 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F104711 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MKRKEEQKLVKLLKSLYGKNWLFNWQGQDNGFELNLQVWKGKK |
| Number of Associated Samples | 77 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 40.00 % |
| % of genes near scaffold ends (potentially truncated) | 42.00 % |
| % of genes from short scaffolds (< 2000 bps) | 94.00 % |
| Associated GOLD sequencing projects | 67 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (91.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (32.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (84.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (88.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.56% β-sheet: 9.30% Coil/Unstructured: 58.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF07878 | RHH_5 | 2.00 |
| PF13185 | GAF_2 | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 91.00 % |
| All Organisms | root | All Organisms | 9.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 32.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 22.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 15.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 8.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.00% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 5.00% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.00% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.00% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.00% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004794 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012763 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140108_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013133 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2 | Environmental | Open in IMG/M |
| 3300013136 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.5m | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25908J49247_100395822 | 3300003277 | Freshwater Lake | MKRKEEQKLVKLLKSLYGKDWLFNWQGQDNGFELTVQVWKGKK* |
| JGI25909J50240_10522162 | 3300003393 | Freshwater Lake | MKKQEEQKLVKLLKALYKKNWAFDWKGQDNGFELNLQVWKGKK* |
| JGI25911J50253_101083723 | 3300003411 | Freshwater Lake | MKRKEEQKLVKLLKSLYGKDWLFNWQGQDNGFELTVQVWK |
| Ga0007787_105725582 | 3300004240 | Freshwater Lake | MKKQEEQKLVKLLKALYKKNWAFNWKGQDNGFELNLQVWKGKK* |
| Ga0007751_100444092 | 3300004794 | Freshwater Lake | MKRKEEQKLVKLLKSLYGKDWLFNWQGQDNGFELNLQVWKGKK* |
| Ga0070374_100631344 | 3300005517 | Freshwater Lake | MTRKDENKLVSLLKKLYGKDWSFNWKGQNNGFELILQVWKGKK* |
| Ga0049081_100872393 | 3300005581 | Freshwater Lentic | MKKLEEQKLVKLLKSLYGKNWLFNWQGQDNGFELNLQVWKGKK* |
| Ga0049081_101827071 | 3300005581 | Freshwater Lentic | MKKREEQKLVKLLKSLYGKNWLFNWQGQDNGFELNLQVWKGKK* |
| Ga0049082_102355032 | 3300005584 | Freshwater Lentic | MKRKEEQKLVKLLKSLYGKNWLFNWQGQDNGFELTLQVWKGKNE* |
| Ga0079957_12244942 | 3300005805 | Lake | MKKTDEQKLIKLLKSLYGKNWLFNWQGQDNGFELTLQVWKGKK* |
| Ga0075464_103175503 | 3300006805 | Aqueous | MKKLEEQKLVKLLKSLYGKNWLFNWQGQDNGFELNLQVWKGKK*KAHFIF* |
| Ga0075464_109075762 | 3300006805 | Aqueous | MKKREEQKLVKLLKSLYGKNWLFNWQGQDNGFELT |
| Ga0114880_12423151 | 3300008450 | Freshwater Lake | MKRKEEQKLVKLLKSLYGKYWLFNWQGQDNGFELTVQVWKEKK* |
| Ga0114973_101254514 | 3300009068 | Freshwater Lake | MTKKEETKLVSLLKRLYKKDWSFNWKGQDNGFELTLQVWKGKK* |
| Ga0114973_101861482 | 3300009068 | Freshwater Lake | MKRKEEQKLVKLLKSLYGKNWLFNWQGQDNGFELNLQVWK |
| Ga0114973_103859362 | 3300009068 | Freshwater Lake | MKRKEEQKLVKLLKSLYGKNWLFNWQGQDNGFELNLQVWKGKK* |
| Ga0114980_102333391 | 3300009152 | Freshwater Lake | QKLVKLLKSLYGKNWLFNWQGQDNGFELNLQVWKGKK* |
| Ga0114963_101500063 | 3300009154 | Freshwater Lake | MTKKDEAKLVKLLKSLYKKNWAFNWKGQDNGFELTLNVWKGKL* |
| Ga0114963_105525173 | 3300009154 | Freshwater Lake | MTKKDEAKLVKLLKTLYKKNWAFNWKGQDNGFELTLNVWKGKL* |
| Ga0114968_103762873 | 3300009155 | Freshwater Lake | EEQKLVKLLKSLYGKNWLFNWQGQDNGFELNLQVWKGKK* |
| Ga0114966_106668862 | 3300009161 | Freshwater Lake | MKKQEEKKLVKLLKSLYGKNWLFNWKGQDNGFELNL |
| Ga0114974_102417834 | 3300009183 | Freshwater Lake | MTKKEETKLVSLLKKLYKKDWSFNWKGQDNGFELTLQVWKGKK* |
| Ga0114976_103734593 | 3300009184 | Freshwater Lake | MKRKEEQKLVKLLKSLYGKNWLFNWQGQDNGFELNLQV |
| Ga0114972_107548572 | 3300009187 | Freshwater Lake | MKRKEEQKLVKLLKSLYGKNWLFNWQGQDNGFELNLQ |
| Ga0136644_102542262 | 3300010334 | Freshwater Lake | MTKKDEAKLVKLLKTLYKKNWAFNWKGQDNGFELTLNVWK |
| Ga0129333_109167171 | 3300010354 | Freshwater To Marine Saline Gradient | MKKTDEQKLIKLLKSLYGKNWLFNWQGQDNGFELILQVWKGKK* |
| Ga0129336_101917972 | 3300010370 | Freshwater To Marine Saline Gradient | MKKQEEKKLVKLLKSLYGKNWLFNWKGQDNGFELNLQVWKGKK* |
| Ga0133913_133921641 | 3300010885 | Freshwater Lake | MKRKEEQKLVKLLKSLYGKDWLFNWQGQDNGFELTVQVWKEKK* |
| Ga0138289_12225933 | 3300012763 | Freshwater Lake | MTKKEETKLVSLLKKLYKKDWSFNWKGQDNGFELNLQVWKGKK* |
| Ga0164293_100868283 | 3300013004 | Freshwater | MKKKEELKLVKLLKSLYGKNWLFNWQGQDNGFELTLQVWKGKK* |
| Ga0164292_109311521 | 3300013005 | Freshwater | MKKLEEQKLVKLLKSLYGKNWLFNWQGQDNGFELNLQVW |
| (restricted) Ga0172367_101721661 | 3300013126 | Freshwater | MKKTDEQKLVKLLKSLYGKNWLFNWRGQDNGFELTLQVWKGKKCTN* |
| (restricted) Ga0172367_104267351 | 3300013126 | Freshwater | MKKKDEQKLVKLLKSLYGKNWLFNWQGQDNGFALTLQVWKGKK* |
| (restricted) Ga0172373_103539522 | 3300013131 | Freshwater | MKKKEEQKLVNLLKSLYGKNWLFNWRGQDNGFELTLQVWKGKKCTN* |
| (restricted) Ga0172373_109379201 | 3300013131 | Freshwater | MMKKKDEQKLVKLLKSLYGKNWLFNWKGQDNGFELILNVRKG* |
| (restricted) Ga0172372_103733082 | 3300013132 | Freshwater | MKKKEEQKLVNLLKSLYGKNWLFNWRGQDNGFELTLQVWKGKK* |
| (restricted) Ga0172362_104169962 | 3300013133 | Sediment | MKKKEEQKLVKLLKSLYGKKWLFNWQGQDNGFALTLQVWKGKK* |
| (restricted) Ga0172370_103022751 | 3300013136 | Freshwater | DEQKLVKLLKSLYGKNWLFNWKGQDNGFELILNVKKG* |
| Ga0170791_151826341 | 3300013295 | Freshwater | KLVKLLKSLYGKNWLFNWQGQDNGFELNLQVWKGKK* |
| Ga0170791_152063081 | 3300013295 | Freshwater | NKGKTMKKQEEQKLVKLLKALYKKNWAFDWKGQDNGFELNLQVWKGKK* |
| Ga0177922_105983991 | 3300013372 | Freshwater | TDEQKLVKLLKSLYGKNWLFNWQGQDNGFELTLQVWKGKK* |
| Ga0177922_106650981 | 3300013372 | Freshwater | MKKQEEQKLVKLLKALYKKNWAFDWKGQDNGFELN |
| Ga0181362_10423911 | 3300017723 | Freshwater Lake | EEQKLVKLLKSLYGKDWLFNWQGQDNGFELTVQVWKGKK |
| Ga0181362_10632711 | 3300017723 | Freshwater Lake | QNKGRKMKKQEEQKLVKLLKALYKKNWAFDWKGQDNGFELNLQVWKGKK |
| Ga0181362_10664552 | 3300017723 | Freshwater Lake | MKRKEEQKLVKLLKSLYGKNWLFNWQGQDNGFELT |
| Ga0181362_10673582 | 3300017723 | Freshwater Lake | MKRKEEQKLVKLLKSLYGKDWLFNWQGQDNGFELTVQVWKGKKXK |
| Ga0181365_10638321 | 3300017736 | Freshwater Lake | MKKLEEQKLVKLLKSLYGKDWLFNWQGQDNGFELTV |
| Ga0181356_11139843 | 3300017761 | Freshwater Lake | MTRKDENKLVSLLKKLYGKDWSFNWKGQNNGFELI |
| Ga0181356_11218241 | 3300017761 | Freshwater Lake | MKKQAEQKLVKLLKSLYGKNWLFNWQGQDNGFELTVQVW |
| Ga0181356_11359473 | 3300017761 | Freshwater Lake | MKKQEEQKLVKLLKALYKKNWAFDWKGQDNGFELNLQV |
| Ga0181358_12138741 | 3300017774 | Freshwater Lake | TMKRKEEQKLVKLLKSLYGKYWLFNWQGQDNGFELTLQVWKGKNE |
| Ga0181357_12855094 | 3300017777 | Freshwater Lake | MKKKEEQKLIKLLKSLYGKNWLFNWQGQDNGFELNLQVWKGKNE |
| Ga0181348_12553202 | 3300017784 | Freshwater Lake | MKRKEEQKLVKLLKSLYGKNWLFNWQGQDNGFELTVQVWKGKKXK |
| Ga0181348_12952361 | 3300017784 | Freshwater Lake | QRKTMKRKEEQKLVKLLKSLYGKDWLFNWQGQDKGFELNLQVWKGKK |
| Ga0181348_12967601 | 3300017784 | Freshwater Lake | RKTMKRKEEQKLVKLLKSLYGKDWLFNWQGQDNGFELTVQEWKEKK |
| Ga0169931_109849551 | 3300017788 | Freshwater | KKEEQKLVNLLKSLYGKNWLFNWRGQDNGFELTLQVWKGKKCTN |
| Ga0181359_10917992 | 3300019784 | Freshwater Lake | MKKQEEQKLVKLLKALYKKNWAFNWKGQDNGFELNLQVWKGKK |
| Ga0181359_11150252 | 3300019784 | Freshwater Lake | MKKQEEQKLVKLLKALYKKNWAFDWKGQDNGFELNLQVWKGKK |
| Ga0181359_11417672 | 3300019784 | Freshwater Lake | MKKREEQKLVKLLKSLYGKNWLFNWQGQDNGFELNLQVWKGKK |
| Ga0181359_12069143 | 3300019784 | Freshwater Lake | MTRKDENKLVSLLKKLYGKDWSFNWKGQNNGFELILQVWKGKK |
| Ga0194113_100461463 | 3300020074 | Freshwater Lake | MKRKDEQKLVKLLKSLYGKNWLFNWKGQDNGFELILNVWKG |
| Ga0194113_101272556 | 3300020074 | Freshwater Lake | MKKKDENKLVKLLKKLYGNDWSFTWDSQDHGFNLNLQVWKGEKYNDKR |
| Ga0194112_1002477215 | 3300020109 | Freshwater Lake | MKKKDEQKLVKLLKSLYGKNWLFNWKGQDNGFELILNVWKG |
| Ga0211736_108490192 | 3300020151 | Freshwater | MKKQEEQKLVKLLKALYKKNWAFDWKGQDNGFELNLQVWKGKKXKTHSIF |
| Ga0211726_100357523 | 3300020161 | Freshwater | MKKQEEQKLVKLLKALYKKNWAFDWKGQDNGFELNLQVWK |
| Ga0194115_102381623 | 3300020183 | Freshwater Lake | MKKKEEQKLVKLLKSLYGKNWLFNWQGQDNGFALTLQVWKGKK |
| Ga0194115_103537651 | 3300020183 | Freshwater Lake | MKKKEEQKLVNLLKSLYGKNWLFNWRGQDNGFALTLQVWKGKK |
| Ga0194130_102130432 | 3300021376 | Freshwater Lake | MKKKDEQKLVKLLKSLYGKNWFFNWRGQDNGFELTLQVSKERKL |
| Ga0194117_103048022 | 3300021424 | Freshwater Lake | MKKKDEQKLVKLLKSLYGKNWFFNWKGQDNGFELILNVMKKGK |
| Ga0181354_11501643 | 3300022190 | Freshwater Lake | MKRKEEQKLVKLLKSLYGKDWLFNWQGQDNGFELTVQVWKGKK |
| Ga0181354_11627282 | 3300022190 | Freshwater Lake | MKRKEEQKLVKLLKSLYGKDWLFNWQGQDNGFELTVQVWKEKK |
| Ga0181354_12393372 | 3300022190 | Freshwater Lake | MTKKEETKLISLLKKLYGKDWSFNWKGQDNGFELILQVWKGKNE |
| Ga0181351_12004892 | 3300022407 | Freshwater Lake | MKRKEEQKLVKLLKSLYGKYWLFNWQGQDNGFELTVQVWKGKK |
| Ga0214917_100834032 | 3300022752 | Freshwater | MKKREEQKLVKLLKSLYGKNWLFNWQGQDNGFELTLQVWKGKKXKVHFIF |
| Ga0214923_103450953 | 3300023179 | Freshwater | TMKRKEEQKLVKLLKSLYGKNWLFNWQGQDNGFELNLQVWKGKK |
| Ga0208916_101280962 | 3300025896 | Aqueous | MKKLEEQKLVKLLKSLYGKNWLFNWQGQDNGFELNLQVWKGKK |
| Ga0208974_10521484 | 3300027608 | Freshwater Lentic | MKKREEQKLVKLLKSLYGKNWLFNWQGQDNGFELNLQVWKGKKXKAHFIF |
| Ga0208975_12039192 | 3300027659 | Freshwater Lentic | KQEEQKLVKLLKALYKKNWAFDWKGQDNGFELNLQVWKGKK |
| Ga0209769_12482942 | 3300027679 | Freshwater Lake | MKRKEEQKLVKLLKSLYGKDWLFNWQGQDNGFELNLQVWKGKK |
| Ga0209443_11499742 | 3300027707 | Freshwater Lake | MTRKEENKLVSLLKKLYGKDWSFNWKGQNNGFELILQVWKGKK |
| Ga0209297_11366024 | 3300027733 | Freshwater Lake | MKKLEEQKLVKLLKSLYGKNWLFNWQGQDNGFELNLQVWKGKKXKAHFIF |
| Ga0209087_11593092 | 3300027734 | Freshwater Lake | MKRKEEQKLVKLLKSLYGKNWLFNWQGQDNGFELNLQVWKGKK |
| Ga0209085_11231871 | 3300027741 | Freshwater Lake | MTKKDEAKLVKLLKTLYKKNWAFNWKGQDNGFELTLNVW |
| Ga0209355_12293652 | 3300027744 | Freshwater Lake | MKRKEEQKLVKLLKSLYGKDWLFNWQGQDNGFELTVQVWKGKKXKAHSI |
| Ga0209296_10587972 | 3300027759 | Freshwater Lake | MTKKEETKLVSLLKKLYKKDWSFNWKGQDNGFELTLQVWKGKK |
| Ga0209598_101179432 | 3300027760 | Freshwater Lake | MKKLEEKKLVKLLKSLYGKNWLFNWQGQDNGFELNLQVWKGKKXKAHFIF |
| Ga0209829_101730641 | 3300027777 | Freshwater Lake | MTKKDEAKLVKLLKTLYKKNWAFNWKGQDNGFELTLNVWKGKLXK |
| Ga0209358_103160284 | 3300027804 | Freshwater Lake | QKLVKLLKSLYGKNWLFNWQGQDNGFELNLQVWKGKK |
| Ga0209550_101017994 | 3300027892 | Freshwater Lake | MKKQEEQKLVKLLKALYKKNWAFDWKGQDNGFELNLQVWKGKKXLKQKNKY |
| Ga0209400_12053222 | 3300027963 | Freshwater Lake | MKRKEEQKLVKLLKSLYGKNWLFNWQGQDNGFELNLQVWKGK |
| Ga0209401_12976032 | 3300027971 | Freshwater Lake | EEKKLVKLLKSLYGKNWLFNWQGQDNGFELNLQVWKGKK |
| (restricted) Ga0247834_12431532 | 3300027977 | Freshwater | MKKQDEQKLVKLLKALYKKNWAFDWKGQDNGFELTLQVWKGKK |
| (restricted) Ga0247843_12412011 | 3300028569 | Freshwater | MTKKEETKLAGLLKKLYGKDWSFNWKGQNNGFELILQVWKGKK |
| Ga0315293_104089772 | 3300031746 | Sediment | MTKKDETKLISLLKKLYGKDWSFNWKGQDNGFELTLQVWKGKK |
| Ga0315909_108249791 | 3300031857 | Freshwater | MKKREEQKLVKLLKSLYGKNWLFNWQGQDNGFELNLQVWKGKKXKAH |
| Ga0315274_102141385 | 3300031999 | Sediment | MKRKEEQKLVKLLKSLYGKDWLFNWQGQDNGFELTVQVWKGKKXKAHFIF |
| Ga0315905_112700272 | 3300032092 | Freshwater | MKRKEEQKLVKLLKSLYGKDWLFNWQGQDNGFELNLQV |
| Ga0315295_116873442 | 3300032156 | Sediment | MKRKEEQKLVKLLKSLYGKNWLFNWQGQDNGFELTVQVWKGKK |
| Ga0335036_0456211_331_474 | 3300034106 | Freshwater | MTKKEETKLISLLKKLYGKDWSFNWKGQENGFELILQVWKGKNEKSI |
| Ga0335065_0389660_749_856 | 3300034200 | Freshwater | LVSLLKKLYGKNWSFNWKGQNNGFELILQVWKGKK |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |