 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F104496 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MKKRTGILINSIIILLGANYESYLLLGAGVLCLSLVLISKTKRDEVKN |
| Number of Associated Samples | 66 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 31.00 % |
| % of genes from short scaffolds (< 2000 bps) | 63.00 % |
| Associated GOLD sequencing projects | 63 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (63.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (24.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (53.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (48.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 83.33% β-sheet: 0.00% Coil/Unstructured: 16.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF08291 | Peptidase_M15_3 | 16.00 |
| PF13392 | HNH_3 | 2.00 |
| PF07603 | DUF1566 | 1.00 |
| PF00145 | DNA_methylase | 1.00 |
| PF14550 | Peptidase_S78_2 | 1.00 |
| PF01555 | N6_N4_Mtase | 1.00 |
| PF05766 | NinG | 1.00 |
| PF09206 | ArabFuran-catal | 1.00 |
| PF05063 | MT-A70 | 1.00 |
| PF04466 | Terminase_3 | 1.00 |
| PF08299 | Bac_DnaA_C | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG4725 | N6-adenosine-specific RNA methylase IME4 | Translation, ribosomal structure and biogenesis [J] | 2.00 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 1.00 |
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 1.00 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 1.00 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 1.00 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 63.00 % |
| All Organisms | root | All Organisms | 37.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 24.00% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 17.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 11.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 10.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 9.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.00% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.00% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.00% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 2.00% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.00% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.00% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.00% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 1.00% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 1.00% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
| 3300007551 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 | Environmental | Open in IMG/M |
| 3300007642 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008339 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020488 | Freshwater microbial communities from Lake Mendota, WI - 17OCT2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020511 | Freshwater microbial communities from Lake Mendota, WI - 15JUL2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020550 | Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| NpDRAFT_105206483 | 3300000929 | Freshwater And Marine | NSISILLGSNYESYLLLGAGVLCLSLVLISKTKRDEVKN* |
| JGI24766J26685_100245836 | 3300002161 | Freshwater And Sediment | MKKRTGILINSIIILLGATYDSYLMLGAGVICLSLVLISKTKXHELKN* |
| B570J40625_1009102831 | 3300002835 | Freshwater | MKKRTGILINSIIILLGATYDSYLMLGAGIICLSLVLISKTKRHELKN* |
| Ga0068876_100005578 | 3300005527 | Freshwater Lake | MKKRTGILINSIIILLGYTYESYLLLAIGAICLSLVLISKTKNYESKR* |
| Ga0068876_100017315 | 3300005527 | Freshwater Lake | MKKRTGILINSIIILLGYTYESYLLLGIGVICLTLVLISKTKRHELKN* |
| Ga0049081_100960971 | 3300005581 | Freshwater Lentic | MKKRTGILINSIIILLGANYESYLLLAAGVLCLSLVLISKTKRDEVT |
| Ga0079957_10022399 | 3300005805 | Lake | MKKRTGILINSIIILLSYTYDSYLMLGAGVICLSLVLISKTKRHELKN* |
| Ga0102877_11745622 | 3300007548 | Estuarine | MKKQTGILINSIIILLGANYESYLLLAAGVLCLSLVLISKT |
| Ga0102881_10928072 | 3300007551 | Estuarine | MKKQTGILINSIIILLGANYESYLLLGAGVLCLSLVLISKTKRDEVKN* |
| Ga0102876_12175131 | 3300007642 | Estuarine | MKKQTGILINSIIILLGANYESYLLLAAGVLCLSLVLISKTKRDEVKN* |
| Ga0114340_10107686 | 3300008107 | Freshwater, Plankton | MKKRTGILINSIIILLGATYDSYLMLGAGVICLSLVLISKTKRHEAKN* |
| Ga0114340_10418143 | 3300008107 | Freshwater, Plankton | MKKRTGILINSIIILLGYTYDSYLMLGAGVLCLSLVIISKTKRHEAKN* |
| Ga0114340_10441314 | 3300008107 | Freshwater, Plankton | MKKRTGILINSIIILLGYTYDSYLMLGAGVICLSLVLISKTKRHELKN* |
| Ga0114340_11204376 | 3300008107 | Freshwater, Plankton | ILINSIIILLGHTYDSYLMLGAGVLCLSLVLISKTKRHELKN* |
| Ga0114340_11792243 | 3300008107 | Freshwater, Plankton | MKKRTGILINSIIILLGATYDSYLMLGAGVICLSLVLISKTK |
| Ga0114343_10528782 | 3300008110 | Freshwater, Plankton | MKKRTGILINSIIILLGATYDSYLMLGAGVICLSLVLISKTKRHELKN* |
| Ga0114344_10257154 | 3300008111 | Freshwater, Plankton | MKKRTGILINLIIILLGYTYDSYLMLGAGVICLSLVLISKTKRHELKN* |
| Ga0114350_10141436 | 3300008116 | Freshwater, Plankton | MKKRTGILINSIIILLGYNYENYLLLGIGAICLTLVLISKTKRHELKN* |
| Ga0114355_100242910 | 3300008120 | Freshwater, Plankton | MEKRTGILINSIIILLGANYESYLLLTAGVLCLSLVLISKSKRDEVKN* |
| Ga0114355_10238109 | 3300008120 | Freshwater, Plankton | FCRNIKTNTMKKRTGILINSIVILLGYTYESYLLLGIGVICLTLVLISKTKRHELKN* |
| Ga0114355_10413716 | 3300008120 | Freshwater, Plankton | MKKRTSILINSIIILLGYTYDSYLMLGAGVLCLSLVIISKTKRHEAKN* |
| Ga0114841_100336518 | 3300008259 | Freshwater, Plankton | MKKRTGILINSIIILLGANYESYLLLGAGVLCLSLVLISKFKRHELKN* |
| Ga0114841_12492873 | 3300008259 | Freshwater, Plankton | MKKRTSILINLIIILLGYTYDNYLMLGAGVICLSLVLISKTKRDEVKN* |
| Ga0114363_10219383 | 3300008266 | Freshwater, Plankton | MKKQTGILINSIIILLGANYESYLLLGAGVLCLSLVLISKTKRDEVTN* |
| Ga0114363_102302010 | 3300008266 | Freshwater, Plankton | MKKRTGILINSIIILLGHTYDSYLMLGAGVICLSLVLISKTKRHELKN* |
| Ga0114363_11341788 | 3300008266 | Freshwater, Plankton | MKKRTGILINSIIILLGANYESYLLLGAGVLCLSLVLISKTKKDEVTN* |
| Ga0114363_12462911 | 3300008266 | Freshwater, Plankton | MKKRTGILINSVIILLGYTYDSYLLLGIGVICLTLVLISKTKRDEVKN* |
| Ga0114878_12233182 | 3300008339 | Freshwater Lake | MEKRTGILINSIIILLGANYESYLLLTAGVLCLSLVLISKSKRDEVTN* |
| Ga0114876_101301513 | 3300008448 | Freshwater Lake | MKKRTGILINSIIILLGATYDSYLMLGAGVICLSLVLISKTKKHELKN* |
| Ga0114876_11642993 | 3300008448 | Freshwater Lake | MKKRTGILINSIIILLGWNYENYLLLGIGAICLTLVLISKSKTHESKR* |
| Ga0114880_10202321 | 3300008450 | Freshwater Lake | MKKRTSILINSIIILLGATYDSYLMLGAGVLCLSLVLISKTKRHELKN* |
| Ga0114880_10933534 | 3300008450 | Freshwater Lake | MKKRTGILINSIIILLGANYESYLLLAAGVLCLSLVLISKTKRDEVKN* |
| Ga0114880_12664871 | 3300008450 | Freshwater Lake | LINSIIILLGANYESYLLLGAGVLCLSLVLISKTKKDEVTN* |
| Ga0105098_100001396 | 3300009081 | Freshwater Sediment | MKKQTGIFINLALIVIGYSYENWLLLGAGVLCLSLVLISKTKRDEVKN* |
| Ga0105103_100669548 | 3300009085 | Freshwater Sediment | MKKRTGILINSIIILLGANYESYLLLGAGVLCLSLVLISKTKRDEATN* |
| Ga0105103_102698741 | 3300009085 | Freshwater Sediment | MKKRTGILINSIIILLGANYESYLLLGAGVLCLSLVLISK |
| Ga0105102_100068849 | 3300009165 | Freshwater Sediment | MKKRTGILINSIIILLGTTYESYLMLGAGVICLSLVIISKTKRHEAKN* |
| Ga0105102_101508594 | 3300009165 | Freshwater Sediment | MKKQTGILINSIIILLGANYESYLLLGAGVLCLSLVLISKTKRDEV |
| Ga0105102_107253763 | 3300009165 | Freshwater Sediment | MKKQTGIFINLALIVIGYSYENWLLFGAGVFCLSLVLISKSKRDEVKN* |
| Ga0105097_101408574 | 3300009169 | Freshwater Sediment | MKKRTGILINSIIILLGANYESYLLLGAGVLCLSLLLISKTKRDEVKN* |
| Ga0105096_104829371 | 3300009170 | Freshwater Sediment | KKRTGILINSIIILLGANYESYLLLGAGVLCLSLVLISKTKRDEVKN* |
| Ga0129333_100351019 | 3300010354 | Freshwater To Marine Saline Gradient | MKKRTGILINSIIILLGANYESYLLLGAGVLCLSLVLISKTKRDEVKN* |
| Ga0129333_103855296 | 3300010354 | Freshwater To Marine Saline Gradient | MEKRTGTLINSVIILLGYSYDNYLMLGAGVFCLTLVLISKSKKHEFKN* |
| Ga0153805_10217954 | 3300012013 | Surface Ice | MKKQTGIFINLALIVIGYSYENWLLFGAGVFCLSLVLISKTKRDELKN* |
| Ga0164293_100220584 | 3300013004 | Freshwater | MKKRTGILINSIIILLGASYDSYLMLGAGVICLSLVLISKTKKHELKN* |
| Ga0164293_101339123 | 3300013004 | Freshwater | MKKRTGILINSIIILLGANYESYLLLAAGVLCLSLVLISKTKRHEVKN* |
| Ga0164293_106776541 | 3300013004 | Freshwater | MKKQTGILINSIIILLGANYESYLLLAAGVLCLSLVLI |
| Ga0164293_106907542 | 3300013004 | Freshwater | MKKRTGILINSIIILLGATYDSYLMLGAGVLCLSLVLISKTKRHELKN* |
| Ga0164292_103726111 | 3300013005 | Freshwater | MKKQTGILINSIIILLGANYESYLLLGAGVLCLSLVLISKTKR |
| Ga0181352_100253712 | 3300017747 | Freshwater Lake | MKKRTGILINSIIILLGATYDSYLMLGASVICLSLVLISKTK |
| Ga0181352_11703311 | 3300017747 | Freshwater Lake | MKKRTGILINSIIILLGANYESYLLLGAGVLCLSLVLIS |
| Ga0181359_12498792 | 3300019784 | Freshwater Lake | MKKRTGILINSIIILLGANYESYLLLGAGVLCLSLVLISKTKRDEVKN |
| Ga0211729_114668793 | 3300020172 | Freshwater | MKKRTGILINSIIILLGYTYESYLLLAIGAICLSLVLISKTKRHEAKK |
| Ga0208051_1021403 | 3300020488 | Freshwater | MKKRTGILINSIIILLGYTYDSYLMLGAGVFCLSLVLISKTKKHEAKN |
| Ga0208593_10067826 | 3300020511 | Freshwater | RTFKQNTMKKRTGILINSIIILLGANYESYLLLAAGVLCLSLVLISKTKRDEVKN |
| Ga0207942_10461243 | 3300020549 | Freshwater | MKKRTGILINSIIILLGATYDSYLMLGAGIICLSLVLISKTKRHELKN |
| Ga0208600_10657852 | 3300020550 | Freshwater | MKKRTGILINSIIILLGANYESYLLLGAGVFCLSLVLISKTKRDE |
| Ga0222714_100907893 | 3300021961 | Estuarine Water | MKKRTGILINSIIILLGANYESYLLLGAGVLCLSLVLISKSKRDAIKN |
| Ga0222713_102058783 | 3300021962 | Estuarine Water | MKKRTGILINSVIILLGYTYESYLLLGIGVICLSLVLISKSKKHEVKN |
| Ga0222712_1001120311 | 3300021963 | Estuarine Water | MKKRTEILINSIIILLGANYESYLLLGAGVLCLSLVLISKTKRDAIKN |
| Ga0222712_102027891 | 3300021963 | Estuarine Water | MKKRTGILINSIIILLGYTYESYLLLGIGVICLSLVLISKSKKHEVKN |
| Ga0181353_10437442 | 3300022179 | Freshwater Lake | MKKRTGILINSIIILLGATYDSYLMLGAGVICLSLVLISKTKRHELKN |
| Ga0181353_10635842 | 3300022179 | Freshwater Lake | MKKRTGILINSIIILLGANYESYLLLGAGVLCLSLVLISKTKRDEVTN |
| Ga0209492_11685283 | 3300027721 | Freshwater Sediment | MKKRTGILINSIIILLGANYESYLLLGAGVLCLSLVLISKT |
| Ga0209972_100284594 | 3300027793 | Freshwater Lake | MKKRTGILINSIIILLGYTYESYLLLAIGAICLSLVLISKTKNYESKR |
| Ga0209972_100588726 | 3300027793 | Freshwater Lake | MKKRTGILINSIIILLGYTYESYLLLGIGVICLTLVLISKTKRHELKN |
| Ga0209229_100223956 | 3300027805 | Freshwater And Sediment | MKKRTGILINSIIILLGYTYDSYLMLGAGIICLSLVLISKTKRHELKN |
| Ga0209820_100220614 | 3300027956 | Freshwater Sediment | MKKQTGIFINLALIVIGYSYENWLLLGAGVLCLSLVLISKTKRDEVKN |
| Ga0209820_10690234 | 3300027956 | Freshwater Sediment | MKKRTGILINSIIILLGANYESYLLLGAGVLCLSLVLISKTKRDEATN |
| Ga0119945_10089081 | 3300029933 | Aquatic | FKIKRNTMKKRTGILINSIIILLGWNYENYLLLGIGAICLTLVLISKSKRYESKR |
| Ga0315907_1003000111 | 3300031758 | Freshwater | MKKRTGILINSIIILLGYNYENYLLLGIGAICLTLVLISKTKRHELKN |
| Ga0315907_108442463 | 3300031758 | Freshwater | MKKQTGILINSIIILLGANYESYLLLGAGVLCLSLVLISKTKRDEVTN |
| Ga0315900_106796784 | 3300031787 | Freshwater | MKKRTGILINSIIILLGATYDSYLMLGAGVICLSLVLISKTKRHEAKN |
| Ga0315909_1003075111 | 3300031857 | Freshwater | MEKRTGILINSIIILLGANYESYLLLTAGVLCLSLVLISKSKRDEVKN |
| Ga0315909_103720816 | 3300031857 | Freshwater | MKKRTGILINSIIILLGANYESYLLLGAGVLCLSLVLISKTKRHEVKN |
| Ga0315909_103743111 | 3300031857 | Freshwater | MKKRTGILINSIIILLGHTYDSYLMLGAGVICLSLVLISKTKRHELKN |
| Ga0315904_114451963 | 3300031951 | Freshwater | MKKRTGILINSVIILLGYTYDSYLLLGIGVICLTLVLISKTKRDEVKN |
| Ga0315906_108744232 | 3300032050 | Freshwater | MEKRTGILINSIIILLGANYESYLLLTAGVLCLSLVLISKSKRDEVTN |
| Ga0315902_100895301 | 3300032093 | Freshwater | TSIMKKRTGILINSVIILLGYTYDSYLLLGIGVICLTLVLISKTKRDEVKN |
| Ga0315903_106432093 | 3300032116 | Freshwater | MKKRTGILINSIIILLGANYESYLLLGAGVLCLSLVLISKTKRDE |
| Ga0316616_1043959852 | 3300033521 | Soil | MKKRTGILINSIIILLGYNYENYLLLGIGAICLTLVLISKSKRH |
| Ga0334980_0018230_2259_2405 | 3300033816 | Freshwater | MKKRTGILINSIIILLGASYDSYLMLGAGVICLSLVLISKTKKHELKN |
| Ga0334982_0445415_473_580 | 3300033981 | Freshwater | ILLGANYESYLLLAAGVLCLSLVLISKTKRDELKN |
| Ga0334996_0188934_81_227 | 3300033994 | Freshwater | MKKQTGILINSIIILLGANYESYLLLGAGVLCLSLVLISKTKRDEVKN |
| Ga0334979_0018637_4181_4327 | 3300033996 | Freshwater | MKKRTGILINSIIILLGANYESYLLLAAGVLCLSLVLISKTKRHEVKN |
| Ga0334979_0193075_384_530 | 3300033996 | Freshwater | MKKQTGILINSIIILLGANYESYLLLGAGVLCLSLVLISKTKRDEATN |
| Ga0334986_0599966_410_523 | 3300034012 | Freshwater | IIILLGANYESYLLLGAGVLCLSLVLISKTKRDEVKN |
| Ga0334998_0048007_428_574 | 3300034019 | Freshwater | MKKRTGILINSIIILLGATYDSYLMLGAGVLCLSLVLISKTKRHELKN |
| Ga0334987_0010913_3559_3705 | 3300034061 | Freshwater | MKKRTGILINSIIILLGYTYDSYLMLGAGVICLSLVLISKTKRHELKN |
| Ga0334995_0130799_389_535 | 3300034062 | Freshwater | MKKQTGILINSIIILLGANYESYLLLGAGVFCLSLVLISKTKRDEVKN |
| Ga0335020_0359809_194_340 | 3300034082 | Freshwater | MKKRTGILINSIIILLGATYDSYLMLGAGVICLSLALISKTKRHELKN |
| Ga0335031_0000498_1695_1841 | 3300034104 | Freshwater | MKKRTGILINSIIILLGANYESYLLLAAGVLCLSLVLISKTKRDEVTN |
| Ga0335031_0053729_1970_2116 | 3300034104 | Freshwater | MKKRTGILINSIIILLGYTYDSYLMLGAGVICLSLVLISKTKRHESKR |
| Ga0335036_0035616_2171_2317 | 3300034106 | Freshwater | MKKRTGILINSIIILLGANYESYLLLGAGVLCLSLVLISKTKRHELKN |
| Ga0335036_0192885_1239_1385 | 3300034106 | Freshwater | MKKQTGIFINLALIVIGYSYENWLLFGAGVFCLSLVLISKTKRDEVKN |
| Ga0335054_0492591_276_422 | 3300034119 | Freshwater | MKKQTGIFINLALIVIGYSYESYLLLAAGVLCLSLVLISKTKRDEVKN |
| Ga0335054_0546812_1_114 | 3300034119 | Freshwater | MKKRTGILINSIIILLGANYESYLLLGAGVLCLSLVLI |
| Ga0335056_0403510_2_127 | 3300034120 | Freshwater | LINSIIILLGANYESYLLLGAGVLCLSLVLISKTKRDEVKN |
| Ga0335056_0518217_3_116 | 3300034120 | Freshwater | MKKQTGILINSIIILLGANYESYLLLGAGVFCLSLVLI |
| Ga0334997_0039228_742_888 | 3300034280 | Freshwater | MKKQTGILINSIIILLGANYESYLLLAAGVLCLSLVLISKTKRNEVKN |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |