVTIESVESETRTDTAFAPVMPTIKRMGRPRKVVNG |
Ga0181359_11527074 | 3300019784 | Freshwater Lake | QGYVRVDEPEVTIESVESETRTDTAFAPVIKRMGRPRKVANG |
Ga0181359_12120111 | 3300019784 | Freshwater Lake | SMRGHQGYVRVDEPEVTIESEVRTDTAFRAPVIPTIKRMGRPRKVANG |
Ga0222715_102162561 | 3300021960 | Estuarine Water | AEVTTESVESETRTDTAFAPVIPTFKRMGRPRKVANV |
Ga0181354_10744245 | 3300022190 | Freshwater Lake | NEPEVTTESVESEIRTDTAFAPVIPTFKRMGRPRKVANV |
Ga0181351_11409125 | 3300022407 | Freshwater Lake | IDEPEVTIESVNSERTDTAFAPVIPTIKRMGRPRKVENV |
Ga0181351_11515405 | 3300022407 | Freshwater Lake | GYVRVDEPEVTIESQTRTDTAFAPVIPTFKRMGRPRKVANV |
Ga0181351_12644493 | 3300022407 | Freshwater Lake | QGYVRVDEPEVTIESEIRTDTAFRAPVIPTIKRMGRPRKVANG |
Ga0181351_12793811 | 3300022407 | Freshwater Lake | YELIDEEEVTIESVNSMRTDTAFAPVIPTIKRMGRPRKVANG |
Ga0214919_104808233 | 3300023184 | Freshwater | HHGYVRIDEPEVTIESETRTDTAFRAPVIPTIKRMGRPRKVANV |
Ga0255148_10599581 | 3300024306 | Freshwater | GYVRVDEVEVTIESVESEIRTDTAFRAPVIPTIKRMGRPRKVALNV |
Ga0255144_10428573 | 3300024513 | Freshwater | VEVTIESVESEIRTDTAFRAPVIPTIKRMGRPRKVALNV |
Ga0256299_11028503 | 3300024533 | Freshwater | GYVRIDEAEVTTESVESETRTDTAFAPVIPTFKRMGRPRKVANV |
Ga0256336_11091961 | 3300024562 | Freshwater | RIDEVEVTIESKNSVRTDTAFTAPVIPTIKRLGRPRKEYVGH |
Ga0208147_11093721 | 3300025635 | Aqueous | EVTIESVESEIRTDTAFRAPVIPTIKRMGRPRKVVANV |
Ga0208916_102637823 | 3300025896 | Aqueous | VRVDEPEVTIESVESEIRTDTAFTAPVIPTIKRMGRPRKAENVGS |
Ga0208916_103819093 | 3300025896 | Aqueous | GHQGYVRIDEPEVTIESETRTDTAFAPVIPTFKRMGRPRKVANV |
Ga0255069_10010901 | 3300027134 | Freshwater | RIDEAEVTTESVESETRTDTAFAPVIPTFKRMGRPRKVANV |
Ga0255102_10807551 | 3300027144 | Freshwater | GHQGYVRVDEPEVTIESEVRTDTAFRAPVIPTIKRMGRPRKVANG |
Ga0255133_10207811 | 3300027368 | Freshwater | PEVTIESYDSVRTDTAFRAPVIPTIKRMGRPRKVVNV |
Ga0208975_10313831 | 3300027659 | Freshwater Lentic | EPEVTIESVDSERTDTAFAPVIPTIKRMGRPRKVENV |
Ga0209443_11414601 | 3300027707 | Freshwater Lake | DSMRGHQGYVRVDEPEVTIESEVRTDTAFRAPVIPTIKRMGRPRKVANG |
Ga0209087_11286855 | 3300027734 | Freshwater Lake | VDEPEITIESVESETRTDTAFRAPVIPTIKRMGRPRKVVANV |
Ga0209087_11825291 | 3300027734 | Freshwater Lake | EPEVTTESVESETRTDTAFAPVIPTFRKMGRPRKVANV |
Ga0209087_12489773 | 3300027734 | Freshwater Lake | KGHQGYVRVDEPEVTIESETRTDTAFAPVMPTIKRMGRPRKVANV |
Ga0209190_11209676 | 3300027736 | Freshwater Lake | HQGYVRVDEPEVTIESETRTDTAFAPVMPTIKRMGRPRKVANG |
Ga0209596_10794378 | 3300027754 | Freshwater Lake | VRVDEPEVTIESETRTDTAFAPVMPTIKRMGRPRKIANG |
Ga0209596_11350276 | 3300027754 | Freshwater Lake | DEPEVTIESEIRTDTAFRAPVIPTIKRMGRPRKVANG |
Ga0209444_102075381 | 3300027756 | Freshwater Lake | MKGHQGYVRVEEPEVTIESVESETKTDTAFAPVIKRMGRPRKVANG |
Ga0209296_12448811 | 3300027759 | Freshwater Lake | EVTIESVESEVKTDTAFRAPVIPTIKRMGRPRKVANV |
Ga0209598_101178085 | 3300027760 | Freshwater Lake | HQGYIRVDEPEITIESDNSVRTDTAFAPVIPTIKRLGRPRKVANV |
Ga0209246_102216931 | 3300027785 | Freshwater Lake | GHQGYVRIDEPEVTTESVESETRTDTAFAPVIPTFKRMGRPRKVANV |
Ga0209353_101338781 | 3300027798 | Freshwater Lake | MKGHQGYVRVDEPEVTIESVESDTRTDTAFAPVIKRMGRPRKVANG |
Ga0209353_102492381 | 3300027798 | Freshwater Lake | PEVTIESEVRTDTAFRAPVIPTIKRMGRPRKVANG |
Ga0209353_102779661 | 3300027798 | Freshwater Lake | GYVRIDEPEVTTESVESETRTDTAFAPVIPTFKRMGRPRKVANV |
Ga0209354_101106006 | 3300027808 | Freshwater Lake | HQGYVRIDEPEVTIESVDSERTDTAFAPVIPTIKRMGRPRKVENV |
Ga0209191_13335171 | 3300027969 | Freshwater Lake | VLVDEEVTIESVESETRTDTAFAPVIPTIKRMGRPRKVANV |
Ga0209299_100804311 | 3300027974 | Freshwater Lake | VTIESHDSVRTDTAFRAPVIPTIKRLGRPRKVVNV |
Ga0315291_104278431 | 3300031707 | Sediment | RVDEPEVTIESEIRTDTAFRAPVIPTIKRMGRPRKVANG |
Ga0315909_107135721 | 3300031857 | Freshwater | GYVRIDEAEVTKESVESEVRTDTAFRAPVIPTIKRMGRPRKVVNV |
Ga0315294_102372079 | 3300031952 | Sediment | MKGHQGYVRVDEPEVTIESETRTDTAFAPVMPTIKRMGRPRKVVNG |
Ga0315294_114325903 | 3300031952 | Sediment | EPEVTIESEIRTDTAFRAPVIPTIKRMGRPRKVANG |
Ga0315278_110866145 | 3300031997 | Sediment | MRGHQGYVRVDEPEVTIESEIRTDTAFRAPVIPTIKRMGRPRKVANG |
Ga0315274_117539131 | 3300031999 | Sediment | VRIDEPEVTTESVESETRTDTAFAPVIPTFKRMGRPRKVANV |
Ga0315289_112187641 | 3300032046 | Sediment | GHQGYVRVDEPEVTIESEIRTDTAFRAPVMPTIKRMGRPRKVTNG |
Ga0315295_105833716 | 3300032156 | Sediment | GYVRVDEPEVTIESEIRTDTAFRAPVIPTIKRMGRPRKVANG |
Ga0315295_122669891 | 3300032156 | Sediment | KGHQGYVRVDEPEVTIESEVRTDTAFRAPVIPTIKRMGRPRKVANG |
Ga0315270_111538001 | 3300032275 | Sediment | RGHQGYVRVDEPEVTIESEIRTDTAFRAPVIPTIKRMGRPRKVANG |
Ga0334982_0008547_2724_2873 | 3300033981 | Freshwater | MEGHQGYVLVDEPEVTIESVESETRTDTAFAPVIPTIKRMGRPRKVANV |
Ga0335027_0413173_3_140 | 3300034101 | Freshwater | QGYVRVDEPEVTIESHDSVRTDTAFRAPVIPTIKRMGRPRKVVNV |
Ga0335031_0629178_520_627 | 3300034104 | Freshwater | EVTIESVDSERTDTAFAPVIPTIKRMGRPRKVANV |
Ga0335060_0491578_519_632 | 3300034122 | Freshwater | PEVTIESHDSVRTDTAFRAPVIPTIKRMGRPRKVVNV |
⦗Top⦘ |