| Basic Information | |
|---|---|
| Family ID | F104624 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 45 residues |
| Representative Sequence | IAGLRVWGNWKIGENVLKVFLRLRGSANRRVDLFLPLIASISGRRQ |
| Number of Associated Samples | 58 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 1.00 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 45 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (99.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (75.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (69.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (92.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 60.87% β-sheet: 0.00% Coil/Unstructured: 39.13% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF02371 | Transposase_20 | 19.00 |
| PF01548 | DEDD_Tnp_IS110 | 11.00 |
| PF00210 | Ferritin | 2.00 |
| PF04023 | FeoA | 2.00 |
| PF07394 | DUF1501 | 1.00 |
| PF01972 | SDH_sah | 1.00 |
| PF01988 | VIT1 | 1.00 |
| PF01229 | Glyco_hydro_39 | 1.00 |
| PF12631 | MnmE_helical | 1.00 |
| PF02742 | Fe_dep_repr_C | 1.00 |
| PF01663 | Phosphodiest | 1.00 |
| PF00083 | Sugar_tr | 1.00 |
| PF01370 | Epimerase | 1.00 |
| PF07638 | Sigma70_ECF | 1.00 |
| PF00834 | Ribul_P_3_epim | 1.00 |
| PF13646 | HEAT_2 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 30.00 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 2.00 |
| COG1918 | Fe2+ transport protein FeoA | Inorganic ion transport and metabolism [P] | 2.00 |
| COG0036 | Pentose-5-phosphate-3-epimerase | Carbohydrate transport and metabolism [G] | 1.00 |
| COG1321 | Mn-dependent transcriptional regulator MntR, DtxR family | Transcription [K] | 1.00 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.00 |
| COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 1.00 |
| COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 1.00 |
| COG3664 | Beta-xylosidase | Carbohydrate transport and metabolism [G] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 99.00 % |
| All Organisms | root | All Organisms | 1.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300032160|Ga0311301_10099086 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera borealis | 5722 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 75.00% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 7.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.00% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300003293 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 44 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300003295 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 67 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300003296 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 41 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300003298 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 42 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300004477 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004596 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 37 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004955 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 78 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004964 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 77 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300006860 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 63 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010164 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 61 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011059 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 44 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011086 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 49 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011109 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 18 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300025439 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300026945 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 55 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J35102_1204050181 | 3300002568 | Soil | MKFIAGLRVWGMWGSQANILKVFLRLRSPANRRVDLHLPLIASIPKSGLSR |
| JGI26339J46600_100247542 | 3300003218 | Bog Forest Soil | MKFIAGLRVWGNWGIGENVLKVFLRLRGSANRRVDLFLPLIASIXTGPSHLSPGLRQAGTLGTNQS |
| JGI26339J46600_100256951 | 3300003218 | Bog Forest Soil | MKFIAGLRVWGNWGIGENVLKVFLRLRGSANRRVDLFLPLIASISAGALRLRRVSPTA |
| JGI26341J46601_100329171 | 3300003219 | Bog Forest Soil | MKFIAGLRVWGNWGIGENVLKVFLRLRGSANRRVDLFLPLIASIXXL |
| Ga0006843J48913_1085221 | 3300003293 | Peatlands Soil | MKFIAGLRVWGNWKIGENVLKVFLRLRGSANRRVDLFLPLIASILA |
| Ga0006866J48919_1092691 | 3300003295 | Peatlands Soil | MKFIAGLRVWGNWEIGENVLKVFLRLRGSANRRVDLFLPLIASI |
| Ga0006840J48914_1024551 | 3300003296 | Peatlands Soil | MKFIAGLRVWGNWKIGENVLKVFLRLRGSANRRVDLFLPLIASISGRR |
| Ga0006841J48915_1028611 | 3300003298 | Peatlands Soil | MKFIAGLRVWGNWEIGENVLKVFLRLRGSANRRVDLFLPLIASISGRRQG |
| JGI26340J50214_100278762 | 3300003368 | Bog Forest Soil | MKFIAGLRVWGNWGIGENVLKVFLRLRGSANRRVDLFLPLIASIFTGPSYLSP |
| Ga0068971_10227651 | 3300004477 | Peatlands Soil | VWGNWGIGENVLKVFLRFRGSANRRVDLFLPLIASISGRRQ* |
| Ga0068971_10263693 | 3300004477 | Peatlands Soil | AGLRVWGNWEIGENVLKVFLRFRGSANRRVDLFLPLIASIFGCNLKSGKR* |
| Ga0068949_10038431 | 3300004596 | Peatlands Soil | MKFIAGLRVWGNWKIGENVLKVFLRLRGSANRRVDLFLPLIAS |
| Ga0072332_1931401 | 3300004955 | Peatlands Soil | MKFIAGLRVWGNWKIGENVLKVFLRLRGSANRRVDLFLPLIA |
| Ga0072331_11769902 | 3300004964 | Peatlands Soil | MKFIAGLRVWGNWEIGENVLKVFLRLRGSANRRVDLFLPLIASISGRRQ* |
| Ga0063829_10065502 | 3300006860 | Peatlands Soil | MKFIAGLRVWGNWEIGENVLKVFLRFRGSANRRVDLFLPLIASIFGCNLKSGKR* |
| Ga0116108_11383941 | 3300009519 | Peatland | MKFIAGLRVWGNWEIGENVLKVFLRLRGSANRRVDLFLPLIASISGRRL* |
| Ga0116214_10567521 | 3300009520 | Peatlands Soil | IVGLRVWGNWGIGENVLKVFLRFRGSANRRVDLFLPLIASILGCNLIYHSG* |
| Ga0116214_11581502 | 3300009520 | Peatlands Soil | WGNWGIGENVLKVFLRFRGSANRRVDLFLPLIASISGRRQGT* |
| Ga0116214_12424511 | 3300009520 | Peatlands Soil | NWEIGENVLKVFLRLRGSANRRVDLFLPLIASIPSRRQ* |
| Ga0116214_13783311 | 3300009520 | Peatlands Soil | IAGLRVWGNWEIGENVLKVFLRLRGSANRRVDLFLPLIASIGKLGRWRVAGGPRSA* |
| Ga0116222_11760451 | 3300009521 | Peatlands Soil | WGNWKIGENVLKVFLRLRGSANRRVDLFLPLIASISGRRQ* |
| Ga0116222_12116341 | 3300009521 | Peatlands Soil | NWGIGENVLKVFLRFRGSANRRVDLFLPLIASISGRRQGT* |
| Ga0116218_10339723 | 3300009522 | Peatlands Soil | AGLRVWGNWKIGENVLKVFLRLRGSANRRVDLFLPLIASIFGCNLKSGKR* |
| Ga0116218_10635362 | 3300009522 | Peatlands Soil | MKFIAWLRVWGNWGILENVLKVFLRLRGSANRRVDLFLPLIASNLR* |
| Ga0116218_12349033 | 3300009522 | Peatlands Soil | GENVLKVFLRLRGSANRRVDLFLPLIASISGRQL* |
| Ga0116218_12908901 | 3300009522 | Peatlands Soil | VWGNWEIGENVLKVFLRLRGSANRRVDLFLPLIASIPSRRQ* |
| Ga0116221_11404231 | 3300009523 | Peatlands Soil | AGLRVWGNWKIGENVLKVFLRLRGSANRRVDLFLPLIASIPGRRQ* |
| Ga0116221_13585171 | 3300009523 | Peatlands Soil | WKIGENVLKVFLRLRGSANRRVDLFLPLIASISGRRQ* |
| Ga0116225_11747932 | 3300009524 | Peatlands Soil | RVWGNWKIGENVLKVFLRLRGSANRRVDLFLPLIASISGRQL* |
| Ga0116225_12814881 | 3300009524 | Peatlands Soil | GNWKIGENVLKVFLRLRGSANRRVDLFLPLIASISGRRQ* |
| Ga0116225_12933341 | 3300009524 | Peatlands Soil | GNWEIGENVLKVFLRLRGSANRRVDLFLPLIASIPSRRQ* |
| Ga0116220_104585601 | 3300009525 | Peatlands Soil | RVWGNWKIGENVLKVFLRLRGSANRRVDLFLPLIASISGRRQ* |
| Ga0116215_12686881 | 3300009672 | Peatlands Soil | AGLRVWGNWEIGENVLKVFLRLRGSANRRVDLFLPLIASIPSRRQ* |
| Ga0116224_100906941 | 3300009683 | Peatlands Soil | MKFIAGLRVWGNWGILENVLKVFLRLRGSANRRVDLFLPLIASK |
| Ga0116224_103230081 | 3300009683 | Peatlands Soil | RVWGNWGIGENVLKVFLRFRGSANRRVDLFLPLIASIPSRRQ* |
| Ga0116217_105225561 | 3300009700 | Peatlands Soil | VGLRVWGNWGIGENVLKVFLRFRGSANRRVDLFLPLIASIPSRRQ* |
| Ga0116219_104276671 | 3300009824 | Peatlands Soil | LRVWGNWEIGENVLKVFLRLRGSANRRVDLFLPLIASIPSRRQ* |
| Ga0063827_1491801 | 3300010164 | Peatlands Soil | IGENVLKVFLRLRGSANRRVDLFLPLIASISGRRQ* |
| Ga0074046_103036891 | 3300010339 | Bog Forest Soil | AKLRVWGNWGIGENVLKVFLRFRGSANRRVDLFLPLIASIPGRRQ* |
| Ga0074045_100102091 | 3300010341 | Bog Forest Soil | IAGLRVWGNWEIGENVLKVFLRLRGSANRRVDLFLPLIASISGRRCEA* |
| Ga0074045_100664314 | 3300010341 | Bog Forest Soil | AGLRVWENWEIGENVLKVFLRLRGSANRRVDLFLPLIASIPGGGEDETSNG* |
| Ga0074045_102008621 | 3300010341 | Bog Forest Soil | IAKLRVWGNWGIGENVLKVFLRFRGSANRRVDLFLPLIASIPGRRQ* |
| Ga0074045_105255331 | 3300010341 | Bog Forest Soil | IAGLRVWGNWEIGENVLKVFLRLRGSANRRVDLFLPLIASITSRQQ* |
| Ga0074044_100045261 | 3300010343 | Bog Forest Soil | KLRVWGNWGIGENVLKVFLRFRGSANRRVDLFLPLIASISGWRQ* |
| Ga0074044_101149692 | 3300010343 | Bog Forest Soil | LQGLRVWGNGIRENVLKVFLMLKDSANRRVDLSLLS* |
| Ga0136449_1007931372 | 3300010379 | Peatlands Soil | MKFIAGLRVWGNRGNLENVLKVFLTLRDSANSRVDLYLPLIAS |
| Ga0136449_1030432632 | 3300010379 | Peatlands Soil | ENVLKVFLRLRGSANRRVDLFLPLIASISGGRGRNM* |
| Ga0136449_1032935661 | 3300010379 | Peatlands Soil | KIGENVLKVFLRLRGSANRRVDLFLPLIASISGRRQ* |
| Ga0136449_1046707142 | 3300010379 | Peatlands Soil | IAGLRVWGNWKIGENVLKVFLRLRGSANRRVDLFLPLIASTSGRLQ* |
| Ga0138597_10364101 | 3300011059 | Peatlands Soil | MKFIAGLRVWGNWKIGENVLKVFLRLRGSANRRVDLFLPLIASILAGRLAAGGVV |
| Ga0138564_10705631 | 3300011086 | Peatlands Soil | MKFIAGLRVWRNWGIVENVLKVFLKLRGSASRRVDLFLPLIASISGRRPRDVTSVR* |
| Ga0138539_10517001 | 3300011109 | Peatlands Soil | LRVWGNWGIGENVLKVFLRFRGSANRRVDLFLPLIASISGRRQ* |
| Ga0138539_11353151 | 3300011109 | Peatlands Soil | IGENVLKVFLRLRGSANRRVDLFLPLIASISGRQL* |
| Ga0182036_104874191 | 3300016270 | Soil | MKFIAGLRVWKNWVSPGNVLKVFLRLRGSANRRVDL |
| Ga0187801_102612401 | 3300017933 | Freshwater Sediment | MKFIAGLRVWGNWEIGENVLKVFLRLRGSANRRVDLFLPLIASISGRRQ |
| Ga0187866_10519791 | 3300018015 | Peatland | MKFIAGLRVWGNWKIGENVLKVFLRLRGSANRRVDL |
| Ga0187889_100508981 | 3300018023 | Peatland | MKFIAGLRVWGNWKIGENVLKVFLRLRGSANRRVDLFLPLIASISGRRL |
| Ga0187855_105857362 | 3300018038 | Peatland | MKFIAGLRVWRNWGIVENVLKVFLKLRGSANRRVDLSSLS |
| Ga0208323_10529001 | 3300025439 | Peatland | MKFIAGLRVWGNWEIGENVLKVFLRLRGSANRRVDLFLPLIASISG |
| Ga0208686_11268531 | 3300025500 | Peatland | MKFIAGLRVWGNWKIGENVLKVFLRLRGSANRRVDLFLPLIASISGRRQGESGQWL |
| Ga0207743_10152462 | 3300026945 | Tropical Forest Soil | MTGLRVWGNWGSLGNVLKVFLRLRGSATPRVDLHLPLIASI |
| Ga0208199_11352561 | 3300027497 | Peatlands Soil | MKFIAGLRVWGNWKIGENVLKVFLRLRGSANRRVDLFLPLIASI |
| Ga0208042_10298331 | 3300027568 | Peatlands Soil | IAGLRVWGNWKIGENVLKVFLRLRGSANRRVDLFLPLIASISGRRQ |
| Ga0208043_10033161 | 3300027570 | Peatlands Soil | RVWGNWKIGENVLKVFLRLRGSANRRVDLFLPLIASISGRRQ |
| Ga0208043_10859301 | 3300027570 | Peatlands Soil | TPMKFIAKLRVWGNWGIGENVLKVFLRFRGSANCRVDLFLPLIASI |
| Ga0208324_10395081 | 3300027604 | Peatlands Soil | MKFIAWLRVWGNWGILENVLKVFLRLRGSANRRVDLFLPLIASNC |
| Ga0208044_10593221 | 3300027625 | Peatlands Soil | FIAGLRVWGNWKIGENVLKVFLRLRGSANRRVDLFLPLIASISGRRQ |
| Ga0208044_10929711 | 3300027625 | Peatlands Soil | FIAGLRVWGNWKIGENVLKVFLRLRGSANRRVDLFLPLIASIPGRRQ |
| Ga0208044_11328381 | 3300027625 | Peatlands Soil | GNWEIGENVLKVFLRLRGSANRRVDLFLPLIASIPSRRQ |
| Ga0208827_10895441 | 3300027641 | Peatlands Soil | WKIGENVLKVFLRLRGSANRRVDLFLPLIASISGRRQ |
| Ga0208827_11471231 | 3300027641 | Peatlands Soil | MKFIAGLRVWGNWKIGENVLKVFLRLRGSANRRVDLFLPLIASIS |
| Ga0208565_10287903 | 3300027662 | Peatlands Soil | LRVWGNWKIGENVLKVFLRLRGSANRRVDLFLPLIASISGRQL |
| Ga0208565_12178931 | 3300027662 | Peatlands Soil | FIAGLRVWGNWKIGENVLKVFLRLRGSANRRVDLFLPLIASISGRRH |
| Ga0208696_11289411 | 3300027696 | Peatlands Soil | GNWGIGENVLKVFLRFRGSANRRVDLFLPLIASIPGRRQ |
| Ga0209517_100307471 | 3300027854 | Peatlands Soil | FIAGLRVWGNWKIGENVLKVFLRLRGSANRRVDLFLPLIASILGCNLIYHSG |
| Ga0209517_104155741 | 3300027854 | Peatlands Soil | IAGLRVWGNWEIGENVLKVFLRLRGSANRRVDLFLPLIASIPSRRQ |
| Ga0311334_118387271 | 3300029987 | Fen | MKFIAGLRVWGNWGSLGNILKVFLRLRGSANRRAD |
| Ga0310037_100733312 | 3300030494 | Peatlands Soil | MKFIAWLRVWGNWGILENVLKVFLRLRGSANRRVDLFLPLIAS |
| Ga0310037_101980491 | 3300030494 | Peatlands Soil | FIVGLRVWGNWGIGENVLKVFLRFRGSANRRVDLFLPLIASISGRRQGT |
| Ga0310037_104232621 | 3300030494 | Peatlands Soil | GNWKIGENVLKVFLRLRGSANRRVDLFLPLIASISGRRQ |
| Ga0316363_100071221 | 3300030659 | Peatlands Soil | GLRVWGNWKIGENVLKVFLRLRGSANRRVDLFLPLIASISGRQL |
| Ga0316363_101887401 | 3300030659 | Peatlands Soil | GNWKIGENVLKVFLRLRGSANRRVDLFLPLIASIPGRRQ |
| Ga0316363_102754141 | 3300030659 | Peatlands Soil | GLRVWGNWEIGENVLKVFLRLRGSANRRVDLFLPLIASISGRWRGARGE |
| Ga0316363_104098861 | 3300030659 | Peatlands Soil | RVWGNWKIGENVLKVFLRLRGSANRRVDLFLPLIASISGRRH |
| Ga0310039_101712301 | 3300030706 | Peatlands Soil | GNWGIGENVLKVFLRFRGSANRRVDLFLPLIASISGRRQGT |
| Ga0310039_102279761 | 3300030706 | Peatlands Soil | WGIGENVLKVFLRFRGSANRRVDLFLPLIASIPSRRQ |
| Ga0310039_103279432 | 3300030706 | Peatlands Soil | FIAGLRVWGNWEIGENVLKVFLRLRGSANRRVDLFLPLIASIGKLGRWRVAGGPRSA |
| Ga0310038_101897072 | 3300030707 | Peatlands Soil | IAGLRVWGNWKIGENVLKVFLRLRGSANRRVDLFLPLIASISGRQL |
| Ga0310038_104132751 | 3300030707 | Peatlands Soil | FIVGLRVWGNWGIGENVLKVFLRFRGSANRRVDLFLPLIASICSSCQ |
| Ga0318561_105119671 | 3300031679 | Soil | MKFIAGLRVWKNWGSPGNVLKVFLRLRGSANRRVDLYL |
| Ga0306926_130396652 | 3300031954 | Soil | RSAPMKFIAGLRVWGNWGSPGNILKVFLRLRGPANRRVDLHLPLIVSIQQPQLYL |
| Ga0306922_121046951 | 3300032001 | Soil | GNWGSPGNILKVFLRLRGSANRRVDLYLPLIASIFGVA |
| Ga0311301_100990861 | 3300032160 | Peatlands Soil | FIAGLRVWGNWEIGENVLKVFLRLRGSANRRVDLFLPLIASIFGGCKS |
| Ga0311301_102065341 | 3300032160 | Peatlands Soil | FIAGLRVWGNRGNLENVLKVFLTLRDSANSRVDLYLPLIASIRRASGE |
| Ga0311301_104830721 | 3300032160 | Peatlands Soil | MKFIAGLRVWGNRGNLENVLKVFLTLRDSANSRVDLYLPLIASI |
| Ga0311301_110420182 | 3300032160 | Peatlands Soil | AGLRVWGNWKIGENVLKVFLRLRGSANRRVDLFLPLIASIPGLRQ |
| Ga0311301_111399921 | 3300032160 | Peatlands Soil | RVWGNWKIGENVLKVFLRLRGSANRRVDLFLPLIASISGRRL |
| Ga0311301_111644041 | 3300032160 | Peatlands Soil | FIAGLRVWGNWKIGENVLKVFLRLRGSANRRVDLFLPLIASTSGRLQ |
| Ga0311301_114728491 | 3300032160 | Peatlands Soil | GLRVWGNWEIGENVLKVFLRLRGSANRRVDLFLPLIASIPSRRQ |
| Ga0311301_128626951 | 3300032160 | Peatlands Soil | FIAGLRVWGNRGNLENVLKVFLTLRDSANSRVDLYLPLIASIFMVSSQSG |
| ⦗Top⦘ |