 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F104485 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MKFILLSITMISVSCGTEVMAEPEQMIIKQEVEKSILSTPIVGSGFCCL |
| Number of Associated Samples | 73 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 12.20 % |
| % of genes near scaffold ends (potentially truncated) | 4.00 % |
| % of genes from short scaffolds (< 2000 bps) | 36.00 % |
| Associated GOLD sequencing projects | 66 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.25 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (59.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine (26.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (76.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (94.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 32.47% β-sheet: 0.00% Coil/Unstructured: 67.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF00106 | adh_short | 6.00 |
| PF13432 | TPR_16 | 2.00 |
| PF02698 | DUF218 | 1.00 |
| PF13463 | HTH_27 | 1.00 |
| PF02321 | OEP | 1.00 |
| PF00127 | Copper-bind | 1.00 |
| PF13524 | Glyco_trans_1_2 | 1.00 |
| PF04932 | Wzy_C | 1.00 |
| PF05433 | Rick_17kDa_Anti | 1.00 |
| PF00462 | Glutaredoxin | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 2.00 |
| COG1434 | Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 family | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
| COG2949 | Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycin | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
| COG3307 | O-antigen ligase | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 59.00 % |
| All Organisms | root | All Organisms | 41.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10021286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 3779 | Open in IMG/M |
| 3300001348|JGI20154J14316_10019132 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 3869 | Open in IMG/M |
| 3300001348|JGI20154J14316_10125572 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 747 | Open in IMG/M |
| 3300001352|JGI20157J14317_10144288 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 754 | Open in IMG/M |
| 3300001355|JGI20158J14315_10108415 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 933 | Open in IMG/M |
| 3300001947|GOS2218_1023559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → unclassified Nitrosomonadales → OM43 clade | 1476 | Open in IMG/M |
| 3300005086|Ga0072334_10237110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → unclassified Nitrosomonadales → OM43 clade | 642 | Open in IMG/M |
| 3300007637|Ga0102906_1042876 | All Organisms → cellular organisms → Bacteria | 1322 | Open in IMG/M |
| 3300009076|Ga0115550_1200003 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 673 | Open in IMG/M |
| 3300009434|Ga0115562_1110588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → unclassified Nitrosomonadales → OM43 clade | 1072 | Open in IMG/M |
| 3300009472|Ga0115554_1114727 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 1136 | Open in IMG/M |
| 3300009472|Ga0115554_1139604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → unclassified Nitrosomonadales → OM43 clade | 1007 | Open in IMG/M |
| 3300009496|Ga0115570_10434717 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 555 | Open in IMG/M |
| 3300009505|Ga0115564_10635507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → unclassified Nitrosomonadales → OM43 clade | 500 | Open in IMG/M |
| 3300009508|Ga0115567_10576916 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300017786|Ga0181424_10343247 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300020169|Ga0206127_1055415 | All Organisms → cellular organisms → Bacteria | 1962 | Open in IMG/M |
| 3300020169|Ga0206127_1224275 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300020182|Ga0206129_10273273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → unclassified Nitrosomonadales → OM43 clade | 696 | Open in IMG/M |
| 3300020187|Ga0206130_10047252 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3105 | Open in IMG/M |
| 3300020187|Ga0206130_10177872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → unclassified Nitrosomonadales → OM43 clade | 1059 | Open in IMG/M |
| 3300020187|Ga0206130_10339849 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 628 | Open in IMG/M |
| 3300020438|Ga0211576_10318921 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 805 | Open in IMG/M |
| 3300020595|Ga0206126_10363193 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300021365|Ga0206123_10437865 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 532 | Open in IMG/M |
| 3300021957|Ga0222717_10055872 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 2547 | Open in IMG/M |
| 3300021957|Ga0222717_10336230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → unclassified Nitrosomonadales → OM43 clade → Methylophilales bacterium MBRS-H7 | 852 | Open in IMG/M |
| 3300024180|Ga0228668_1086076 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 572 | Open in IMG/M |
| 3300024221|Ga0228666_1010205 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 2599 | Open in IMG/M |
| (restricted) 3300024264|Ga0233444_10461804 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 513 | Open in IMG/M |
| 3300024322|Ga0228656_1091380 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 655 | Open in IMG/M |
| 3300024329|Ga0228631_1124692 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 587 | Open in IMG/M |
| 3300025621|Ga0209504_1071373 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 981 | Open in IMG/M |
| 3300025640|Ga0209198_1113015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → unclassified Nitrosomonadales → OM43 clade | 819 | Open in IMG/M |
| 3300025860|Ga0209119_1174690 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 859 | Open in IMG/M |
| 3300025880|Ga0209534_10160307 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300025880|Ga0209534_10263173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → unclassified Nitrosomonadales → OM43 clade | 817 | Open in IMG/M |
| 3300025880|Ga0209534_10286026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → unclassified Nitrosomonadales → OM43 clade | 767 | Open in IMG/M |
| 3300025886|Ga0209632_10281453 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 837 | Open in IMG/M |
| 3300026460|Ga0247604_1054856 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 955 | Open in IMG/M |
| 3300032073|Ga0315315_11609365 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | 559 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 26.00% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 21.00% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 16.00% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 15.00% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 4.00% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 3.00% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 3.00% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.00% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.00% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.00% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.00% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.00% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.00% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.00% |
| Water | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Water | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
| 3300001348 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 | Environmental | Open in IMG/M |
| 3300001349 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 | Environmental | Open in IMG/M |
| 3300001351 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 | Environmental | Open in IMG/M |
| 3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
| 3300001354 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 | Environmental | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300001947 | Marine microbial communities from the Gulf of Maine, Canada - GS002 | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300005086 | Microbial Community from Halfdan Field MHDA3 | Environmental | Open in IMG/M |
| 3300007637 | Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02 | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300009049 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
| 3300009440 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 | Environmental | Open in IMG/M |
| 3300009443 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 | Environmental | Open in IMG/M |
| 3300009445 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
| 3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300024180 | Seawater microbial communities from Monterey Bay, California, United States - 82D | Environmental | Open in IMG/M |
| 3300024221 | Seawater microbial communities from Monterey Bay, California, United States - 80D | Environmental | Open in IMG/M |
| 3300024231 | Seawater microbial communities from Monterey Bay, California, United States - 43D | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024260 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_135_MG | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300024293 | Seawater microbial communities from Monterey Bay, California, United States - 63D | Environmental | Open in IMG/M |
| 3300024322 | Seawater microbial communities from Monterey Bay, California, United States - 68D | Environmental | Open in IMG/M |
| 3300024329 | Seawater microbial communities from Monterey Bay, California, United States - 39D | Environmental | Open in IMG/M |
| 3300024428 | Seawater microbial communities from Monterey Bay, California, United States - 32D | Environmental | Open in IMG/M |
| 3300025590 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 (SPAdes) | Environmental | Open in IMG/M |
| 3300025621 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes) | Environmental | Open in IMG/M |
| 3300025636 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025637 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 (SPAdes) | Environmental | Open in IMG/M |
| 3300025640 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes) | Environmental | Open in IMG/M |
| 3300025809 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes) | Environmental | Open in IMG/M |
| 3300025832 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 (SPAdes) | Environmental | Open in IMG/M |
| 3300025860 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 (SPAdes) | Environmental | Open in IMG/M |
| 3300025870 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025874 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 (SPAdes) | Environmental | Open in IMG/M |
| 3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025894 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes) | Environmental | Open in IMG/M |
| 3300026460 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 85R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026503 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026504 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 46R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026511 | Seawater microbial communities from Monterey Bay, California, United States - 27D | Environmental | Open in IMG/M |
| 3300027833 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028008 | Seawater microbial communities from Monterey Bay, California, United States - 1D_r | Environmental | Open in IMG/M |
| 3300028130 | Seawater microbial communities from Monterey Bay, California, United States - 22D | Environmental | Open in IMG/M |
| 3300028133 | Seawater microbial communities from Monterey Bay, California, United States - 10D | Environmental | Open in IMG/M |
| 3300028134 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100212864 | 3300000101 | Marine | MKLILLSITMISVSCGTEVMGEPEQGIIKQEVEKSIVITPIGDSGLFCL* |
| JGI20151J14362_100352185 | 3300001346 | Pelagic Marine | MKFILLSIMMISVSCGTEVMAEQEQIIIKQELEKSILYTPIRGSRLFFL* |
| JGI20151J14362_100621723 | 3300001346 | Pelagic Marine | MKFILLFISMISVSCGSEVMAEPEHKIIKKELEKSILSTSIGGSGFCCL* |
| JGI20151J14362_101446813 | 3300001346 | Pelagic Marine | MKLILLSITMISVSCGTEVMAEPGQRIIKQEVEKSIVITPIGDSGLFCL* |
| JGI20154J14316_100191329 | 3300001348 | Pelagic Marine | MKLILLSITMISVSCGTEVMAEPEQIITKQEVEKSILYAPIGESGFCCL* |
| JGI20154J14316_100494622 | 3300001348 | Pelagic Marine | MISVSFGKEVMAEPEQMIIKQEVEKSILSTPIGGSEFCCL* |
| JGI20154J14316_100816564 | 3300001348 | Pelagic Marine | MKLILLSITMISVSCGTEVMGEPGQGIIKQEVEKSIVITPIGDSGLFCL* |
| JGI20154J14316_101112902 | 3300001348 | Pelagic Marine | MKFILLSITMISVSCGTEVMAEPGQRIIKQEVEKSIVITPIGDSGLFCL* |
| JGI20154J14316_101255723 | 3300001348 | Pelagic Marine | MKFILLSITMISVSCGTEVMAEPEQSIIKQEVEKSILCSPIGGSGLYCL* |
| JGI20160J14292_101027182 | 3300001349 | Pelagic Marine | MKFILLFISMISVSCGXEVMAEPEHKIIKKELEKSILSTSIGGSGFCCL* |
| JGI20153J14318_100832461 | 3300001351 | Pelagic Marine | MKFTLLFITMISVICGTEVMAVPEQIIIKQEVEKSILSTQIV |
| JGI20157J14317_101331853 | 3300001352 | Pelagic Marine | MKFILLSITMISVSCGTEVIAEPERLIIKQEVEKSIFPSQIVGLGFCCYKLLILI |
| JGI20157J14317_101442882 | 3300001352 | Pelagic Marine | MISVSCGTELMAEPEQNVIEQVVEKSILCAPIGESGFCCL* |
| JGI20155J14468_102318351 | 3300001354 | Pelagic Marine | GTEVMAEPEHKIIKKELEKSILSTSIGGSGFCCL* |
| JGI20158J14315_100902673 | 3300001355 | Pelagic Marine | MKFILLSITMISVSCGTEVMAEPGQRGINQKVEKSILFTPIGGSGSYYL* |
| JGI20158J14315_101084153 | 3300001355 | Pelagic Marine | MKFILLSITMISVSCGTEVMAEPEQIIIKQDVEKSILCAPIGESGFCYL* |
| GOS2218_10235594 | 3300001947 | Marine | MKLILLSITMISVSCGTEVMGEPEQVIIKQEVEKSIVITPIGGSGLFCL* |
| Ga0055584_1022841152 | 3300004097 | Pelagic Marine | VKFILLTISVISVSCGTEVMAEVEQNNIIQKEEKSIVFTSIRYSELFFL* |
| Ga0072334_102371102 | 3300005086 | Water | MKFILLSITMISVSCGTEVMAEPDQMIIKQEVEKSILSTPIGGSEFCCL* |
| Ga0102906_10428761 | 3300007637 | Estuarine | MISVSCGTEVMAEPEQKIIKKELEKSILSTSIGGSGFCL* |
| Ga0105748_105599642 | 3300007992 | Estuary Water | MISVSCGTEVMAEPEHKIIKKELEKSILSTSIGGSGFCCL* |
| Ga0102911_11788541 | 3300009049 | Estuarine | KFILLSITMISVSCGTEVIAEPEQMIIKQEVKKSIFSPPIVGSGFCCL* |
| Ga0115566_108263051 | 3300009071 | Pelagic Marine | ISMISVSCGTEVVAEPGQKIVIQEAEKPIVLTSIEDLLI* |
| Ga0115550_12000033 | 3300009076 | Pelagic Marine | MISVSCGTEVMVEPEQIIIKQEVEKSILFAPTGESGFCCL* |
| Ga0115551_12313502 | 3300009193 | Pelagic Marine | MISVSCGTEVMAEPGQRGINQKVEKSILFTPIGGSGSYYL* |
| Ga0115551_13428622 | 3300009193 | Pelagic Marine | MISVSCGTEVMAEPEHKIIKKELEKSILSTSIGG* |
| Ga0115562_11105882 | 3300009434 | Pelagic Marine | MISVSCGTEVMAEPGQRIIKQEVEKSIVITPIGDSGLFSL* |
| Ga0115561_10684933 | 3300009440 | Pelagic Marine | MISVSCGTEVMAEPGQRIIKQEVEKSIVITPIGDSGLFCL* |
| Ga0115557_13228021 | 3300009443 | Pelagic Marine | MISVSCGTEVMAEPEQIIIKQEVEKSILFAPIGESGFCCL* |
| Ga0115553_12784473 | 3300009445 | Pelagic Marine | VSCGTEVMAEPEQIIIKQELEKSILFAPIGESGFCCL* |
| Ga0115553_13412572 | 3300009445 | Pelagic Marine | MISVSCGTEVMAEPGQRIIKQEVEMSIVITPIGDSGLFCL* |
| Ga0115554_11147273 | 3300009472 | Pelagic Marine | MKFILFSITMISVSCGTEVMAEPEQSIIKQEVEKSILCSPIGGSGLYCL* |
| Ga0115554_11396042 | 3300009472 | Pelagic Marine | MKLILLSITLISVSCGTEVMGEPEQRIIKQEVEKSIVITPIGDSGLFCL* |
| Ga0115570_104347172 | 3300009496 | Pelagic Marine | MISVSCGTEVMAEPGQIIIKQELEKSILFAPTGESGFCCL* |
| Ga0115564_106355072 | 3300009505 | Pelagic Marine | MKLILLSITMISVSCGTEVMGEPEQRIIKQEVEKSIVITPIGDSGLFCL* |
| Ga0115572_102448512 | 3300009507 | Pelagic Marine | MISVSCGTEVMGEPEQRVIKQEVEKSISYTPIGSSRLYCS* |
| Ga0115567_105769161 | 3300009508 | Pelagic Marine | FILLSITMISVSCGTEVMAEPEQSVIKQEVEKSILSTPIGESGFCYL* |
| Ga0181424_103432471 | 3300017786 | Seawater | VSCGTEVMAEPEHKIIKKELEKSILSTSIGGSGFCCL |
| Ga0206125_101245122 | 3300020165 | Seawater | MISVSCGTEVMAEPGQRIIKQEVEKSIVITPIGDSGLFCL |
| Ga0206127_10554151 | 3300020169 | Seawater | MISVSCGTEVMAEPEQSIIKQAVEKSFLCSPRGGSGLYCL |
| Ga0206127_10759042 | 3300020169 | Seawater | MKLILLSITMISVSCGTEVMAEPGQRIIKQEVEKSIVITPIGDSGLFCL |
| Ga0206127_12242753 | 3300020169 | Seawater | MISVSCGTELMAEPEQIVIKQVVEKSILCAPIGESGFCCL |
| Ga0206129_100299996 | 3300020182 | Seawater | MKFILLSIMMISVSCGTEVMAEQEQIIIKQELEKSILYTPIRGSRLFFL |
| Ga0206129_102732733 | 3300020182 | Seawater | MKFILLSIKMISVSFGKEVMAEPEQMIIKQEVEKSILSTPIGGSEFCCL |
| Ga0206131_101481493 | 3300020185 | Seawater | MKLILFSITMISVSCGTEVMVEPEQIIIKQEVEKSILFAPTGESGFCCL |
| Ga0206131_103700793 | 3300020185 | Seawater | MKLILLSITMISVSCGTEVMAEPGQRIIKQEVEKSIVITPIGDSG |
| Ga0206130_100472524 | 3300020187 | Seawater | MKFILLSITMISVSCGTEVMAEPEQSIIKQEVEKSILCSPIGGSGLYCL |
| Ga0206130_101165713 | 3300020187 | Seawater | MKFILLSITMISVSCGTEVMAEPEQMIIKQEVEKSILSTPIVGSGFCCL |
| Ga0206130_101778722 | 3300020187 | Seawater | MISVSCGTEVMGEPEQRVIKQEVEKSISYTPIGSSRLYCS |
| Ga0206130_103398492 | 3300020187 | Seawater | MISVSCGTEVMAASEQMIINHEVEIYILFTPIRDSGFCCL |
| Ga0211677_102288633 | 3300020385 | Marine | MKFILFTISIISVSCGTEVMAKPEQMIVIQEAEKPILLTPIEDSGLYCI |
| Ga0211576_103189213 | 3300020438 | Marine | MKFVLLSITIISVGCGTEVMPVPEQRIIKQEVEKSILGA |
| Ga0206126_103631931 | 3300020595 | Seawater | ILLSITMISVSCGTEVMAEPEQSIIKQEVEKSILCSPIGGSGLYCL |
| Ga0206126_103988732 | 3300020595 | Seawater | MISVSCGTEVMAEPGQRGINQKVEKSILFTPIGGSGSYYL |
| Ga0206677_100551465 | 3300021085 | Seawater | MKFILLFISMISVSCGTEVMAEPEHKIIKKELEKSILSTSIGGSGFCCL |
| Ga0206123_102776143 | 3300021365 | Seawater | MISVSCGTEVMAEPEHKIIKKELEKSILSTSIGGSGFCCL |
| Ga0206123_104378652 | 3300021365 | Seawater | MISVSCGTEVMAEPEQIIIKQELEKSILFAPTGESGFCCL |
| Ga0222717_100558724 | 3300021957 | Estuarine Water | MKFMLLSITMISISCGTEVMAEPEQIIVKQEVEKSILCVPIWESGFCCL |
| Ga0222717_103362302 | 3300021957 | Estuarine Water | MISVSCGTEIRAEPGQRIINQKVEKPILCSPIGTFGFYYL |
| Ga0222716_107680433 | 3300021959 | Estuarine Water | ILFTISIISVSCGTEVMAEPEQMIVIQEAEKPIVLTPIED |
| Ga0228668_10860762 | 3300024180 | Seawater | MMICVSCGTEGMAEPEQMIIKHEEEISILCTPIEDSGFCYL |
| Ga0228666_10102057 | 3300024221 | Seawater | MKFILLFISMISVSCGTEVMAEPEHKIIKKELGKSILSTSIGGSGFCCL |
| Ga0233399_10775033 | 3300024231 | Seawater | MISVSCGTEVMAEPEQIIIKQELEKSILFAPIGESEFCCL |
| (restricted) Ga0233438_101016713 | 3300024255 | Seawater | MKFILLSITMISVSCGTEVMAEPEQIIIKQDVEKSILCAPIGESGFLLFMSF |
| (restricted) Ga0233441_11744743 | 3300024260 | Seawater | MISVSCGTEVIAEPEQMIIKQEVKKSIFSPPIVGSGFC |
| (restricted) Ga0233444_103190093 | 3300024264 | Seawater | MKFILLSITMISVSCGTEVIAVPEQMIIKQEVEKSIFFSPI |
| (restricted) Ga0233444_104618042 | 3300024264 | Seawater | MISVSCGTEVMAEPEQIIIKQQVEKSILCAPIGESGFCCL |
| Ga0228651_10659911 | 3300024293 | Seawater | MKFILFSITMIPVSCGTEVMAEPEQIIIKQELEKSIL |
| Ga0228656_10913802 | 3300024322 | Seawater | MISVSCGTEVMAEPEQIIIKQEVEKSISLTPIEESGFCCI |
| Ga0228631_11246922 | 3300024329 | Seawater | MMICVSCGTEGMAEPEQMIIKHEVEISILCTPIEDSGFCYL |
| Ga0233396_10542521 | 3300024428 | Seawater | FISMISVSCGTEVMAEPEQKIIKKELEKSILSTSIGGSGFCCL |
| Ga0209195_10524053 | 3300025590 | Pelagic Marine | MKLILLSITMISVSCGTEVMGEPEQGIIKQEVEKSIVITPIGDSGLFCL |
| Ga0209504_10713733 | 3300025621 | Pelagic Marine | MISVSCGTEVMAEPEQIITKQEVEKSILYAPIGESGFCCL |
| Ga0209136_11425511 | 3300025636 | Marine | MKFILLFISMISVSCGTEVMAEPEQKIIKKELEKSILSTSIGGSGFCCL |
| Ga0209197_11558213 | 3300025637 | Pelagic Marine | MKFILLSISMISVSCGTEVIAESEQMIIKQEVEKSFFS |
| Ga0209198_11130152 | 3300025640 | Pelagic Marine | MKLILLSITMISVSCGTEVMGEPEQGIIKQEVEKSIVITPIGDSELFCL |
| Ga0209199_10321496 | 3300025809 | Pelagic Marine | MKFILLFISMISVSCGSEVMAEPEHKIIKKELEKSILSTSIGGSGFCCL |
| Ga0209307_11759583 | 3300025832 | Pelagic Marine | MKFILLSIMMISVSCGTEVMAEQEQIIIKQELEKSILSTS |
| Ga0209119_11746903 | 3300025860 | Pelagic Marine | MKLILLSITMISVSCGTEVMAEPEQIITKQEVEKSILYAPIGESGFCCL |
| Ga0209666_11968353 | 3300025870 | Marine | MISVSCGTEVMAEPEHKIIKKELKKSILSTSIGGSGFCCL |
| Ga0209533_10361954 | 3300025874 | Pelagic Marine | MISVSFGKEVMAEPEQMIIKQEVEKSILSTPIGGSEFCCL |
| Ga0209533_12755111 | 3300025874 | Pelagic Marine | MISVSCGTEVVAEPGQKIVIQEAEKPIVLTSIEDLLI |
| Ga0209534_101603074 | 3300025880 | Pelagic Marine | MISVSCGTEVMAEPGHRGINQKVEKSILSTSIGGSRLYYL |
| Ga0209534_102631732 | 3300025880 | Pelagic Marine | MISVSCGTKVMAELEKRIIKKEVEKSILSTPIGGSG |
| Ga0209534_102860262 | 3300025880 | Pelagic Marine | MKFILVSITMISFSCGTKAMAEPEQRIIKKEIEKSILCAPMGDS |
| Ga0209534_102934091 | 3300025880 | Pelagic Marine | MKFILLSITMISVSCGTEVMAEPGQRIIKQEVEKSIVITPIGDSG |
| Ga0209632_101052584 | 3300025886 | Pelagic Marine | MKFILLSITMISVSCGTEVMAEPGQRIIKQEVEKSIVITPIGDSGLFCL |
| Ga0209632_102814533 | 3300025886 | Pelagic Marine | MISVSCGTEVMAEPEQIIIKQEQEKFILFAPIVESGFCCL |
| Ga0209335_100737533 | 3300025894 | Pelagic Marine | MKFILLSITMISVSCGTEVIAEPERLIIKQEVEKSIFPSQIVGLGFCCYK |
| Ga0247604_10548563 | 3300026460 | Seawater | MKFVLLFITIISVGCGTEVMPEPEQRIIKQEVEKSILGA |
| Ga0247605_10554672 | 3300026503 | Seawater | MISVSCGSEVMAEPEQIIIKQEVEKSILLTPIEESGFCCI |
| Ga0247587_11255513 | 3300026504 | Seawater | MISVSCGTELMAEPEQIVIEQVVEKSILCAPIGESGFCCL |
| Ga0233395_11194573 | 3300026511 | Seawater | LLFISMISVSCGTEVMAEPEHKIIKKELEKSILSTSIGGSGFCCL |
| Ga0209092_103789671 | 3300027833 | Marine | SCGTEVMAEPGQRIIKQEVEKSIVITPIGDSGLFCL |
| Ga0228674_12717782 | 3300028008 | Seawater | MISVSCGTEVMAEPGQRGINQKLEKSILSTPIGGSGSYYL |
| Ga0228619_10455151 | 3300028130 | Seawater | ISMISVSCGTEVMAEPEHKIIKKELEKSILSTSIGGSGFCCL |
| Ga0228609_11523442 | 3300028133 | Seawater | MKFILLSIMLISVSCGTEVMAEPGQRGINQKLEKSILSTPIGGSGSYYL |
| Ga0256411_12770552 | 3300028134 | Seawater | MKFVLLSITIISVGCGTEVMPEPEQRIIKQEVEKSILGA |
| Ga0315316_104594501 | 3300032011 | Seawater | MISVSCGTELMSEPDQIIIIQEPEKPVVLTLIEDSGS |
| Ga0315315_116093651 | 3300032073 | Seawater | MKFILFTISIISVSCGTEVMAEPEKMIVIKEAEKPIVLISIEDSGLYCI |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |