| Basic Information | |
|---|---|
| Family ID | F104574 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 46 residues |
| Representative Sequence | VQQVVHSVFFTVVSVVATLLTVGLTGVIILLVTDGDTPHADTRHRH |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 76.00 % |
| % of genes near scaffold ends (potentially truncated) | 30.00 % |
| % of genes from short scaffolds (< 2000 bps) | 79.00 % |
| Associated GOLD sequencing projects | 62 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (64.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere (15.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (69.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (83.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.95% β-sheet: 0.00% Coil/Unstructured: 54.05% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF03544 | TonB_C | 48.00 |
| PF01812 | 5-FTHF_cyc-lig | 16.00 |
| PF05569 | Peptidase_M56 | 8.00 |
| PF03062 | MBOAT | 5.00 |
| PF03965 | Penicillinase_R | 3.00 |
| PF02585 | PIG-L | 1.00 |
| PF05187 | ETF_QO | 1.00 |
| PF13620 | CarboxypepD_reg | 1.00 |
| PF00496 | SBP_bac_5 | 1.00 |
| PF01068 | DNA_ligase_A_M | 1.00 |
| PF11239 | DUF3040 | 1.00 |
| PF07638 | Sigma70_ECF | 1.00 |
| PF02518 | HATPase_c | 1.00 |
| PF02578 | Cu-oxidase_4 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 48.00 |
| COG0212 | 5-formyltetrahydrofolate cyclo-ligase | Coenzyme transport and metabolism [H] | 16.00 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 3.00 |
| COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 3.00 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 1.00 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 1.00 |
| COG1496 | Copper oxidase (laccase) domain | Inorganic ion transport and metabolism [P] | 1.00 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.00 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 1.00 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 1.00 |
| COG2440 | Ferredoxin-like protein FixX | Energy production and conversion [C] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.00 % |
| Unclassified | root | N/A | 32.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2067725003|GPWSG_F5G3JLY01D37VN | Not Available | 508 | Open in IMG/M |
| 3300000956|JGI10216J12902_110757163 | All Organisms → cellular organisms → Bacteria | 1576 | Open in IMG/M |
| 3300000956|JGI10216J12902_111423321 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300000956|JGI10216J12902_120072751 | Not Available | 607 | Open in IMG/M |
| 3300004025|Ga0055433_10046629 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300005328|Ga0070676_10010620 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4997 | Open in IMG/M |
| 3300005330|Ga0070690_100026161 | All Organisms → cellular organisms → Bacteria | 3597 | Open in IMG/M |
| 3300005331|Ga0070670_100012324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 7315 | Open in IMG/M |
| 3300005331|Ga0070670_100836680 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300005334|Ga0068869_100103916 | All Organisms → cellular organisms → Bacteria | 2153 | Open in IMG/M |
| 3300005338|Ga0068868_100185530 | All Organisms → cellular organisms → Bacteria | 1728 | Open in IMG/M |
| 3300005338|Ga0068868_101325043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300005343|Ga0070687_100465504 | Not Available | 844 | Open in IMG/M |
| 3300005353|Ga0070669_100038823 | All Organisms → cellular organisms → Bacteria | 3457 | Open in IMG/M |
| 3300005353|Ga0070669_101478548 | Not Available | 590 | Open in IMG/M |
| 3300005354|Ga0070675_100012442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6666 | Open in IMG/M |
| 3300005354|Ga0070675_100029354 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4435 | Open in IMG/M |
| 3300005354|Ga0070675_101358927 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 655 | Open in IMG/M |
| 3300005356|Ga0070674_100758011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 835 | Open in IMG/M |
| 3300005356|Ga0070674_101419722 | Not Available | 622 | Open in IMG/M |
| 3300005364|Ga0070673_100285220 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
| 3300005364|Ga0070673_101630168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 610 | Open in IMG/M |
| 3300005365|Ga0070688_100138833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1648 | Open in IMG/M |
| 3300005367|Ga0070667_100239654 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| 3300005444|Ga0070694_100817206 | Not Available | 765 | Open in IMG/M |
| 3300005456|Ga0070678_100361914 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
| 3300005466|Ga0070685_10473507 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300005466|Ga0070685_11004144 | Not Available | 626 | Open in IMG/M |
| 3300005466|Ga0070685_11395869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300005543|Ga0070672_100521965 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300005543|Ga0070672_101088278 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300005577|Ga0068857_100722936 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300005616|Ga0068852_100483106 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
| 3300005617|Ga0068859_101186127 | Not Available | 841 | Open in IMG/M |
| 3300005618|Ga0068864_100737476 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300005718|Ga0068866_10328779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 964 | Open in IMG/M |
| 3300005719|Ga0068861_100032136 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3861 | Open in IMG/M |
| 3300005719|Ga0068861_100612048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1001 | Open in IMG/M |
| 3300005840|Ga0068870_10129683 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1463 | Open in IMG/M |
| 3300005841|Ga0068863_101240359 | Not Available | 752 | Open in IMG/M |
| 3300005844|Ga0068862_100241345 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1643 | Open in IMG/M |
| 3300006931|Ga0097620_101980543 | Not Available | 643 | Open in IMG/M |
| 3300009098|Ga0105245_12033360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300009156|Ga0111538_11000330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1058 | Open in IMG/M |
| 3300009551|Ga0105238_10017586 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7269 | Open in IMG/M |
| 3300009553|Ga0105249_12686855 | Not Available | 570 | Open in IMG/M |
| 3300009610|Ga0105340_1400876 | Not Available | 611 | Open in IMG/M |
| 3300012960|Ga0164301_10815614 | Not Available | 715 | Open in IMG/M |
| 3300013306|Ga0163162_11111739 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300014326|Ga0157380_10040108 | All Organisms → cellular organisms → Bacteria | 3645 | Open in IMG/M |
| 3300014326|Ga0157380_12424139 | Not Available | 590 | Open in IMG/M |
| 3300014745|Ga0157377_11539503 | Not Available | 530 | Open in IMG/M |
| 3300015371|Ga0132258_10452058 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3202 | Open in IMG/M |
| 3300015372|Ga0132256_101593442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 763 | Open in IMG/M |
| 3300015374|Ga0132255_104532849 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300017965|Ga0190266_10086023 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
| 3300018083|Ga0184628_10000954 | All Organisms → cellular organisms → Bacteria | 14752 | Open in IMG/M |
| 3300018469|Ga0190270_10001779 | All Organisms → cellular organisms → Bacteria | 10189 | Open in IMG/M |
| 3300018476|Ga0190274_10278887 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
| 3300021082|Ga0210380_10000045 | All Organisms → cellular organisms → Bacteria | 86720 | Open in IMG/M |
| 3300021082|Ga0210380_10376808 | Not Available | 648 | Open in IMG/M |
| 3300021445|Ga0182009_10232850 | Not Available | 908 | Open in IMG/M |
| 3300025580|Ga0210138_1028282 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
| 3300025893|Ga0207682_10013782 | All Organisms → cellular organisms → Bacteria | 3148 | Open in IMG/M |
| 3300025901|Ga0207688_10631461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 676 | Open in IMG/M |
| 3300025908|Ga0207643_10210975 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
| 3300025908|Ga0207643_10861045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300025918|Ga0207662_10477374 | Not Available | 856 | Open in IMG/M |
| 3300025920|Ga0207649_10547488 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 885 | Open in IMG/M |
| 3300025923|Ga0207681_10056088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 2686 | Open in IMG/M |
| 3300025923|Ga0207681_10426762 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300025923|Ga0207681_11385320 | Not Available | 590 | Open in IMG/M |
| 3300025924|Ga0207694_10021541 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4885 | Open in IMG/M |
| 3300025926|Ga0207659_10086034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 2337 | Open in IMG/M |
| 3300025926|Ga0207659_11094633 | Not Available | 686 | Open in IMG/M |
| 3300025930|Ga0207701_10253419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1536 | Open in IMG/M |
| 3300025931|Ga0207644_10032760 | All Organisms → cellular organisms → Bacteria | 3628 | Open in IMG/M |
| 3300025940|Ga0207691_10117647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2358 | Open in IMG/M |
| 3300025940|Ga0207691_11298635 | Not Available | 601 | Open in IMG/M |
| 3300025941|Ga0207711_10699904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 945 | Open in IMG/M |
| 3300025942|Ga0207689_11433378 | Not Available | 578 | Open in IMG/M |
| 3300025960|Ga0207651_11299815 | Not Available | 654 | Open in IMG/M |
| 3300025960|Ga0207651_11354300 | Not Available | 640 | Open in IMG/M |
| 3300025961|Ga0207712_12072777 | Not Available | 509 | Open in IMG/M |
| 3300025972|Ga0207668_10694172 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300026023|Ga0207677_10109449 | All Organisms → cellular organisms → Bacteria | 2054 | Open in IMG/M |
| 3300026075|Ga0207708_10597799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 934 | Open in IMG/M |
| 3300026095|Ga0207676_10812601 | Not Available | 913 | Open in IMG/M |
| 3300026118|Ga0207675_101743915 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 642 | Open in IMG/M |
| 3300026121|Ga0207683_10867447 | Not Available | 838 | Open in IMG/M |
| 3300026142|Ga0207698_12370838 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 542 | Open in IMG/M |
| 3300028379|Ga0268266_11239879 | Not Available | 721 | Open in IMG/M |
| 3300028380|Ga0268265_10165676 | All Organisms → cellular organisms → Bacteria | 1883 | Open in IMG/M |
| 3300028381|Ga0268264_12336325 | Not Available | 541 | Open in IMG/M |
| 3300031562|Ga0310886_10130085 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
| 3300031740|Ga0307468_101592636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Denitrobaculum → Denitrobaculum tricleocarpae | 610 | Open in IMG/M |
| 3300031854|Ga0310904_10451335 | Not Available | 853 | Open in IMG/M |
| 3300031940|Ga0310901_10304382 | Not Available | 670 | Open in IMG/M |
| 3300032013|Ga0310906_10947450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 616 | Open in IMG/M |
| 3300032144|Ga0315910_10730973 | Not Available | 769 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 15.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 13.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 11.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 9.00% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 7.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.00% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.00% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 2.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2067725003 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004025 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025580 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPWSG_01793420 | 2067725003 | Soil | TVQDVVHQVFVTVVGVTFTLLAVGLTGVIILLVTDRDTAHTDTRSA |
| JGI10216J12902_1107571632 | 3300000956 | Soil | VQEMVHSVFFTVVGVAVTLLTLGLTGVIILLATNGDTPHTDQRRPAHSAGR* |
| JGI10216J12902_1114233212 | 3300000956 | Soil | VQQVVHSVFFTVVSVVATLLTVGLTGVILLLATNRDTPHTESRPHERLATPTSV* |
| JGI10216J12902_1200727512 | 3300000956 | Soil | VQDVVHHVFVTVVGVIVTLLTVGLTGVVILLATDRDTSHHDPPRRA* |
| Ga0055433_100466292 | 3300004025 | Natural And Restored Wetlands | VQEMVHSVFFTVVGVAVTLLTLGLTGVIILLVTNGDTPHADHRTASGRPA* |
| Ga0070676_100106205 | 3300005328 | Miscanthus Rhizosphere | VQQVVHSVFFTVVSVVATLLTVGLTGVIILLVTDGDTPHADTRPRH* |
| Ga0070690_1000261613 | 3300005330 | Switchgrass Rhizosphere | VQQVVHSVFFTVVSVVATLLTIGLTGVIILLVTDGDTPHADTRPRH* |
| Ga0070670_1000123245 | 3300005331 | Switchgrass Rhizosphere | VQQVVHSVFFTVVSVVATLLTVFLTGVIILLVTNGDMPHSDTRHGH* |
| Ga0070670_1008366802 | 3300005331 | Switchgrass Rhizosphere | VQQVVHSVFFTVVSVVVTLLTVGLTGVILLIATDGDTPHAESRKNATSV* |
| Ga0068869_1001039162 | 3300005334 | Miscanthus Rhizosphere | VQQVVHSVFFTVVSVVATLLTVGLTGLIILLVTNGDTPHADSRPGH* |
| Ga0068868_1001855303 | 3300005338 | Miscanthus Rhizosphere | VQQVVHSVFFTVVSVVATLLTIGLTGVIILLVTDGDTPHADTRHRH* |
| Ga0068868_1013250431 | 3300005338 | Miscanthus Rhizosphere | PVPGGALVQQVVHSVFFTVVSVVTTLLTMGLTGVIILLVTNGDTPQADTRHGH* |
| Ga0070687_1004655041 | 3300005343 | Switchgrass Rhizosphere | VQQVVHSVFFTVVSVVATLLTVGLTGLIILLATARDTSHPDARPRH* |
| Ga0070669_1000388232 | 3300005353 | Switchgrass Rhizosphere | VQQVVHSVFFTVVSVVATLLTVGLTGVILLLVTDRDTPYTESPAEPTSV* |
| Ga0070669_1014785482 | 3300005353 | Switchgrass Rhizosphere | QGGATVQDVVHQVFVTVVGVTFTLLAVGLTGVIILLVTDRDTAHTDTRSA* |
| Ga0070675_1000124423 | 3300005354 | Miscanthus Rhizosphere | VQDVVHQVFVTVVGVTFTLLAVGLTGVIILLVTDRDTAHTDTRSA* |
| Ga0070675_1000293542 | 3300005354 | Miscanthus Rhizosphere | VQQVVHSVFFTVVSVVATLLTVGLTGVIILLVTDGDTPHADTRHRH* |
| Ga0070675_1013589271 | 3300005354 | Miscanthus Rhizosphere | VQQVVHSVFFTVVSVVATLLTVGLTGVIILLVTNGDTSHADSRRRPTSV* |
| Ga0070674_1007580111 | 3300005356 | Miscanthus Rhizosphere | VQQVVHSVFFTVVGVIATLLTLGLTGVIILLATNGDTPHTDSRPRATSV* |
| Ga0070674_1014197222 | 3300005356 | Miscanthus Rhizosphere | VHSVFFTVVSVVATLLTVGLTGVILLLVTDRDTPYTESPAEPTSV* |
| Ga0070673_1002852203 | 3300005364 | Switchgrass Rhizosphere | VQQVVHSVFFTVVSVVATLLTVFLTGVIILLVTNGDTPHAESRRAPTSA* |
| Ga0070673_1016301681 | 3300005364 | Switchgrass Rhizosphere | VQQVVHSVFFTVVSVVATLLTVGLTGVILLLVTDRDTPYAESPAEPTSV* |
| Ga0070688_1001388331 | 3300005365 | Switchgrass Rhizosphere | TVVSVVATLLTVGLTGVILLLVTDRDTPYTESPAEPTSV* |
| Ga0070667_1002396542 | 3300005367 | Switchgrass Rhizosphere | VQQVVHSVFFTVVSVVATLLTVGLTGVILLLVTDGDTPHADRRVPH* |
| Ga0070694_1008172062 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VQQVVHSVFFTVVSVVATLLTIGLTGVIILLATDRDTPHAESRARTTSV* |
| Ga0070678_1003619142 | 3300005456 | Miscanthus Rhizosphere | VQQVVHSVFFTVVSVVATLLTVGLTGVILLLVTDRDTPSTESPAEPTSV* |
| Ga0070685_104735072 | 3300005466 | Switchgrass Rhizosphere | VQQVVHSVFFTVVSVVTTLLTIGLTGVIILLVTNGDTPHTDGNRRATSA* |
| Ga0070685_110041442 | 3300005466 | Switchgrass Rhizosphere | VQQVVHSVFFTVVSVVATLITVGLTGVIILLATNGDTPQGDSNRRASAAH* |
| Ga0070685_113958692 | 3300005466 | Switchgrass Rhizosphere | GGLVQQVVHSVFFTVVSVVATLLTIGLTGVIILLVTDGDTPHADTRPRH* |
| Ga0070672_1005219652 | 3300005543 | Miscanthus Rhizosphere | VVHSVFFTVVSVVATLLTVFLTGVIILLVTNGDTPHADAGHRH* |
| Ga0070672_1010882782 | 3300005543 | Miscanthus Rhizosphere | VQQVVHSVFFTVISVVATLLTVGLTGLIILLVTNGDTPHADTRHGH* |
| Ga0068857_1007229362 | 3300005577 | Corn Rhizosphere | VRQVVHSVFFTVVSVVATLLTIGLTGVIILLVTDGDTPHADTRPRH* |
| Ga0068852_1004831062 | 3300005616 | Corn Rhizosphere | VQQVVHSVFFTVVSVVTTLLTMGLTGVIILLVTNGDTPQADTRHGH* |
| Ga0068859_1011861272 | 3300005617 | Switchgrass Rhizosphere | VQQVVHSVFFTVVSVVTTLLTIGLTGVIILLVTNGDTPQADTRHGH* |
| Ga0068864_1007374762 | 3300005618 | Switchgrass Rhizosphere | VFFTVVSVVATLLTVFLTGVIILLVTNGDMPHSDTRHGH* |
| Ga0068866_103287792 | 3300005718 | Miscanthus Rhizosphere | VQQVVHSVFFTVVSVVATLLTVGLTGLIILLATARDTSH |
| Ga0068861_1000321362 | 3300005719 | Switchgrass Rhizosphere | VQQVVHSVFFTVVSVVATLLTVFLTGVIILLVTNGDTPHADAGHRH* |
| Ga0068861_1006120481 | 3300005719 | Switchgrass Rhizosphere | VQQVVHSVFFTVVSVVATLITVGLTGIIILLATNGDTPHTDSRPRA* |
| Ga0068870_101296831 | 3300005840 | Miscanthus Rhizosphere | VQQVVHSVFFTVVSVVATLLTVGLTGVILLLVTDRDT |
| Ga0068863_1012403592 | 3300005841 | Switchgrass Rhizosphere | VQQVVHSVFFTVVSVVATLLTVFLTGVIILLVTNGDTPHSDTRHGH* |
| Ga0068862_1002413452 | 3300005844 | Switchgrass Rhizosphere | VQQVVHSVFFTVVSVVATLLTLGLTGVIILLATNGDTPHADSRRRPTSV* |
| Ga0097620_1019805432 | 3300006931 | Switchgrass Rhizosphere | VQQVVHSVFFTVVSVVATLITVGLTGIIILLATNGDTPHADSNRRASAAH* |
| Ga0105245_120333602 | 3300009098 | Miscanthus Rhizosphere | MVHSVFFTVVSVVTTLLTMGLTGVIILLVTNGDTPQADTRHGH* |
| Ga0111538_110003302 | 3300009156 | Populus Rhizosphere | VVHSVFYTVVSVVATLLTLGLTGIIILLATNGDTPHAESRPRATSV* |
| Ga0105238_100175865 | 3300009551 | Corn Rhizosphere | VFFTVVSVVTTLLTMGLTGVIILLVTNGDTPQADTRHGH* |
| Ga0105249_126868552 | 3300009553 | Switchgrass Rhizosphere | TFQGGATVQDVVHQVFVTVVGVTFTLLAVGLTGVIILLVTDRDTAHTDTRSA* |
| Ga0105340_14008762 | 3300009610 | Soil | VQQVVHSVFFTVVSVVATLLTIGLTGVIILLATDRDTPHAESRTRTTSV* |
| Ga0164301_108156142 | 3300012960 | Soil | VQQVVHSVFFTVVSVVATLLTVGLTGLIILLVTNGDTPHADTRHGH* |
| Ga0163162_111117392 | 3300013306 | Switchgrass Rhizosphere | VQQVVHSVFFTVVSVVATLLPIGLTGVIILLVTDGDTPHADTRPRH* |
| Ga0157380_100401081 | 3300014326 | Switchgrass Rhizosphere | LVQQVVHSVFFTVVSVVATLLTVGLTGVILLLVTDRDTPSTESPAEPTSV* |
| Ga0157380_124241392 | 3300014326 | Switchgrass Rhizosphere | VVSVVATLLTVGLTGLIILLATARDTSHADTRRASTSA* |
| Ga0157377_115395031 | 3300014745 | Miscanthus Rhizosphere | SVFFTVVGVVVTLITVGLTGVILLLATDRDTSHTESRPGH* |
| Ga0132258_104520581 | 3300015371 | Arabidopsis Rhizosphere | VQEFVHSVFYTVVGVTVTLLTIGLTGVITLITTDRDTSHGEPRATGH* |
| Ga0132256_1015934422 | 3300015372 | Arabidopsis Rhizosphere | HSGGDVVQQVVHSVFFTVVSVVATLLTIGLTGVIILLVTDGDTPHADTRPRH* |
| Ga0132255_1045328491 | 3300015374 | Arabidopsis Rhizosphere | VFFTVVSVVATLLTIGLTGVIILLVTDGDTPHADTRPRH* |
| Ga0190266_100860232 | 3300017965 | Soil | VQQFVHSVFFTVVSVVATLLTVGLTGVIILLATDRDTPHADSRRPTSV |
| Ga0184628_1000095412 | 3300018083 | Groundwater Sediment | VEHVVHQVFLTVVGVTVTLLTVGLTGVIILLVTDRDTSHA |
| Ga0190270_100017797 | 3300018469 | Soil | VQDVVHQVFVTVVGVTFTLLALGLTGVIILLVTNRDTAHTDRPRSA |
| Ga0190274_102788872 | 3300018476 | Soil | VQDVVHHVFVTVVGVIVTLLTVGLTGVVILLATDRDTSHHDPPRRA |
| Ga0210380_1000004541 | 3300021082 | Groundwater Sediment | VEHVVHQVFLTVVGVTVTLLTVGLTGVIILLVTDRDTSHADPPRSA |
| Ga0210380_103768081 | 3300021082 | Groundwater Sediment | VFVTVVGVTFTLLAVGLTGVIILLVTDRDTAHTDTRSA |
| Ga0182009_102328502 | 3300021445 | Soil | VPQVVHSVFFTVVGVVTTLLTMGLTGVIILLVTNGDTPQNDSRHGH |
| Ga0210138_10282823 | 3300025580 | Natural And Restored Wetlands | VQEMVHSVFFTVVGVAVTLLTLGLTGVIILLVTNGDTPHADHRTASGRPA |
| Ga0207682_100137823 | 3300025893 | Miscanthus Rhizosphere | VQQVVHSVFFTVVSVVATLLTIGLTGVIILLVTDGDTPHADTRPRH |
| Ga0207688_106314611 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | VQQVVHSVFFTVVSVVATLLTVGLTGVILLLVTDRDTPYTESPAEPTSV |
| Ga0207643_102109752 | 3300025908 | Miscanthus Rhizosphere | VQQVVHSVFFTVVGVVVTLITVGLTGVILLLATDRDTSHTESRPGH |
| Ga0207643_108610452 | 3300025908 | Miscanthus Rhizosphere | VQQVVHSVFFTVVGVIATLLTLGLTGVIILLATNGDTPHVDTRSKATSV |
| Ga0207662_104773742 | 3300025918 | Switchgrass Rhizosphere | VQQVVHSVFFTVVSVVATLLTVGLTGLIILLATARDTSHPDARPRH |
| Ga0207649_105474882 | 3300025920 | Corn Rhizosphere | VQQVVHSVFFTVVSVVATLLTVFLTGVIILLVTNGDMPHSDTRHGH |
| Ga0207681_100560882 | 3300025923 | Switchgrass Rhizosphere | VQQVVHSVFFTVVSVVATLLTVGLTGLIILLVTNGDTPHADSRPGH |
| Ga0207681_104267622 | 3300025923 | Switchgrass Rhizosphere | VQQVVHSVFFTVVSVVATLLTVFLTGVIILLVTNGDTPHADAGHRH |
| Ga0207681_113853202 | 3300025923 | Switchgrass Rhizosphere | QGGATVQDVVHQVFVTVVGVTFTLLAVGLTGVIILLVTDRDTAHTDTRSA |
| Ga0207694_100215412 | 3300025924 | Corn Rhizosphere | VQQVVHSVFFTVVSVVTTLLTMGLTGVIILLVTNGDTPQADTRHGH |
| Ga0207659_100860343 | 3300025926 | Miscanthus Rhizosphere | VQDVVHQVFVTVVGVTFTLLAVGLTGVIILLVTDRDTAHTDTRSA |
| Ga0207659_110946331 | 3300025926 | Miscanthus Rhizosphere | VQQVVHSVFFTVVSVVATLLTVGLTGVIILLVTNGDTSHADSRRRPTSV |
| Ga0207701_102534192 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | VPGGVLVQQVVHSVFFTVVSVVATLLTVGLTGVILLLVTDRDTPYTESPAEPTSV |
| Ga0207644_100327603 | 3300025931 | Switchgrass Rhizosphere | VQQVVHSVFFTVVSVVATLLTVGLTGVIILLVTDGDTPHADTRHRH |
| Ga0207691_101176474 | 3300025940 | Miscanthus Rhizosphere | GGGLVQQVVHSVFFTVVSVVATLLTIGLTGVIILLVTDGDTPHADTRPRH |
| Ga0207691_112986351 | 3300025940 | Miscanthus Rhizosphere | VQQVVHSVFFTVVGVVVTLITVGLTGVILLLATDR |
| Ga0207711_106999042 | 3300025941 | Switchgrass Rhizosphere | VQQVVHSVFFTVVSVVATLLTVGLTGVIILLVPTAT |
| Ga0207689_114333781 | 3300025942 | Miscanthus Rhizosphere | VQQVVHSVFFTVVSVVATLLTVGLTGVILLLVTDGDTPHADRRVPH |
| Ga0207651_112998151 | 3300025960 | Switchgrass Rhizosphere | LAVPGGVLVQQVAHSVFFTVVSVVATLLTVGLTGVILLLVTDRDTPYAESPAEPTSV |
| Ga0207651_113543002 | 3300025960 | Switchgrass Rhizosphere | VQQVVHSVFFTVISVVATLLTVGLTGLIILLVTNGDTPRADTRHGH |
| Ga0207712_120727771 | 3300025961 | Switchgrass Rhizosphere | TFQGGATVQDVVHQVFVTVVGVTFTLLAVGLTGVIILLVTDRDTAHTDTRSA |
| Ga0207668_106941722 | 3300025972 | Switchgrass Rhizosphere | VVHSVFFTVVSVVATLLTIGLTGVIILLVTDGDTPHADTRPRH |
| Ga0207677_101094493 | 3300026023 | Miscanthus Rhizosphere | VQQVVHSVFFTVVSVVATLLTIGLTGVIILLVTDGDTPHADTRHRH |
| Ga0207708_105977993 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VHSVFFTVVSVVVTLLTVGITGIILLVVTNGDTPHADSRRAATSV |
| Ga0207676_108126011 | 3300026095 | Switchgrass Rhizosphere | VQQVVHSVFFTVVSVVTTLVTMGLAGVIILLVTNGDTPQADTRHGH |
| Ga0207675_1017439152 | 3300026118 | Switchgrass Rhizosphere | VQQVVHSVFFTVVSVVATLITVGLTGIIILLATNGDTPHTDSRPRA |
| Ga0207683_108674472 | 3300026121 | Miscanthus Rhizosphere | VQQVVHSVFFTVVSVVATLLTVGLTGVILLLVTDRDTPSTESPAEPTSV |
| Ga0207698_123708382 | 3300026142 | Corn Rhizosphere | VQQVVHSVFFTVVSVVATLLTIGLTGVIILLVTDGDTPHAD |
| Ga0268266_112398791 | 3300028379 | Switchgrass Rhizosphere | GGVLVQQVVHSVFFTVVSVVATLLTVGLTGVILLLVTDRDTPYTESPAEPTSV |
| Ga0268265_101656763 | 3300028380 | Switchgrass Rhizosphere | VQQVVHSVFFTVVSVVATLLTLGLTGVIILLATNGDTPHADSRRRPTSV |
| Ga0268264_123363251 | 3300028381 | Switchgrass Rhizosphere | VQQVVHSVFFTVVSVVTTLLTIGLTGVNILLVTNGDTPH |
| Ga0310886_101300852 | 3300031562 | Soil | VQQVVHSVFFTVVGVIVTLLTLGLSGVIILLATNGDTPHTDSRPRATSV |
| Ga0307468_1015926362 | 3300031740 | Hardwood Forest Soil | VQQVVHSVFFTVVSVVATLLTVGLTGLIILLVTNGDTPHADAGHRH |
| Ga0310904_104513352 | 3300031854 | Soil | VQEVVHSVFYTVVGVVATLLTLGLTGVIILLATNGDTPHTDTRSRRGPHTTRAA |
| Ga0310901_103043822 | 3300031940 | Soil | DVVHQVFVTVVGVTFTLLAVGLTGVIILLVTDRDTAHTDTRSA |
| Ga0310906_109474503 | 3300032013 | Soil | VQQVVHSVFFTVVGVVATLLTLGLAGVIILLATNGDTP |
| Ga0315910_107309731 | 3300032144 | Soil | VQEVVHSVFFTVVGVIVTLLTLGLTGVIILLATNGDTPHADTRSRATSV |
| ⦗Top⦘ |