 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F104608 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 42 residues |
| Representative Sequence | PPMEGGYDEGYSGGGFGDEPRASGSASPARGRTPVNDLDDDIPF |
| Number of Associated Samples | 68 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.00 % |
| % of genes from short scaffolds (< 2000 bps) | 89.00 % |
| Associated GOLD sequencing projects | 63 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.16 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (58.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (30.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (67.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.16 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF01717 | Meth_synt_2 | 10.00 |
| PF01541 | GIY-YIG | 4.00 |
| PF07883 | Cupin_2 | 4.00 |
| PF03466 | LysR_substrate | 4.00 |
| PF09509 | Hypoth_Ymh | 3.00 |
| PF13614 | AAA_31 | 3.00 |
| PF03235 | DUF262 | 2.00 |
| PF13151 | DUF3990 | 2.00 |
| PF00561 | Abhydrolase_1 | 1.00 |
| PF13365 | Trypsin_2 | 1.00 |
| PF07366 | SnoaL | 1.00 |
| PF01878 | EVE | 1.00 |
| PF07993 | NAD_binding_4 | 1.00 |
| PF13274 | DUF4065 | 1.00 |
| PF13175 | AAA_15 | 1.00 |
| PF02776 | TPP_enzyme_N | 1.00 |
| PF13302 | Acetyltransf_3 | 1.00 |
| PF01636 | APH | 1.00 |
| PF00107 | ADH_zinc_N | 1.00 |
| PF14022 | DUF4238 | 1.00 |
| PF06094 | GGACT | 1.00 |
| PF04471 | Mrr_cat | 1.00 |
| PF13470 | PIN_3 | 1.00 |
| PF00106 | adh_short | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 10.00 |
| COG1479 | DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains | Defense mechanisms [V] | 2.00 |
| COG1673 | Predicted RNA-binding protein, contains PUA-like EVE domain | General function prediction only [R] | 1.00 |
| COG2947 | Predicted RNA-binding protein, contains EVE domain | General function prediction only [R] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 58.00 % |
| Unclassified | root | N/A | 42.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004080|Ga0062385_10374598 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 843 | Open in IMG/M |
| 3300004082|Ga0062384_100024839 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2611 | Open in IMG/M |
| 3300004152|Ga0062386_100693262 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 836 | Open in IMG/M |
| 3300004152|Ga0062386_101749181 | Not Available | 519 | Open in IMG/M |
| 3300005764|Ga0066903_100317769 | All Organisms → cellular organisms → Bacteria | 2483 | Open in IMG/M |
| 3300005764|Ga0066903_105271292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 684 | Open in IMG/M |
| 3300005764|Ga0066903_106961702 | Not Available | 587 | Open in IMG/M |
| 3300006871|Ga0075434_100735558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1004 | Open in IMG/M |
| 3300006893|Ga0073928_10071379 | All Organisms → cellular organisms → Bacteria | 3013 | Open in IMG/M |
| 3300009147|Ga0114129_12034217 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300010046|Ga0126384_11841020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 575 | Open in IMG/M |
| 3300010359|Ga0126376_10503752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1121 | Open in IMG/M |
| 3300010359|Ga0126376_12973769 | Not Available | 523 | Open in IMG/M |
| 3300010360|Ga0126372_10748704 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300010361|Ga0126378_12734846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 564 | Open in IMG/M |
| 3300010366|Ga0126379_12082647 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300010366|Ga0126379_12217312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 650 | Open in IMG/M |
| 3300010376|Ga0126381_101575755 | Not Available | 949 | Open in IMG/M |
| 3300010376|Ga0126381_104255768 | Not Available | 555 | Open in IMG/M |
| 3300011269|Ga0137392_10501287 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300011270|Ga0137391_10289888 | Not Available | 1413 | Open in IMG/M |
| 3300012202|Ga0137363_10223810 | Not Available | 1520 | Open in IMG/M |
| 3300012202|Ga0137363_10719174 | Not Available | 846 | Open in IMG/M |
| 3300012202|Ga0137363_11028964 | Not Available | 700 | Open in IMG/M |
| 3300012362|Ga0137361_11070662 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 727 | Open in IMG/M |
| 3300012362|Ga0137361_11090956 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300012922|Ga0137394_10932581 | Not Available | 724 | Open in IMG/M |
| 3300015371|Ga0132258_10936669 | All Organisms → cellular organisms → Bacteria | 2188 | Open in IMG/M |
| 3300016270|Ga0182036_10155587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1633 | Open in IMG/M |
| 3300016270|Ga0182036_10926335 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300016294|Ga0182041_10160352 | Not Available | 1748 | Open in IMG/M |
| 3300016294|Ga0182041_10870521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 808 | Open in IMG/M |
| 3300016319|Ga0182033_10004721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 7207 | Open in IMG/M |
| 3300016319|Ga0182033_10580413 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium LiPW_15 | 972 | Open in IMG/M |
| 3300016341|Ga0182035_11064243 | Not Available | 719 | Open in IMG/M |
| 3300016341|Ga0182035_11823113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electronema → unclassified Candidatus Electronema → Candidatus Electronema sp. GS | 551 | Open in IMG/M |
| 3300016357|Ga0182032_10386821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium vitis | 1128 | Open in IMG/M |
| 3300016357|Ga0182032_10391476 | Not Available | 1122 | Open in IMG/M |
| 3300016357|Ga0182032_11122246 | Not Available | 675 | Open in IMG/M |
| 3300016387|Ga0182040_10153521 | All Organisms → cellular organisms → Bacteria | 1644 | Open in IMG/M |
| 3300016404|Ga0182037_11043640 | Not Available | 714 | Open in IMG/M |
| 3300016404|Ga0182037_11495776 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300016422|Ga0182039_11066973 | Not Available | 726 | Open in IMG/M |
| 3300016445|Ga0182038_10102379 | Not Available | 2084 | Open in IMG/M |
| 3300016445|Ga0182038_10910845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 775 | Open in IMG/M |
| 3300017955|Ga0187817_10379276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 902 | Open in IMG/M |
| 3300020580|Ga0210403_10622216 | Not Available | 870 | Open in IMG/M |
| 3300020580|Ga0210403_11064396 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 630 | Open in IMG/M |
| 3300020581|Ga0210399_10690371 | Not Available | 840 | Open in IMG/M |
| 3300020581|Ga0210399_11407063 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300020583|Ga0210401_10509165 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300020583|Ga0210401_11309169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 582 | Open in IMG/M |
| 3300021168|Ga0210406_10522086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 936 | Open in IMG/M |
| 3300021478|Ga0210402_11400423 | Not Available | 626 | Open in IMG/M |
| 3300021560|Ga0126371_10029948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5087 | Open in IMG/M |
| 3300021560|Ga0126371_11641148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 768 | Open in IMG/M |
| 3300022527|Ga0242664_1129815 | Not Available | 542 | Open in IMG/M |
| 3300022527|Ga0242664_1134784 | Not Available | 535 | Open in IMG/M |
| 3300022724|Ga0242665_10263825 | Not Available | 590 | Open in IMG/M |
| 3300025910|Ga0207684_10363848 | Not Available | 1245 | Open in IMG/M |
| 3300026538|Ga0209056_10508783 | Not Available | 627 | Open in IMG/M |
| 3300026552|Ga0209577_10611510 | Not Available | 648 | Open in IMG/M |
| 3300027371|Ga0209418_1084985 | Not Available | 568 | Open in IMG/M |
| 3300027603|Ga0209331_1174659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300027635|Ga0209625_1045575 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 978 | Open in IMG/M |
| 3300027737|Ga0209038_10008862 | All Organisms → cellular organisms → Bacteria | 2953 | Open in IMG/M |
| 3300027824|Ga0209040_10182977 | Not Available | 1102 | Open in IMG/M |
| 3300027824|Ga0209040_10323984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 741 | Open in IMG/M |
| 3300031543|Ga0318516_10676057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 587 | Open in IMG/M |
| 3300031561|Ga0318528_10013025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3831 | Open in IMG/M |
| 3300031679|Ga0318561_10273691 | Not Available | 922 | Open in IMG/M |
| 3300031708|Ga0310686_102805954 | Not Available | 1255 | Open in IMG/M |
| 3300031708|Ga0310686_103736495 | Not Available | 739 | Open in IMG/M |
| 3300031708|Ga0310686_108444655 | Not Available | 623 | Open in IMG/M |
| 3300031719|Ga0306917_11141794 | Not Available | 606 | Open in IMG/M |
| 3300031782|Ga0318552_10067639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1721 | Open in IMG/M |
| 3300031796|Ga0318576_10302111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 756 | Open in IMG/M |
| 3300031797|Ga0318550_10574438 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300031833|Ga0310917_10378322 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300031835|Ga0318517_10548521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 520 | Open in IMG/M |
| 3300031879|Ga0306919_11323673 | Not Available | 545 | Open in IMG/M |
| 3300031890|Ga0306925_11037241 | Not Available | 833 | Open in IMG/M |
| 3300031890|Ga0306925_12081617 | Not Available | 532 | Open in IMG/M |
| 3300031910|Ga0306923_11539084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 694 | Open in IMG/M |
| 3300031912|Ga0306921_12188373 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300031912|Ga0306921_12626658 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300031912|Ga0306921_12666347 | Not Available | 514 | Open in IMG/M |
| 3300031942|Ga0310916_10947055 | Not Available | 720 | Open in IMG/M |
| 3300031942|Ga0310916_11353668 | Not Available | 584 | Open in IMG/M |
| 3300031946|Ga0310910_11182419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 594 | Open in IMG/M |
| 3300032025|Ga0318507_10062806 | All Organisms → cellular organisms → Bacteria | 1489 | Open in IMG/M |
| 3300032052|Ga0318506_10223880 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300032063|Ga0318504_10334080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli | 719 | Open in IMG/M |
| 3300032094|Ga0318540_10000820 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9557 | Open in IMG/M |
| 3300032261|Ga0306920_100357007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2174 | Open in IMG/M |
| 3300032515|Ga0348332_12930965 | Not Available | 806 | Open in IMG/M |
| 3300033289|Ga0310914_10548721 | Not Available | 1044 | Open in IMG/M |
| 3300033289|Ga0310914_10817582 | Not Available | 830 | Open in IMG/M |
| 3300033289|Ga0310914_10995092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 739 | Open in IMG/M |
| 3300033289|Ga0310914_11361562 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 30.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 7.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.00% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062385_103745982 | 3300004080 | Bog Forest Soil | ASGGPPMEGGYDEGYGDEMPASRPAAPARGRTPVNDLDDDIPF* |
| Ga0062384_1000248393 | 3300004082 | Bog Forest Soil | MEGGYDEGYAGGGFGDEPTGAAAAPVRPRTPVNDLDDDIPF* |
| Ga0062386_1006932623 | 3300004152 | Bog Forest Soil | GAGGPPMEGGYDEGYAGGGFGDEPTGAAAAPVRPRTPVNDLDDDIPF* |
| Ga0062386_1017491812 | 3300004152 | Bog Forest Soil | GGPPMEGGYDEGYAGGGFDDERPAGGSAAPARARTPVNDLDDDIPF* |
| Ga0066903_1003177695 | 3300005764 | Tropical Forest Soil | GPPMEGGYDEGYAGGGFGDEPRASATPTRARTPVNDLDDDIPF* |
| Ga0066903_1052712921 | 3300005764 | Tropical Forest Soil | GGSPMESGYDEGFADEPLASAAAIPARARTPVNDLDDEIPL* |
| Ga0066903_1069617021 | 3300005764 | Tropical Forest Soil | RGAGGPPMEGGYDEGYASGGFGDEPRTAATPARAGTPVNDLDDDIPF* |
| Ga0075434_1007355581 | 3300006871 | Populus Rhizosphere | DEGYGGGFGDEPRASGPATPARGRTPVNDLDDDIPF* |
| Ga0073928_100713793 | 3300006893 | Iron-Sulfur Acid Spring | EGGYDEGGFGDEPRASGSTAPARARTPVNDLDDDIPF* |
| Ga0114129_120342172 | 3300009147 | Populus Rhizosphere | GYDEGYAGGGFGDEPRTSATPARSRTPVNDLDDDIPF* |
| Ga0126384_118410201 | 3300010046 | Tropical Forest Soil | GPPIEGGYDEGYGGGFGDEPAARGSATPTRARTPVNDLDDDIPF* |
| Ga0126376_105037522 | 3300010359 | Tropical Forest Soil | GGARGAGAPSIEGGYDEGFADEPRASATAMPARGRTPVNDLDDDIPF* |
| Ga0126376_129737691 | 3300010359 | Tropical Forest Soil | AGGPPMEGGYDEGYAGGGFDDERPAVGSSAPSRARSPVNDLDDDIPF* |
| Ga0126372_107487042 | 3300010360 | Tropical Forest Soil | AIEAGYDEGFADEPRAPAAAAPARSRALTDDLDDDIPF* |
| Ga0126378_127348462 | 3300010361 | Tropical Forest Soil | RGAGGSPMESGYDEGFADEPLASAAAIPARARTPVNDLDDDIPF* |
| Ga0126379_120826471 | 3300010366 | Tropical Forest Soil | PPIEGGYDEGYAGGGFGDEPTAAVTPARARTPVNDLDDDIPF* |
| Ga0126379_122173122 | 3300010366 | Tropical Forest Soil | GGYDEGYAGRGFDDEPRLLHPPRGRTPVNDLDHDIPF* |
| Ga0126381_1015757551 | 3300010376 | Tropical Forest Soil | MESGYDEGFADEPLASAAAIPARARTPVNDLDDDIPF* |
| Ga0126381_1042557682 | 3300010376 | Tropical Forest Soil | GYGGGFDDERPSPGSATPARARPPVNYPDDDIPF* |
| Ga0137392_105012871 | 3300011269 | Vadose Zone Soil | PPAEGGYDEGYAGGGFGDEPRPSGPAAPARGRTPVNDLDDDIPF* |
| Ga0137391_102898881 | 3300011270 | Vadose Zone Soil | GGYDEAYAGSGFGDEPRTASPAPARSRTPVNDLDDDIPF* |
| Ga0137363_102238101 | 3300012202 | Vadose Zone Soil | GYDEGYAGGGFGDEPRTAATPAPARGRTPVNDLDDDIPF* |
| Ga0137363_107191742 | 3300012202 | Vadose Zone Soil | DGARGAGGSPSIEGGYDEAYSGGGLGDEPRAAATPARTRTPVNDLDDDIPF* |
| Ga0137363_110289642 | 3300012202 | Vadose Zone Soil | SARGAGGPPIEGGYDEGYTGGGFGDEPRAAATPAPARGRTPVNDLDGNIAS* |
| Ga0137361_110706622 | 3300012362 | Vadose Zone Soil | DSARGAGGPPIEGGYEEGYAGGGFGDEPRAAATPAPARGRTPVNDLDDDIPF* |
| Ga0137361_110909561 | 3300012362 | Vadose Zone Soil | IEGGYDEGFAGGGFGDEPRTAATPARGRTPVNDLDDDIPF* |
| Ga0137394_109325811 | 3300012922 | Vadose Zone Soil | GPAMEGGYDEGYSGGGLGDEPRASGATAPARGRTPVNDLDDDIPF* |
| Ga0132258_109366695 | 3300015371 | Arabidopsis Rhizosphere | LDSARGTGGPPVEGGYDEGYAGGGFGDEPRPAAAPARSRTPVNDLDDDIPF* |
| Ga0182036_101555871 | 3300016270 | Soil | PPMEGGYDEGYSGGGFGDEPRASGSASPARGRTPVNDLDDDIPF |
| Ga0182036_109263352 | 3300016270 | Soil | GAGGPPMEGGYDEGYGSGFDDEPTTRSSAAPARARTPVNDLDDDIPF |
| Ga0182041_101603521 | 3300016294 | Soil | GGPPMEGGYDEGYAGGGFDDEPAARGSAAPARARTPVNDLDDDIPF |
| Ga0182041_108705212 | 3300016294 | Soil | EGGYEEGFSGGGFGDEPRSNATPARGRTPVNDLDDDIPF |
| Ga0182033_100047219 | 3300016319 | Soil | GYDEGYTGGGFGDEPRTSTTPARSRTPVNDLDDDIPF |
| Ga0182033_105804132 | 3300016319 | Soil | EGYAGGGFDDEPATRGSAAPARVRTPVNDLDDDIPF |
| Ga0182035_110642431 | 3300016341 | Soil | RGAGGPPMEGGYDDSFGGGFDDEPTARSSATPTRARTPVNDLDDDIPF |
| Ga0182035_118231132 | 3300016341 | Soil | AGGPPMEGGYDEGYAGGGFDEERPASGSAAPARARTPVNDLDDDIPF |
| Ga0182032_103868212 | 3300016357 | Soil | GGPPMEGGYDEGYAGGGFDDERPAGATAPIRARTPVNDLDDDIPF |
| Ga0182032_103914762 | 3300016357 | Soil | GPPMEGGYDEGYAGGGFDDEPAARGSAAPARARTPVNDLDDDIPF |
| Ga0182032_111222463 | 3300016357 | Soil | MEGGYDEGYGGGFADEPRASGSASPARGRTPINDLDDDIPF |
| Ga0182040_101535211 | 3300016387 | Soil | EGYGSGFDDEPTTRSSAAPARARTPVNDLDDDIPF |
| Ga0182037_110436401 | 3300016404 | Soil | DEGYGGGFADEPTTRGSAAPARARTPVNDLDDDIPF |
| Ga0182037_114957762 | 3300016404 | Soil | EGYGGGFDDERRAGCSATPARAKTSVNDLDDDIPF |
| Ga0182039_110669732 | 3300016422 | Soil | PMEGGYDEGYAGGGFDDERPAGATTPIRARTPVNDLDDDIPF |
| Ga0182038_101023791 | 3300016445 | Soil | AGGPPMEGGYDEGYGSGGFDDEPAARSSAAPARARTPVNDLDDDIPF |
| Ga0182038_109108452 | 3300016445 | Soil | AGGPPMEGGYDEGYGGGFGDEPTARSSTAPARARTPVNDLDDDIPF |
| Ga0187817_103792763 | 3300017955 | Freshwater Sediment | EGGYDEGYGDEMPASRPATPARGRTPVNDLDDDIPF |
| Ga0210403_106222161 | 3300020580 | Soil | MEGGYDEGYAGGGFGDEPRATATPAPTRGRTPVNDLDDDIPF |
| Ga0210403_110643961 | 3300020580 | Soil | DESYAGGGFGDEPRATATPAAPARARTPVNDLDDDIPF |
| Ga0210399_106903711 | 3300020581 | Soil | ELTMLDGARGAGGPPIEGGYDEGGFGDEPRASGSAPPARGRTPVNDLDDDIPF |
| Ga0210399_114070632 | 3300020581 | Soil | EGGYDEGHAGGGFVDEPRTSGPATPARGRTPVNDLDDDIPF |
| Ga0210401_105091652 | 3300020583 | Soil | GARGAGGPPIEGGYDEGGFGDEPRASGSAPPARGRTPVNDLDDDIPF |
| Ga0210401_113091691 | 3300020583 | Soil | GPPMEGGGSDEGYASGGFGDEPRTSGPATPARGRTPVNDLDDDIPF |
| Ga0210406_105220862 | 3300021168 | Soil | DEGYAGGGFGDEPRTSGPATPARGRTPVNDLDDDIPF |
| Ga0210402_114004232 | 3300021478 | Soil | PIEGGSDEGYAGGGFGDEPRTSGPATPARGRTPVNDLDDDIPF |
| Ga0126371_100299487 | 3300021560 | Tropical Forest Soil | SGIDDEYGGAGFGNESARAATVSPRARTPVNDLDDDIPF |
| Ga0126371_116411483 | 3300021560 | Tropical Forest Soil | GELTMLDGAGGAGRPAMEGGFDDEPATRGSAPPARARTSVNDLDDDIPF |
| Ga0242664_11298151 | 3300022527 | Soil | PIEGSYDEGFAGGGFGDEPRTAATPARSRTPVNDLDDDIPF |
| Ga0242664_11347841 | 3300022527 | Soil | GGPPMETGYDEGGFGDEPRASGPTAPARGRTSVNDLDDDIPF |
| Ga0242665_102638252 | 3300022724 | Soil | EGGHDEGYAGGGFGDEPRTSATPARSRTPVNDLDDDIPF |
| Ga0207684_103638482 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | DEGFAHGGFGDEPRASGPATPVRGRTPVNDLDDDIPF |
| Ga0209056_105087831 | 3300026538 | Soil | GFGGGGFGDEPRTSGPAAPARGRTPVNDLDDDIPF |
| Ga0209577_106115101 | 3300026552 | Soil | EGYGGGFGDEPRASGPATPARGRTPVNDLDDDIPF |
| Ga0209418_10849851 | 3300027371 | Forest Soil | ARGAGGSPAIEGGYDEGGFGDEPRGSSPVAPARGRTPVNDLDDDIPF |
| Ga0209331_11746591 | 3300027603 | Forest Soil | EGYAGGGFGDEPRTSGPATPARGRTPVNDLDDDIPF |
| Ga0209625_10455752 | 3300027635 | Forest Soil | PPIEGGSDEGYAGGGFGDEPRTSGPATPARGRTPVNDLDDDIPF |
| Ga0209038_100088624 | 3300027737 | Bog Forest Soil | GAGGGPPIEGGYDEGGFGDEPRTSSTATPARGRTPVNDLDDDIPF |
| Ga0209040_101829772 | 3300027824 | Bog Forest Soil | PPVEGGYDEGYAGGGFGDEPSSPAATAPARARTPVNDLDDDIPF |
| Ga0209040_103239842 | 3300027824 | Bog Forest Soil | MLDAAGAGGPPVEGGGFDDERPAGGSGAPARAKTPVNDLDDDIPF |
| Ga0318516_106760571 | 3300031543 | Soil | EGGYDDSFGGGFDDEPAARSSAAPARARTPVNDLDDDIPF |
| Ga0318528_100130251 | 3300031561 | Soil | YDEGYSGGGFGDEPRASGSASPARGRTPVNDLDDDIPF |
| Ga0318561_102736911 | 3300031679 | Soil | SGGPPMDGDYDEGYGAFGGEPASRPAAPARGRTPVNDLDDDIPF |
| Ga0310686_1028059541 | 3300031708 | Soil | GGPPIEGGYDEGYGDEMPASRPATPARGRTPVNDLDDDIPF |
| Ga0310686_1037364951 | 3300031708 | Soil | GELTMLDGARGGTAGGPPMDAGYDEGFGDEMPPPRSSPATPSRGARKPVNDLDDDIPF |
| Ga0310686_1084446551 | 3300031708 | Soil | PPVEGGYDEGYGDEMPASRPATPARGRTPVNDLDDDIPF |
| Ga0306917_111417941 | 3300031719 | Soil | GPPTEGGYEEGFSGGGFGDEPRSNATPARGRTPVNDLDDDIPF |
| Ga0318552_100676393 | 3300031782 | Soil | YDEGYGGGVEDERRADSSAALARAKTAVDHLDDDIPF |
| Ga0318576_103021112 | 3300031796 | Soil | GYDVGYSGGGFGDEPRASGSASPARGRTPVNDLDDDIPF |
| Ga0318550_105744381 | 3300031797 | Soil | PMEGGYDEGYGSGFDDEPTTRSSAAPARARTPVNDLDDDIPF |
| Ga0310917_103783222 | 3300031833 | Soil | RGAGGPPMEGGYDEGYGSGFDDESAARGSAAPVRARTPVNDLDDDIPF |
| Ga0318517_105485211 | 3300031835 | Soil | PTEGGYEEGFSGGGFGDEPRSNAAPARGRTPVNDLDDDIPF |
| Ga0306919_113236733 | 3300031879 | Soil | EGGYDEGFAGGGFDDERPAGGSATPARTRTPVNDLDDDIPF |
| Ga0306925_110372412 | 3300031890 | Soil | GYDEGYAGGGFDDERPAGGSAAPARARTPVNDLDDDIPF |
| Ga0306925_120816171 | 3300031890 | Soil | GGPPMEGGYDEGYAGGGFDDEPTTRGSAAPARARTPVNDLDDDIPF |
| Ga0306923_115390841 | 3300031910 | Soil | YDEGYAGGGFDDERPTGGSTAPARARTPVNDLDDDIPF |
| Ga0306921_121883733 | 3300031912 | Soil | GGYDEGYAGGGFDDQRPTGGATTPALRTPVNDLDDDIPF |
| Ga0306921_126266582 | 3300031912 | Soil | GPPMEGGYDEGYAGGGFDDERPASASAAPARARTPVNDLDDDIPF |
| Ga0306921_126663471 | 3300031912 | Soil | EGFAGGGFDDERPAGGSATPARTRTPVNDLDDDIPF |
| Ga0310916_109470551 | 3300031942 | Soil | GAGGPPMEGGYDEGYAGGGFDDEPTTRGSSAPARARTPVNDLDDDIPF |
| Ga0310916_113536681 | 3300031942 | Soil | MEGGYDEGYAGGGFDDEPRASGPGAPARARTPVNDLDDDIPF |
| Ga0310910_111824192 | 3300031946 | Soil | EGYAGGGFDDEPTARGSAAPARARTPVNDLDDDIPF |
| Ga0318507_100628062 | 3300032025 | Soil | AGGARGAGGPPMEGGYDEGFGDEPAGSAVTPARTRTPVNDLDDDIPF |
| Ga0318506_102238801 | 3300032052 | Soil | MEGGYDEGYAGGGFGDEPTGAAAAPVRARTPVNDLDDDIPFLT |
| Ga0318504_103340801 | 3300032063 | Soil | VVAAFHRRAAGGPPMEGGYDEGYSGGGFGDEPRASGSASPARGRTPVNDLDDDIPF |
| Ga0318540_1000082010 | 3300032094 | Soil | MEGGYDEGFGDEPAGSAVTPARTRTPVNDLDDDIPF |
| Ga0306920_1003570076 | 3300032261 | Soil | EGYGGGGFDDERPTGGSATPARARTPVNDLDDDIPF |
| Ga0348332_129309653 | 3300032515 | Plant Litter | GPPMDAGYDEGFGDEMPPPRSSPATPSRGARKPVNDLDDDIPF |
| Ga0310914_105487211 | 3300033289 | Soil | EGGYDEGYAGGGFDDEPTTRGSAAPARARTPVNDLDDDIPF |
| Ga0310914_108175821 | 3300033289 | Soil | GARGGGAPSIEGGYDEGFADEPRSSAATIPARGRTPVNDLDDDIPF |
| Ga0310914_109950922 | 3300033289 | Soil | EGFAGGGFDDEPTTRGSAAPARARTPVNDLDDDIPF |
| Ga0310914_113615621 | 3300033289 | Soil | ARGAGGPPMEGGYDEGYAGGGFDDERPAGATAPIRARTPVNDLDDDIPF |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |