| Basic Information | |
|---|---|
| Family ID | F104460 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 48 residues |
| Representative Sequence | LSQQVMIEALYQEIIGVLEKFDEALPLASVVGVLEVIKYQLLNNTEEDE |
| Number of Associated Samples | 56 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 79.00 % |
| % of genes near scaffold ends (potentially truncated) | 30.00 % |
| % of genes from short scaffolds (< 2000 bps) | 82.00 % |
| Associated GOLD sequencing projects | 54 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (37.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater (24.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (57.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (67.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 83.67% β-sheet: 0.00% Coil/Unstructured: 16.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF09588 | YqaJ | 44.00 |
| PF13392 | HNH_3 | 19.00 |
| PF00959 | Phage_lysozyme | 3.00 |
| PF05772 | NinB | 1.00 |
| PF13489 | Methyltransf_23 | 1.00 |
| PF00725 | 3HCDH | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.00 % |
| Unclassified | root | N/A | 37.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005525|Ga0068877_10470618 | Not Available | 699 | Open in IMG/M |
| 3300005527|Ga0068876_10058343 | All Organisms → Viruses → Predicted Viral | 2342 | Open in IMG/M |
| 3300005527|Ga0068876_10112087 | All Organisms → Viruses → Predicted Viral | 1621 | Open in IMG/M |
| 3300005527|Ga0068876_10143098 | Not Available | 1408 | Open in IMG/M |
| 3300005527|Ga0068876_10269255 | Not Available | 973 | Open in IMG/M |
| 3300005528|Ga0068872_10080474 | Not Available | 1975 | Open in IMG/M |
| 3300005581|Ga0049081_10037537 | All Organisms → Viruses → Predicted Viral | 1841 | Open in IMG/M |
| 3300005581|Ga0049081_10133036 | Not Available | 916 | Open in IMG/M |
| 3300005581|Ga0049081_10221400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
| 3300005662|Ga0078894_10181835 | All Organisms → Viruses → Predicted Viral | 1899 | Open in IMG/M |
| 3300005758|Ga0078117_1093362 | All Organisms → Viruses → Predicted Viral | 2687 | Open in IMG/M |
| 3300005805|Ga0079957_1034004 | All Organisms → Viruses → Predicted Viral | 3330 | Open in IMG/M |
| 3300005805|Ga0079957_1129950 | All Organisms → Viruses → Predicted Viral | 1315 | Open in IMG/M |
| 3300005805|Ga0079957_1286591 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300007973|Ga0105746_1166916 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 746 | Open in IMG/M |
| 3300008107|Ga0114340_1172156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 768 | Open in IMG/M |
| 3300008111|Ga0114344_1146613 | All Organisms → Viruses → Predicted Viral | 1275 | Open in IMG/M |
| 3300008114|Ga0114347_1014952 | All Organisms → Viruses → Predicted Viral | 3777 | Open in IMG/M |
| 3300008116|Ga0114350_1040221 | All Organisms → Viruses → Predicted Viral | 1776 | Open in IMG/M |
| 3300008116|Ga0114350_1070811 | Not Available | 1190 | Open in IMG/M |
| 3300008116|Ga0114350_1096116 | All Organisms → Viruses → Predicted Viral | 1578 | Open in IMG/M |
| 3300008116|Ga0114350_1139990 | Not Available | 694 | Open in IMG/M |
| 3300008120|Ga0114355_1085555 | All Organisms → Viruses → Predicted Viral | 2142 | Open in IMG/M |
| 3300008262|Ga0114337_1188816 | Not Available | 852 | Open in IMG/M |
| 3300008264|Ga0114353_1152613 | All Organisms → Viruses → Predicted Viral | 1158 | Open in IMG/M |
| 3300008264|Ga0114353_1291038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
| 3300008266|Ga0114363_1018827 | All Organisms → Viruses → Predicted Viral | 4575 | Open in IMG/M |
| 3300008266|Ga0114363_1045761 | All Organisms → Viruses → Predicted Viral | 1765 | Open in IMG/M |
| 3300008266|Ga0114363_1051604 | All Organisms → Viruses → Predicted Viral | 1634 | Open in IMG/M |
| 3300008266|Ga0114363_1077057 | All Organisms → Viruses → Predicted Viral | 1252 | Open in IMG/M |
| 3300008266|Ga0114363_1132757 | All Organisms → cellular organisms → Bacteria → FCB group | 849 | Open in IMG/M |
| 3300008267|Ga0114364_1125815 | All Organisms → cellular organisms → Bacteria → FCB group | 752 | Open in IMG/M |
| 3300008267|Ga0114364_1168996 | Not Available | 574 | Open in IMG/M |
| 3300008448|Ga0114876_1036979 | All Organisms → Viruses → Predicted Viral | 2326 | Open in IMG/M |
| 3300008448|Ga0114876_1077995 | Not Available | 1385 | Open in IMG/M |
| 3300008448|Ga0114876_1184947 | Not Available | 721 | Open in IMG/M |
| 3300008450|Ga0114880_1097151 | Not Available | 1146 | Open in IMG/M |
| 3300008450|Ga0114880_1208585 | All Organisms → cellular organisms → Bacteria → FCB group | 647 | Open in IMG/M |
| 3300008450|Ga0114880_1210127 | All Organisms → cellular organisms → Bacteria → FCB group | 643 | Open in IMG/M |
| 3300010354|Ga0129333_10175994 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1955 | Open in IMG/M |
| 3300010354|Ga0129333_10674527 | Not Available | 891 | Open in IMG/M |
| 3300010354|Ga0129333_10828238 | Not Available | 787 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10651253 | All Organisms → cellular organisms → Bacteria → FCB group | 625 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10151583 | All Organisms → Viruses → Predicted Viral | 1834 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10301628 | Not Available | 1140 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10214130 | All Organisms → cellular organisms → Bacteria → FCB group | 1212 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10686949 | All Organisms → cellular organisms → Bacteria → FCB group | 554 | Open in IMG/M |
| 3300017707|Ga0181363_1021039 | Not Available | 1279 | Open in IMG/M |
| 3300017747|Ga0181352_1042570 | All Organisms → Viruses → Predicted Viral | 1340 | Open in IMG/M |
| 3300017747|Ga0181352_1065597 | All Organisms → Viruses → Predicted Viral | 1033 | Open in IMG/M |
| 3300017747|Ga0181352_1203847 | Not Available | 508 | Open in IMG/M |
| 3300017780|Ga0181346_1032382 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2162 | Open in IMG/M |
| 3300017785|Ga0181355_1295091 | Not Available | 610 | Open in IMG/M |
| 3300019784|Ga0181359_1122341 | All Organisms → cellular organisms → Bacteria → FCB group | 929 | Open in IMG/M |
| 3300020048|Ga0207193_1493892 | All Organisms → cellular organisms → Bacteria → FCB group | 812 | Open in IMG/M |
| 3300020151|Ga0211736_10026521 | Not Available | 1258 | Open in IMG/M |
| 3300020151|Ga0211736_10026556 | Not Available | 1279 | Open in IMG/M |
| 3300020159|Ga0211734_10459822 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1716 | Open in IMG/M |
| 3300020161|Ga0211726_10530879 | Not Available | 529 | Open in IMG/M |
| 3300021961|Ga0222714_10090608 | All Organisms → Viruses → Predicted Viral | 1964 | Open in IMG/M |
| 3300022179|Ga0181353_1050290 | Not Available | 1092 | Open in IMG/M |
| 3300022179|Ga0181353_1052860 | All Organisms → Viruses → Predicted Viral | 1060 | Open in IMG/M |
| 3300022190|Ga0181354_1176237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
| 3300024289|Ga0255147_1000102 | Not Available | 35523 | Open in IMG/M |
| 3300027608|Ga0208974_1024502 | All Organisms → Viruses → Predicted Viral | 1855 | Open in IMG/M |
| 3300027697|Ga0209033_1024894 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2373 | Open in IMG/M |
| 3300027721|Ga0209492_1117726 | Not Available | 933 | Open in IMG/M |
| 3300027764|Ga0209134_10067639 | All Organisms → Viruses → Predicted Viral | 1201 | Open in IMG/M |
| 3300027785|Ga0209246_10109950 | All Organisms → Viruses → Predicted Viral | 1081 | Open in IMG/M |
| 3300027793|Ga0209972_10062366 | All Organisms → Viruses → Predicted Viral | 1982 | Open in IMG/M |
| 3300027816|Ga0209990_10430886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
| (restricted) 3300027977|Ga0247834_1093356 | Not Available | 1372 | Open in IMG/M |
| 3300028025|Ga0247723_1098126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 743 | Open in IMG/M |
| (restricted) 3300028559|Ga0247831_1161371 | Not Available | 877 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1073242 | All Organisms → Viruses → Predicted Viral | 1707 | Open in IMG/M |
| 3300031758|Ga0315907_10814583 | All Organisms → cellular organisms → Bacteria → FCB group | 695 | Open in IMG/M |
| 3300031758|Ga0315907_10896292 | Not Available | 651 | Open in IMG/M |
| 3300031784|Ga0315899_11590039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300031787|Ga0315900_10034617 | Not Available | 5551 | Open in IMG/M |
| 3300031787|Ga0315900_10056969 | All Organisms → Viruses → Predicted Viral | 4070 | Open in IMG/M |
| 3300031787|Ga0315900_10115254 | Not Available | 2573 | Open in IMG/M |
| 3300031787|Ga0315900_10168884 | All Organisms → Viruses → Predicted Viral | 1990 | Open in IMG/M |
| 3300031787|Ga0315900_10202693 | All Organisms → Viruses → Predicted Viral | 1754 | Open in IMG/M |
| 3300031787|Ga0315900_10404652 | All Organisms → Viruses → Predicted Viral | 1075 | Open in IMG/M |
| 3300031787|Ga0315900_10613843 | Not Available | 792 | Open in IMG/M |
| 3300031787|Ga0315900_10698148 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
| 3300031787|Ga0315900_10947623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
| 3300031857|Ga0315909_10041984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 4313 | Open in IMG/M |
| 3300031857|Ga0315909_10048435 | All Organisms → Viruses → Predicted Viral | 3954 | Open in IMG/M |
| 3300031857|Ga0315909_10135349 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2056 | Open in IMG/M |
| 3300031857|Ga0315909_10353623 | Not Available | 1072 | Open in IMG/M |
| 3300031857|Ga0315909_10594163 | Not Available | 741 | Open in IMG/M |
| 3300031951|Ga0315904_10099350 | All Organisms → Viruses → Predicted Viral | 3064 | Open in IMG/M |
| 3300031951|Ga0315904_10891433 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
| 3300031963|Ga0315901_11219493 | Not Available | 508 | Open in IMG/M |
| 3300032093|Ga0315902_10419750 | Not Available | 1200 | Open in IMG/M |
| 3300032116|Ga0315903_10252902 | All Organisms → Viruses → Predicted Viral | 1521 | Open in IMG/M |
| 3300032116|Ga0315903_10595543 | Not Available | 850 | Open in IMG/M |
| 3300032116|Ga0315903_10970846 | Not Available | 598 | Open in IMG/M |
| 3300034106|Ga0335036_0013850 | Not Available | 6577 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 24.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 22.00% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 18.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.00% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 4.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.00% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 3.00% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.00% |
| Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 1.00% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 1.00% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.00% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.00% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.00% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005758 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0068877_104706182 | 3300005525 | Freshwater Lake | LSQQVMIEALYQEIIGVLGKFDEALPLASVVGVLEVIKFQLLNNTEDEE* |
| Ga0068876_100583433 | 3300005527 | Freshwater Lake | VREDGRGLGIQDVGPGDEGLSQQVMIEALYQEIIGVLEKFDEALPLASVVGVLEVIKYQLLNNTEEDE* |
| Ga0068876_101120871 | 3300005527 | Freshwater Lake | LSQQVMIEALYQEIIGVLGKFDEALPLASVVGVLEVIKFQLLNNTEEDE* |
| Ga0068876_101430983 | 3300005527 | Freshwater Lake | MGIQDVGSGDEGLSQQVMIEALYQEIVGVLGKFDEALPLASVVGVLEVIKFQLLNNTEEDE* |
| Ga0068876_102692552 | 3300005527 | Freshwater Lake | MIEALYQEIMGVLEKFDEALPLASVVGVLEVIKFQLLNNTEEDE* |
| Ga0068872_100804743 | 3300005528 | Freshwater Lake | LSQQVMIEALYQEIVGVLGKFDEALPLASVVGVLEVIKFQLLNNTEEDE* |
| Ga0049081_100375376 | 3300005581 | Freshwater Lentic | MIEALYQEIMGVLEKFDEALPLASVVGVLEVIKYQLLNNTEEDE* |
| Ga0049081_101330363 | 3300005581 | Freshwater Lentic | LSQQVMIEALYQEIIGVLGKFDEALPLASVVGVLEVIKYQLLNNTEEDE* |
| Ga0049081_102214001 | 3300005581 | Freshwater Lentic | YQEIVGAVEKFDEALPLASVVGVLEVIKYQLLMNTEDEE* |
| Ga0078894_101818354 | 3300005662 | Freshwater Lake | LSQQVMIEALYQEIVGAVEKFDEALPLASVVGVLEVIKYQLLMNTEDEE* |
| Ga0078117_10933623 | 3300005758 | Lake Water | MIEALYQEIMGVLEKFDEALPLASVVGVLEVIKYQLLNNTEEEE* |
| Ga0079957_10340045 | 3300005805 | Lake | MIEALYQEIVGVVEKFDEALPLASVVGVLEVIKYQLLMNTEDEE* |
| Ga0079957_11299504 | 3300005805 | Lake | MIEALYQEIVGAVEKFDEALPLASVVGVLEVIKYQLLMNTEDEE* |
| Ga0079957_12865913 | 3300005805 | Lake | AGLSQQVMIEALYQEIVGAVEKFDEALPLASVVGVLEVIKYQLLMNTEDKE*ETDL* |
| Ga0105746_11669161 | 3300007973 | Estuary Water | QVMIEALYQEIVGAVEKFDEALPLASVVGVLEVIKYQLLMNTEDEE* |
| Ga0114340_11721562 | 3300008107 | Freshwater, Plankton | LSQQVMIEALYQEIMGVLEKFDEALPLASVVGVLEVIKFQLLNNTEEDE* |
| Ga0114344_11466133 | 3300008111 | Freshwater, Plankton | MSQQVMIEGLYKELIGVLEKFDEALPLASVVGVLEVIKYQLLNNTSEDEE* |
| Ga0114347_10149527 | 3300008114 | Freshwater, Plankton | LSQQVMIEALYQELVGVLGKFDEALPLASVVGVLEVIKYQLLNNTEEDE* |
| Ga0114350_10402212 | 3300008116 | Freshwater, Plankton | MIEALYQEIIGVLGKFDEALPLASVVGVLEVIKYQLLNNTEEDE* |
| Ga0114350_10708114 | 3300008116 | Freshwater, Plankton | EGLSQQVMIEALYQEIMGVLEKFDEALPLASVVGVLEVIKYQLLNNTEEDE* |
| Ga0114350_10961164 | 3300008116 | Freshwater, Plankton | LSQQVMIEALYQEIMGVLEKFDEALPLASVVGVLEVIKYQLLNNTEEEDE* |
| Ga0114350_11399903 | 3300008116 | Freshwater, Plankton | EGLSQQVMIEALYQEIMGVLEKFDEALPLASVVGVLEGIRYQLLNNTEEDE* |
| Ga0114355_10855553 | 3300008120 | Freshwater, Plankton | LSQQVMIEALYQEIMGVLEKFDEALPLASVVGVLEVIKYQLLNNTEEDE* |
| Ga0114337_11888162 | 3300008262 | Freshwater, Plankton | MSQQVMIEGLYKELIGVLEKFDEALPLASVVGVLEVIKYQLLNNTEEDE* |
| Ga0114353_11526134 | 3300008264 | Freshwater, Plankton | IQDVGPGDEGLSQQVMIEALYQEIIGVLEKFDEALPLASVVGVLEVIKYQLLNNTEEDE* |
| Ga0114353_12910384 | 3300008264 | Freshwater, Plankton | IEALYQEIVGAVEKFDEALPLASVVGGLEVIKYQLLMNTEDEE* |
| Ga0114363_10188279 | 3300008266 | Freshwater, Plankton | LSQQVMIEALYQEIIGVLEKFDEALPLASVVGVLEVIKYQLLNNTEEDE* |
| Ga0114363_10457614 | 3300008266 | Freshwater, Plankton | LSQQVMIEALYQEIIGVLGKFDEALPLASVVGVLEVIKYQLLNNTSEDEE* |
| Ga0114363_10516045 | 3300008266 | Freshwater, Plankton | LSQQVMIEALYQEIIGVLGKFDEALPLASVVGVLEVIKYQLLNNTEDEE* |
| Ga0114363_10770573 | 3300008266 | Freshwater, Plankton | LSQQVMIEALYQEIVGVLGKFDEALPLASVVGVLEVIKFQLLNNTEDEE* |
| Ga0114363_11327573 | 3300008266 | Freshwater, Plankton | VSQQVMIEALYQEIVGAVEKFDEALPLASVVGVLEVIKYQLLMNTEDEK* |
| Ga0114364_11258152 | 3300008267 | Freshwater, Plankton | LSQQVMIEALYQEIVGAVEKFDEALPLASVVGVLEVIKYQLLINTEDEE* |
| Ga0114364_11689962 | 3300008267 | Freshwater, Plankton | LSQQVMIEGLYKELIGVLEKFDEALPLASVVGVLEVIKYQLLNNTEDEE* |
| Ga0114876_10369796 | 3300008448 | Freshwater Lake | MIEALYQEIVGVVEKFDEALPLASVVGVLEVIKYQLLMN |
| Ga0114876_10779952 | 3300008448 | Freshwater Lake | MSQQVMIEALYQEIIGVLEKFDEALPLASVVGVLEVIKYQLLNNTEEDE* |
| Ga0114876_11849473 | 3300008448 | Freshwater Lake | MIEALYQEIVGAVEKFDEALPLASVVGVLEVIKYQL |
| Ga0114880_10971511 | 3300008450 | Freshwater Lake | LYQEIIGVLGKFDEALPLASVVGVLEVIKYQLLNNTEDEE* |
| Ga0114880_12085851 | 3300008450 | Freshwater Lake | MIEALYQEIVGAVEKFDEALPLASVVGVLEVIKYQLMAN |
| Ga0114880_12101271 | 3300008450 | Freshwater Lake | LSQQVMIEALYQEIVGAVEKFDEALPLASVVGVLEVIK |
| Ga0129333_101759943 | 3300010354 | Freshwater To Marine Saline Gradient | LSQQVMIEALYQEIIGVLGKFDEALPLASMVGVLEVIKYQLLNNTEEDE* |
| Ga0129333_106745271 | 3300010354 | Freshwater To Marine Saline Gradient | QQVMIEALYQEIVGAVEKFDEALPLASVVGVLEVIKYQLLMNTEDEE* |
| Ga0129333_108282381 | 3300010354 | Freshwater To Marine Saline Gradient | MIEALYQEIVGAVEKFDEALPLASVVGVLEVIKYQLLM |
| (restricted) Ga0172373_106512533 | 3300013131 | Freshwater | MSQQVMIEALYQEIVGVLEKFNDALPVSSVVGILEVIKYQILNNTEEEEE* |
| (restricted) Ga0172372_101515832 | 3300013132 | Freshwater | MIEALYQEIVGVLEKFNDALPVSSVVGILEVIKYQILNNTEEEEE* |
| (restricted) Ga0172372_103016283 | 3300013132 | Freshwater | MIEALYQEIVGVLEKFNDALPVSSVVGILEVIKYQILNNVEEEEE* |
| (restricted) Ga0172376_102141303 | 3300014720 | Freshwater | MIEALYQEIVGVLEKFNDALPVSSVVGILEVIKYQLLNNTEEEEE* |
| (restricted) Ga0172376_106869491 | 3300014720 | Freshwater | MSQQVMIEALYQEIVGVLEKFNDALPVSSVVGILEVIKYQL |
| Ga0181363_10210394 | 3300017707 | Freshwater Lake | MIEALYQEIVGAVEKFDEALPLASVVGVLEVIKYQLMANTEDEE |
| Ga0181352_10425701 | 3300017747 | Freshwater Lake | VREDGRGLGIQDFGPGDAGLSQQVMIEALYQEIVGAVEKFDEALPIASVVGVLEVIKYQLLMNTEDEE |
| Ga0181352_10655973 | 3300017747 | Freshwater Lake | VRKDGRGLGIQDPSSGDAGLSQQVMIEALYQEIVGAVEKFDEALPLASVVGVLEVIKYQLLMNTEDEE |
| Ga0181352_12038471 | 3300017747 | Freshwater Lake | LSQQVMIEALYQEIIGVLGKFDEALPLASVVGVLEVIKYQLLMNTEDEE |
| Ga0181346_10323827 | 3300017780 | Freshwater Lake | VGAVEKFDEALPLASVVGVLEVIKYQLLMNTEDEE |
| Ga0181355_12950912 | 3300017785 | Freshwater Lake | MIEALYQEIVGAVEKFDEALPLASVVGVLEVNKYQLLMNTEDEE |
| Ga0181359_11223413 | 3300019784 | Freshwater Lake | LSQQVMIEALYQEIIGVLGKFDEALPLASVVGVLEVIKYQLLNNTEEDE |
| Ga0207193_14938922 | 3300020048 | Freshwater Lake Sediment | XXXAVEKFDEALPLASVVGVLEVIKYQLLMNTEDEE |
| Ga0211736_100265212 | 3300020151 | Freshwater | LSQQVMIEALYQEIIGVLEKFDEALPLASVVGVLEVIKYQLLNNTEEDE |
| Ga0211736_100265562 | 3300020151 | Freshwater | MIEALYQEIIGVLEKFDEALPLASVVGVLEVIKYQLLNNTSEEDE |
| Ga0211734_104598223 | 3300020159 | Freshwater | MIEALYQEIMGVLEKFDEALPLASVVGVLEVIKYQLLNNTEEDE |
| Ga0211726_105308791 | 3300020161 | Freshwater | MIEALYQEIMGVLEKFDEALPLASVVGVLEVIKFQLLNNTEEDE |
| Ga0222714_100906083 | 3300021961 | Estuarine Water | MIEALYQEIIGVLGKFDEALPLASVVGVLEVIKYQLLNNTEEDE |
| Ga0181353_10502903 | 3300022179 | Freshwater Lake | LSQQVMIEALYQEIMGVLEKFDEALPLASVVGVLEVIKYQLLNNTEEDE |
| Ga0181353_10528603 | 3300022179 | Freshwater Lake | LSQQVMIEALYQEIVGAVEKFDEALPLASVVGVLEVIKYQLLMNTEDEE |
| Ga0181354_11762374 | 3300022190 | Freshwater Lake | ELGAGDEGLSQQVMIEALYQEIIGVLEKFDEALPLASVVGVLEVIKYQLLNNTEEDE |
| Ga0255147_100010246 | 3300024289 | Freshwater | MSQQVMIEELTKEIYLAIEKFNEALPLASVVGVLEVIKYELILNIGDDDET |
| Ga0208974_10245023 | 3300027608 | Freshwater Lentic | LSQQVMIEALYQEIMGVLEKFDEALPLASVVGVLEVIKFQLLNNTEEDE |
| Ga0209033_10248941 | 3300027697 | Freshwater Lake | YQEIVGAVEKFDEALPLASVVGVLEVIKYQLLMNTEDEE |
| Ga0209492_11177262 | 3300027721 | Freshwater Sediment | VREDGRGLGIQDPSPGDAGLSQQVMIEALYQEIVGAVEKFDEALPLASVVGVLEVIKYQLLMNTEDEE |
| Ga0209134_100676394 | 3300027764 | Freshwater Lake | DAGLSQQVMIEALYQEIVGAVEKFDEALPLASVVGVLEVIKYQLLMNTEDEE |
| Ga0209246_101099501 | 3300027785 | Freshwater Lake | LSQQVMIEALYQEIVGVVEKFDEALPLASVVGVLEVIKYQLLMNTEDEE |
| Ga0209972_100623663 | 3300027793 | Freshwater Lake | LSQQVMIEALYQEIVGVLGKFDEALPLASVVGVLEVIKFQLLNNTEEDE |
| Ga0209990_104308861 | 3300027816 | Freshwater Lake | MIEALYQEIVGVLGKFDEALPLASVVGVLEVIKFQLLNNTEEDE |
| (restricted) Ga0247834_10933564 | 3300027977 | Freshwater | MIEALYQEIIGVLEKFDEALPLASVVGVLEVIKYQLLNNTEEDE |
| Ga0247723_10981261 | 3300028025 | Deep Subsurface Sediment | ALYQEIVGAVEKFDEALPLASVVGVLEVIKYQLLMNTEDEE |
| (restricted) Ga0247831_11613714 | 3300028559 | Freshwater | AGDEGLSQQVMIEALYQEIIGVLGKFDEALPLASVVGVLEVIKYQLLNNTEEDE |
| (restricted) Ga0247843_10732424 | 3300028569 | Freshwater | LSQQVMIEALYQEIIGVLGKFDEALPLASVVGVLE |
| Ga0315907_108145833 | 3300031758 | Freshwater | LSQQVMIEALYQEIIGVLGKFDEALPLASVVGVLEVIKFQLLNNTEEDE |
| Ga0315907_108962922 | 3300031758 | Freshwater | LSQQVMIEALYQEIMGVLEKFDEALPLASVVGVLEVIKYQLLNNTEEEDE |
| Ga0315899_115900392 | 3300031784 | Freshwater | LSQQVMIEALYQEIIGVLGKFDEALPLASVVGVLEVIKYQLLNNTEDEE |
| Ga0315900_1003461711 | 3300031787 | Freshwater | MIEALYQEIIGVLGKFDEALPLASVVGVLEVIKFQLLNNTEEDE |
| Ga0315900_100569693 | 3300031787 | Freshwater | MIEALYQEIIGVLGKFDEALPLASVVGVLEVIKYQLLNNTSEDEE |
| Ga0315900_101152544 | 3300031787 | Freshwater | MGIQDVGSGDEGLSQQVMIEALYQEIVGVLGKFDEALPLASVVGVLEVIKFQLLNNTEDE |
| Ga0315900_101688844 | 3300031787 | Freshwater | MSQQVMIEGLYKELIGVLEKFDEALPLASVVGVLEVIKYQLLNNTEEDE |
| Ga0315900_102026935 | 3300031787 | Freshwater | MIEALYQEIIGVLGKFDEALPLASVVGVLEVIKYQLLNNTEDEE |
| Ga0315900_104046523 | 3300031787 | Freshwater | LSQQVMIEALYQEIMGVLEKFDEALPLASVVGVLEV |
| Ga0315900_106138432 | 3300031787 | Freshwater | MSQQVMIEALYQEIIGVLEKFDEALPLASVVGVLEVIKYQLLNNTEEDE |
| Ga0315900_106981481 | 3300031787 | Freshwater | SGDEGLSQQVMIEALYQEIIGVLGKFDEALPLASVVGVLEVIKYQLLNNTEEDE |
| Ga0315900_109476231 | 3300031787 | Freshwater | GDEGLSQQVMIEALYQEIVGVLGKFDEALPLASVVGVLEVIKYQLLNNTEEDE |
| Ga0315909_100419841 | 3300031857 | Freshwater | MIEALYQEIVGAVEKFDEALPLASVVGVLEVIKYQLLMN |
| Ga0315909_100484355 | 3300031857 | Freshwater | MIEALYQEIVGVLGKFDEALPLASVVGVLEVIKFQLLNNTEDEE |
| Ga0315909_101353497 | 3300031857 | Freshwater | VAVREDGRGLGIQDPSPGDEGLSQQVMIEALYQEIVGAVEKFDEALPLASVVGVLEVIKYQLLMNTEDEE |
| Ga0315909_103536232 | 3300031857 | Freshwater | MIEALYQELVGVLGKFDEALPLASVVGVLEVIKYQLLNNTEEDE |
| Ga0315909_105941631 | 3300031857 | Freshwater | LMSQQVMIEALYQEIIGVLEKFDEALPLASVVGVLEVIKYQLLNNTEEDE |
| Ga0315904_100993505 | 3300031951 | Freshwater | VREDGRGLGIQDVGPGDEGLSQQVMIEALYQEIIGVLEKFDEALPLASVVGVLEVIKYQLLNNTEEDE |
| Ga0315904_108914331 | 3300031951 | Freshwater | EIIGVLGKFDEALPLASVVGVLEVIKYQLLNNTEEDE |
| Ga0315901_112194933 | 3300031963 | Freshwater | LMSQQVMIEGLYKELIGVLEKFDEALPLASVVGVLEVIKYQLLNNTE |
| Ga0315902_104197501 | 3300032093 | Freshwater | EGLSQQVMIEALYQEIIGVLEKFDEALPLASVVGVLEVIKYQLLNNTEEDE |
| Ga0315903_102529021 | 3300032116 | Freshwater | LSQQVMIEALYQEIIGVLGKFDEALPLASVVGVLEVIKYQLLNNTSEDEE |
| Ga0315903_105955432 | 3300032116 | Freshwater | MSQQVMIEGLYKELIGVLEKFDEALPLASVVGVLEVIKYQLLNNTEDEE |
| Ga0315903_109708463 | 3300032116 | Freshwater | VSQQVMIEALYQEIVGAVEKFDEALPLASVVGVLEVIKYQLLMNTEDEK |
| Ga0335036_0013850_748_882 | 3300034106 | Freshwater | MIEALYQEIIVVLGKFDEALPLASVVGVLEVIKYQLLNNTEEDE |
| ⦗Top⦘ |