NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F104353

Metagenome / Metatranscriptome Family F104353

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F104353
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 96 residues
Representative Sequence VLGVGVGSGVYELEPPRERDELPPVIFLNAPETFRPMPFMMEQKHVQLETGYVSETELNVLTRELLLLSCSKEMRERGLLNSNLEQKSNENPRAKFERV
Number of Associated Samples 78
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 2.00 %
% of genes near scaffold ends (potentially truncated) 32.00 %
% of genes from short scaffolds (< 2000 bps) 99.00 %
Associated GOLD sequencing projects 77
AlphaFold2 3D model prediction Yes
3D model pTM-score0.25

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (82.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(70.000 % of family members)
Environment Ontology (ENVO) Unclassified
(86.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(74.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 22.83%    β-sheet: 0.00%    Coil/Unstructured: 77.17%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.25
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF03078ATHILA 1.00



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms82.00 %
UnclassifiedrootN/A18.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005367|Ga0070667_101733396Not Available588Open in IMG/M
3300005841|Ga0068863_101155089All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum780Open in IMG/M
3300005844|Ga0068862_102664962Not Available512Open in IMG/M
3300009101|Ga0105247_10296635All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1120Open in IMG/M
3300009101|Ga0105247_11601966All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum535Open in IMG/M
3300009553|Ga0105249_11329795All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum790Open in IMG/M
3300009977|Ga0105141_110461All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum801Open in IMG/M
3300009981|Ga0105133_106191Not Available804Open in IMG/M
3300009981|Ga0105133_113855All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum649Open in IMG/M
3300009993|Ga0105028_133313All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum576Open in IMG/M
3300009994|Ga0105126_1054778Not Available510Open in IMG/M
3300010400|Ga0134122_12012302All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum616Open in IMG/M
3300010403|Ga0134123_11464515All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa726Open in IMG/M
3300013306|Ga0163162_11383773Not Available800Open in IMG/M
3300015273|Ga0182102_1013069Not Available703Open in IMG/M
3300015280|Ga0182100_1071619All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum566Open in IMG/M
3300015280|Ga0182100_1076813Not Available552Open in IMG/M
3300015284|Ga0182101_1036763All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum703Open in IMG/M
3300015290|Ga0182105_1024631All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum820Open in IMG/M
3300015297|Ga0182104_1057735All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum653Open in IMG/M
3300015297|Ga0182104_1097280All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum545Open in IMG/M
3300015309|Ga0182098_1119736All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum515Open in IMG/M
3300015310|Ga0182162_1076012All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum615Open in IMG/M
3300015311|Ga0182182_1083340All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum579Open in IMG/M
3300015312|Ga0182168_1074331All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum637Open in IMG/M
3300015313|Ga0182164_1120626All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum530Open in IMG/M
3300015315|Ga0182120_1019767All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum998Open in IMG/M
3300015315|Ga0182120_1108489All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum556Open in IMG/M
3300015316|Ga0182121_1126936All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum533Open in IMG/M
3300015317|Ga0182136_1101018All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum574Open in IMG/M
3300015319|Ga0182130_1044479All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum750Open in IMG/M
3300015319|Ga0182130_1087147All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum597Open in IMG/M
3300015319|Ga0182130_1133883All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum507Open in IMG/M
3300015320|Ga0182165_1064527All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum693Open in IMG/M
3300015320|Ga0182165_1064862All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae691Open in IMG/M
3300015324|Ga0182134_1045231All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum781Open in IMG/M
3300015324|Ga0182134_1117463Not Available552Open in IMG/M
3300015324|Ga0182134_1129827All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum530Open in IMG/M
3300015325|Ga0182148_1090039All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum606Open in IMG/M
3300015328|Ga0182153_1027267All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum928Open in IMG/M
3300015328|Ga0182153_1110577All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum572Open in IMG/M
3300015329|Ga0182135_1071906All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum678Open in IMG/M
3300015329|Ga0182135_1131260All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum538Open in IMG/M
3300015330|Ga0182152_1039207All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum840Open in IMG/M
3300015331|Ga0182131_1104159All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum592Open in IMG/M
3300015334|Ga0182132_1129711All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum563Open in IMG/M
3300015335|Ga0182116_1048664All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum853Open in IMG/M
3300015335|Ga0182116_1058940All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum795Open in IMG/M
3300015338|Ga0182137_1175992All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum506Open in IMG/M
3300015338|Ga0182137_1177361All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum504Open in IMG/M
3300015340|Ga0182133_1067133All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum776Open in IMG/M
3300015340|Ga0182133_1139140All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum579Open in IMG/M
3300015348|Ga0182115_1097180All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum922Open in IMG/M
3300015348|Ga0182115_1191532All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum656Open in IMG/M
3300015350|Ga0182163_1240836All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum567Open in IMG/M
3300015352|Ga0182169_1077579All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1041Open in IMG/M
3300015352|Ga0182169_1141585Not Available782Open in IMG/M
3300015352|Ga0182169_1309345All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum508Open in IMG/M
3300015353|Ga0182179_1319655All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum506Open in IMG/M
3300015354|Ga0182167_1107441All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1022Open in IMG/M
3300015354|Ga0182167_1282484All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum592Open in IMG/M
3300017408|Ga0182197_1094988All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum601Open in IMG/M
3300017412|Ga0182199_1145596All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum576Open in IMG/M
3300017412|Ga0182199_1180966Not Available528Open in IMG/M
3300017421|Ga0182213_1179373All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum600Open in IMG/M
3300017432|Ga0182196_1146580Not Available514Open in IMG/M
3300017439|Ga0182200_1123980All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum556Open in IMG/M
3300017440|Ga0182214_1028316Not Available1092Open in IMG/M
3300017446|Ga0182217_1084931All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum741Open in IMG/M
3300017447|Ga0182215_1117006All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum602Open in IMG/M
3300017792|Ga0163161_11846104All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum538Open in IMG/M
3300020031|Ga0182119_102863All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum662Open in IMG/M
3300020223|Ga0182118_107015All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum636Open in IMG/M
3300025931|Ga0207644_11546897All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum557Open in IMG/M
3300025972|Ga0207668_10530817Not Available1017Open in IMG/M
3300025986|Ga0207658_11118956All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum720Open in IMG/M
3300026118|Ga0207675_102635829All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum512Open in IMG/M
3300028049|Ga0268322_1010038All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum865Open in IMG/M
3300028053|Ga0268346_1012574Not Available745Open in IMG/M
3300028056|Ga0268330_1061991Not Available505Open in IMG/M
3300028057|Ga0268352_1019966Not Available711Open in IMG/M
3300028058|Ga0268332_1060627All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum557Open in IMG/M
3300028141|Ga0268326_1002287All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum851Open in IMG/M
3300028251|Ga0268324_1006193All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum773Open in IMG/M
3300028466|Ga0268321_106484All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum596Open in IMG/M
3300028472|Ga0268315_1011369All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum663Open in IMG/M
3300028473|Ga0268319_1007037All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum733Open in IMG/M
3300028474|Ga0268331_1002084All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1054Open in IMG/M
3300032465|Ga0214493_1142670All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum557Open in IMG/M
3300032490|Ga0214495_1002787All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza2737Open in IMG/M
3300032490|Ga0214495_1155175All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum504Open in IMG/M
3300032502|Ga0214490_1044152All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1001Open in IMG/M
3300032502|Ga0214490_1064487All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum837Open in IMG/M
3300032591|Ga0214484_1123699All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum519Open in IMG/M
3300032625|Ga0214501_1246610Not Available566Open in IMG/M
3300032697|Ga0214499_1233689All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum567Open in IMG/M
3300032699|Ga0214494_1057229Not Available750Open in IMG/M
3300032758|Ga0314746_1031871All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1182Open in IMG/M
3300032914|Ga0314750_1118334All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum617Open in IMG/M
3300032959|Ga0314738_1035315All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum905Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere70.00%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere11.00%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated5.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere4.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.00%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009977Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_91 metaGHost-AssociatedOpen in IMG/M
3300009981Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaGHost-AssociatedOpen in IMG/M
3300009993Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaGHost-AssociatedOpen in IMG/M
3300009994Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaGHost-AssociatedOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300015273Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015280Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015284Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015290Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015297Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015309Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015310Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015311Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015312Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015313Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015315Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015316Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015317Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015319Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015320Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015324Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015325Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015328Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015329Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015330Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015331Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015334Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015335Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015338Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015340Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015348Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015350Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015352Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015354Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017408Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017412Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017421Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017432Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017439Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017440Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017446Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017447Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300020031Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_31MAY2016_LD2 MGHost-AssociatedOpen in IMG/M
3300020223Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_31MAY2016_LD2 MGHost-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028049Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028053Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028056Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028057Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_18SEP2017_LD1Host-AssociatedOpen in IMG/M
3300028058Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028141Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028251Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028466Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028472Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028473Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028474Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300032465Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032490Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032502Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032591Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032625Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032697Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032699Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032758Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032914Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032959Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070667_10173339613300005367Switchgrass RhizospherePPREWDELPPVIFLNVLETFRPMPFMMERKQVQLETGYVIETKMKVLTRELFLLSCSKEMRRRDFLKSNLELKSNENLRAKFERV*
Ga0068863_10115508913300005841Switchgrass RhizosphereVLGVGVGSGVYELEPPQERDELPSVIFLNAPKTFRPMPFMMEQRQVQLETGYVSKTEMNVLTRELLLLSCSKEMRERGLLNSNFEQKSNENPRAKFERV*
Ga0068862_10266496213300005844Switchgrass RhizosphereVYELEPPREWDELPPIIFLNAPETFCPKPFMMEQKHVQLETGYVSGTELNVLTRELLLLSCSKEMRERGLLKSNLEQKSNENPRAKFERV*
Ga0105247_1029663523300009101Switchgrass RhizosphereVLGVGIGSGVYELEPPREQDELPPVIFLNAPETFRPMPFMMEQKHVQLETGYVSETELNVLTRELLLLSCSKEMRERGLLNSNLKQKSNENTRAKFERV*
Ga0105247_1160196613300009101Switchgrass RhizosphereVLDVGVGSGVYELEPPRERDELPPAIFLNAPETFHPMPFMMEQKQVQLEMGYVSETEMNVLTRELLLLSCSKEMRERGLLKSNLEQKSNENPRAKFE
Ga0105249_1132979523300009553Switchgrass RhizosphereMLGGGVGSGVYEFEPPREWDEPPQVIFLNVPETFRPKPFMMEQNKHIQLEAGYVSEIEMNILTRKLLLLSCSKEMRERGLLKSNLEQKSNEIPRAKFERV*
Ga0105141_11046113300009977Switchgrass AssociatedVLGVGIGSGVYELEPPRERDELPPIIFLNASETFHPKHFMMEQKHVQLETGYVSETELNVLTRELLLLSCSKEMRERGLLNSNLEQNPMKTREQSLREFERE*
Ga0105133_10619123300009981Switchgrass AssociatedVLGVSVDWGVYEIEPPQERDELPPVIFLNVPETFRPKPFMMEQNKHVQLETGYVSEIEMNVLSRELFLLSCSKEMRERGLLKSNLEQKFNENLKAKFERV*
Ga0105133_11385513300009981Switchgrass AssociatedVLGVGVGSGVYKLKPPREQDELPPVIFLNALETFHPMPFMMERKQVQLEMGYVIETKMKVLTRKLFLLSCRKEMRERGFLNSKLDQKSNENPR
Ga0105028_13331313300009993Switchgrass AssociatedVLGVGVGSGVYELEPPREWDELLPVIFLNAPETFRPMPFMMERKQVQLETGYVRKTELNVLTRELLLLSCSKAMRERGLLNSNLEQKFNENPRAKFKRV*
Ga0105126_105477813300009994Switchgrass AssociatedGVGSYVYELEPPRERDELPPVIFLNAPESFHPMPFMMEQTNMYNSQTGYVSETEMNVLTRELLLLSCSKEMRERGLLNSNFEQKSNENPRAKFERV*
Ga0134122_1201230223300010400Terrestrial SoilVLGVGIGSGVYELEPPREWDELLPVIFLNAPETFRPMPFMMEQKHVQLETGYVSETELNVLTRELLLLSCSKEMRERGLLNSNLEQKSNENPRARFDRV*
Ga0134123_1146451523300010403Terrestrial SoilVLGVGVGSGVYELDPPRERDELPPIIFLNVPESFRPKPFMMEQKHVQLETGYVSKIKMNVLTCELLLLSCSKEMRERGLLKSNLEQKSNLEQSLRECE*
Ga0163162_1138377323300013306Switchgrass RhizosphereELEPPRERDELPSVIFLNVPETFRPMPFMMEQKQVQLETGYVSETEMNVLTLELLLLSCSKGMRGRGLLNSNLEQKSNENMRAKFERE*
Ga0182102_101306913300015273Switchgrass PhyllosphereELEPPQEWDELPPVIFLNAPETFRPRPFMVEQKQMQLKTSYISETEMNVLTRELLLLSCSKEMRERSLDIKFEQKSNENPRAKFERV*
Ga0182100_107161923300015280Switchgrass PhyllosphereVLGVGVGSGVYKLEPPRERDELPPVIFLNALETFRPMPFMMEQKRMQLKMGYVSETELNVLTRELLLFSCSKEMRERGLLKSNLEQKSNEIPRVKFERV*
Ga0182100_107681313300015280Switchgrass PhyllosphereEWDELPPVIFLNAPETFRPKPFMMEQKYVQLETGYISETEMNVLTREQLLLSCSKEMREIGFLNSKLEQKSNENPRAKFERV*
Ga0182101_103676313300015284Switchgrass PhyllosphereVLGVGVSSGVYELEPPREWDELPPVIFLNAPKTFRPKPFMMEQNKHIQLETIYVSEIEMNVLTRELLLLSCSKEMRERGFLKSNLEQKSNENLRAKFERV*
Ga0182105_102463113300015290Switchgrass PhyllosphereMLSVGVGSGVYELEPPRKWDELPPIIFLNAPETFCPKPFMMEQKHMQLETGYVSGTEMNVLTCELLLLSCSKEMRERERGLLKSNLEQKSNENPKAKFDRI*
Ga0182104_105773513300015297Switchgrass PhyllosphereMLGLGVGSGVCELDPPREYDELPPVIFLNAPETFRPMPFMMERKQMQLEMGYVSETELNVLTRVLLLSCSKEMRERGLFKSNLEQKSNEN*
Ga0182104_109728013300015297Switchgrass PhyllosphereVLGVGVGSGVYELEPPRKWDELPPVIFLNAPETFRPMPFMMEQKQQVQLETGYVTETELNVLTHELLLLSCSKEMRERGLLKSNLEQKIQ*
Ga0182098_111973623300015309Switchgrass PhyllosphereVPGVGVGLGVYELEPPRERDELPPIIFLNAPETFHPMPFMMEQKQVQLEMGYVSETEMNVLTRELLLLFCCKEMRERGLLNSNFEQKSNENSRAKFERV*
Ga0182162_107601213300015310Switchgrass PhyllosphereMLGVGVGSRVYELEPPRERDELPPVIFLNAPETFRPKPFMMEQNKHVQLETGYVSEIGVNVLTRELLLLSCSEEMRERGFLKSKLSKNPTKT*
Ga0182182_108334023300015311Switchgrass PhyllosphereMLGAGVGSGVYELESPREWDELPPVIFLSAPETFRPKPFMMEQNKHVKLETGYVSETKINVLTRELLLVSCSKEMRERGLLKSIFLAKIQ*
Ga0182168_107433113300015312Switchgrass PhyllosphereMLGVGVGLGVYELEPAREWDELPPVIFLNAPETFHPMPFMMEQKLMQLKTGYISETKLNVLTHELLLFSCSKEMRERGLLKSNLEQKSIENPRAKFERE*
Ga0182164_112062613300015313Switchgrass PhyllosphereVLGVGVGSGVYELEPPREQDELPPVIFLNVPETFRPKPFMMEQNKHVQLEMGYVSEIEMNILTRELLLLFLKQRNERKRSLEIKFKQKSNENPRANFERV*
Ga0182120_101976723300015315Switchgrass PhyllosphereVLGVGIGSGVYELEPPREWDELPPVIFLNAPETFCPNPFIMEQKHVQLKTGYVSETELNVLTRELLLLSCSKEMRERGLLNSNLEQKSNENPRAKFERV*
Ga0182120_110848913300015315Switchgrass PhyllosphereYELEPPRERDELPPVIFLNAPETFRPKPFMMEQKHVQLGTGYVSEIKMNILTRELLLLSCSKEMRKRGLLKSNLEQESNETPKAKFERV*
Ga0182121_112693613300015316Switchgrass PhyllosphereVYELEPPREWDELLPVIFLNAPETFRPMPFMMEQKHVQLETGYVRETKMNVLTRELLLLSCSKEMRERGLLNSNLEQKSNENPRTKFERE*
Ga0182136_110101823300015317Switchgrass PhyllosphereVLGVGVGSGVYKLKPPREQDELPPVIFLNALETFHPMPFMMERKQVQLETGYVIETKMKVLTRELFLLSCSKEMRERERGLLRSNLEQKSNENPRAKFERV*
Ga0182130_104447923300015319Switchgrass PhyllosphereMLGVGVGSRVYELEPPRERDELPPIIFLNAPETFRPMPFMMEQKRMQLETGYVSETELNILTRELLFFSCSKEMRERGLLKSNLEQ
Ga0182130_108714713300015319Switchgrass PhyllosphereVLGVGVGSGVYELEPPRERDELPPVIFLNAPETFHPMPFMMERKQVQLETGYVIETKMRLLTRELFFLSSSKEMRERGLLKSNLEQKSNENLRAKFERE*
Ga0182130_113388313300015319Switchgrass PhyllosphereVLGVGVGSGVYELEPPRERDELPPVIFLNAPETFRPKPFMMEQKQVQLETGYVSETELNVLTHELLLLSCSKEMRERGLLKSNLEQKSNENPRAKFERVLRESE*
Ga0182165_106452723300015320Switchgrass PhyllosphereMLGVDVGSGVYKLEPPREWDQLPPVIFLNAPETFRPMPFMMEQKRMQLVTGYDSESELNVLTRELLLFSCSKEMRERGLLKSNLEQKSIENPRAKFERV*
Ga0182165_106486233300015320Switchgrass PhyllosphereMLGVGVGLGVYELEPAREWDELPPVIFLNAPETFRPKPFMMEQKYVQLETGYISETEMNVLTREQLLLSCSKEMREIGFLNSKLEQKSN*
Ga0182134_104523133300015324Switchgrass PhyllosphereVLGVGLGSGVYELEPPREWDDLPPVIFLNASETFRPKPFMMEQKHVQLETGYVSETELNVLTHELLLLSCSKEMRERERGLLKSNLEQKSNENPKAKFDRV*
Ga0182134_111746313300015324Switchgrass PhyllosphereVYELEAPREWDELPRVIFLNALETFHPMPFMMEQKQVQLEMGYVSETELNVLTRELLLLSCCKEMRERGLLNSNLEQKSNENPRAKFERV*
Ga0182134_112982713300015324Switchgrass PhyllosphereGVYELEPPREWDELPPVIFLNAPETFRPMPFMMEQKHVQLETGYVSETELNVLTRELLLLSCSKEMRRRDFLKSNLEQKSNENLRAKFERV*
Ga0182148_109003923300015325Switchgrass PhyllosphereVLCVGVGSGVYELEPPREQDELPPVIFLNAPETFRPMPFMMEQKQVQLETGNVSETELNVLIRELLLLSCSKEMRERGLLNSNLE*
Ga0182153_102726723300015328Switchgrass PhyllosphereVLGVGVGLGVYELEPPRERDELPPVIFLNAPETFRPMPFMMEQKHVQLETGYVSETELNVLTRELLLLSCCKEMRERGLLNSNLEQKSNENTRAKFERV*
Ga0182153_111057723300015328Switchgrass PhyllosphereMLGVGVGSGVYELEPPREWDEPPPVIFLNAPETFRPKPFMMEQLEMGYVSETKMNILTRELLLPSCSKEMREGGLFKSILEQKSDENPRAKFERV*
Ga0182135_107190623300015329Switchgrass PhyllosphereVLGVGVGSGVYELEPPRERDELPPVIFLNAPETFRPMPFMMEQKQVQLKTGYVSETELNVLTRELLLLSCSKEMRERGLLNSNLEQKSNEN
Ga0182135_113126023300015329Switchgrass PhyllosphereVLGVGVGLGVYELEPPREWDELPPVIFLNAPETIPPKPFMMEQTQEQLETDYISETELNDLTRDLLLLSCSKEMREKGLLNSNLEKKSNKNPRAKFERV*
Ga0182152_103920713300015330Switchgrass PhyllosphereVLGVGVGSGVYELEPPRERDELPPVIFLNAPKTFRPIPFMMEQKHVQLETGYVSETEMNVLTRELLLLSCSKEMRERGLLNSNLEQKPNENPRVKFERV*
Ga0182131_110415923300015331Switchgrass PhyllosphereLLGVGIGSGVYELEPPRERDKLPPVIFLNAPETFRPKPFMMEQKQVQFETGYVSETEMNVLTRELLLLSGSKEMRERERGLLNSNLEEKSNENPIAKFERV*
Ga0182132_112971123300015334Switchgrass PhyllosphereMLGVGVGSGVYEVEPPREWDEVPPIIFLNAPETFRPKPFMMEQKYVQLETGYISETKMNVLTRELLLHSCSKEMRERGLLSSNFEQKSNEI
Ga0182116_104866413300015335Switchgrass PhyllosphereVLGVGVGLGVYELEPPREWDELPPIIFLNAPETFRPMPFMMEQTNMYNSQTGYVSETEMNVLTRELLLLFLQQKNERERGSLKSNSSENPLKTREQSLREFERE*
Ga0182116_105894013300015335Switchgrass PhyllosphereVLGVGVDSGVYELEPPREWDELSPVILLNAPKTFHPMPFMMEQKQVQLETGYVSETELNVLTHELLLLSCSKEMRERGLLKSNLEQKSNENPRAKFERV*
Ga0182137_117599213300015338Switchgrass PhyllosphereVLGVGVGSGVYELEPPRERDELPPVIFLNVPETFRPMPFMMEQKHVQLETGYVSETELNVLTRELLLLSCCKEMRERGLLNSNLEQKSNENTRAKFERV*
Ga0182137_117736123300015338Switchgrass PhyllosphereVLGVGVGSGVYELEPPREWDELPPVIFLNAPETFRPMPFMMEQKRMQLKMGYVSETELNVLTRELLLFSCSKEMRERGLLKSNFEQKSKTREQSLREFERE*
Ga0182133_106713333300015340Switchgrass PhyllosphereMLGVGVGSRVYELEPPRERDELPPIIFLIAPETFRPMPFMIGRKHVQLEMGYVSENKLNVLTRELLLLACSKEMRERGLLNSNLDQKSNENP
Ga0182133_113914013300015340Switchgrass PhyllosphereGSGVYNLEPPQEWDELAPVIFLNAPETFRPMPFMMEQKHVQLETGYVSETELNVLTRELLLLSCSKEMRERGLLNSNLEQKSNENPRAKFERV*
Ga0182115_109718023300015348Switchgrass PhyllosphereVLGVGVGLGVYELEPPREQDELPPVIFLNVPETFRPKPFMMEQNKHVQLETGYVSEMEMNVLSRELLLLFLQQRNERERFLEIKFEKKSNEIPRAKFERV*
Ga0182115_119153213300015348Switchgrass PhyllosphereVLGVGVGSGVHELEPPREWDELPPVIFLNTPETFRPMPFMMEQRQVQLETGYVSKTELNVLTCELLLLSCNKEMRERGLLNSNFEQKSNENPRAKFERI*
Ga0182163_124083613300015350Switchgrass PhyllosphereMLGVGIGLGVYELEPPRERDELSPVIFLNAPETFRPMPFMMERKQVQLEMGYVSETKIKIITRELFLLSCSKEMRVRGLLNSNLEQKSNENPRAKFERA*
Ga0182169_107757933300015352Switchgrass PhyllosphereVLGVGVGSGVYELEPPREEDELPPVIFLNAPETFRPKPFMMEQKHVQLKMGYVSESELNVLTRELLLLSCIKEMRGLLKSNLEQKSNENPKVKFERV*
Ga0182169_114158513300015352Switchgrass PhyllosphereIVLGVGVGSGVYELEPPHERDELPPVILLNAPETFRPKPFMMEQIHVQLETSYVNETEMNVLTRELLLLSCSKQMRERGLLNSNLEQKSNENPRAKFERV*
Ga0182169_130934513300015352Switchgrass PhyllosphereVLGVGVGLGVYELEPPREWDELPPVIFLSAPEIFRPKPFMLEQKYVQLEMSYVSETEMNVLTCELLLLSCSKEMRERGLLKSNLEQKSNEILKAKFERV*
Ga0182179_131965513300015353Switchgrass PhyllosphereVLGVGVGSGVYELEPPREQDELPPVIFLNAPKTFRPIPFMMEQKYVQLETGYVSETEMNVLTRELLLLSCSKEMRERERGLLNSNLEQKSNENPRAKF
Ga0182167_110744123300015354Switchgrass PhyllosphereVLGVGVGSGVYELEPPQERDELPPVIFLNAPETFRPMPFMMEQKHVQLETGYVSENEMNVLTRELLLLSCSKGMRERGLLKSNLERKSIENPRAKFERVLRGSE*
Ga0182167_128248413300015354Switchgrass PhyllosphereMTSACGSGVYELEPPREWDELPPVIFLNAPETFHPMPFMMEQKRIQLEMGYINETKMNVLTCELLLLSCSKEMKERGLLNSNLEQKFNENPRAKFERV*
Ga0182197_109498813300017408Switchgrass PhyllosphereMLGVGVGSCVYELEPPRERDELPPVIFLNAPETFHPMPFMMEQKRIQLETGYINETKMNVLTCELLLLSCSKEMKERGLLNSNLEQKFNENPRAKFERVXEGVSEXV
Ga0182199_114559613300017412Switchgrass PhyllosphereVLGVGIGSGVYKLEPPRERDELPPIIFLSVPETFRPKPFMMEQKHVQLETGYVSETKSNALTRELLLLSCSKEMRERGLLKSNLEQKSNENPRAKFGRV
Ga0182199_118096623300017412Switchgrass PhyllosphereVLGVGVGSGVYELEPPRERDELPPVIFFNAPETIRPMPFMMEQNKHAQLKTGYVSEIGMNVLTRRLLLLFLQQRNERERSLEIKFEQKSNENPRAKFERV
Ga0182213_117937323300017421Switchgrass PhyllosphereVLGVGVGSGVYELEPPQERDELPPVIFLNVPETFRPMPFMMERKQLQLEMGYVSETELNVLTCELLLLSCSKETRERGLLNSNFEQKSNENPRAKFERV
Ga0182196_114658013300017432Switchgrass PhyllosphereMLCVGIGSGVYELEPPHERDELPPVIFLNAPETFRPMPFMMEQKHVQLETGYVSETELNVLTRELLLLSCCKEMRERGLLNSNLEQKSNENMRAKFERV
Ga0182200_112398013300017439Switchgrass PhyllosphereVLGVGVGSGVYELEPPREWDELPPVIFLNAPETFHPMPFMMERKQVQLETGYVIETKMRLLTRELFFLSSSKEMRERGLLKSNLEQKSIEKPRAKFERV
Ga0182214_102831623300017440Switchgrass PhyllosphereVLGVGVGSGVYELEPPRERDELPPVIFLNVPETFRPKPFMMKQNKHVQLEIGYVSEIEMNILTHELFLNFLQQRNERERFLKSKLSKNPMKTRKQILIEFERE
Ga0182217_108493123300017446Switchgrass PhyllosphereVLGVGVYSGVYELEPPREQDELPPVIFLNAPETFRPMPFMMEQKHVQLETGYVSETELNVLTRELLLLSCSKEMRERGLLNSNLEQKSNENPRAKFERV
Ga0182215_111700623300017447Switchgrass PhyllosphereVLGIGVGLGVYELEPPREWDELPPVIFLNAPETFRPKPFMMEKKHVQLEMGYVSETKMNVLTRELLLLSCSKEMRERGLLKSNLEQKSNENPKAKFDKV
Ga0163161_1184610413300017792Switchgrass RhizosphereVLGVGVGSGVYELDPPRERDELPPVIFLKAPETFRPTPFMMEQKRMQLETCYVSGTELNVLTREFLLLSCSKEMRERGLLNSNLEQKSNENPRAKFERV
Ga0182119_10286323300020031Switchgrass PhyllosphereVLGVGVGSGVYELEPPRERDELPPVIFLSAPETFRPKPFMMEQKHVLLEMGYVSETEMNVLTRELLLLSCSKEMRKIGLLNSNLEQKSNE
Ga0182118_10701513300020223Switchgrass PhyllosphereVLGVGIGLGVYELEPPRERDELPPVIFLNAPETFRPMPFMMEQKQVQLETGYVSETELNVLTRELLLLSCSKEMRERGLLKSNLEQKSNENPKAKFERV
Ga0207644_1154689723300025931Switchgrass RhizosphereVLGVGVGSGVYELEPPRERDELPPVIFLNAPETFRPKPFMMEQKHVQLETGYVSETELNVLTHELLLLSCSKEMRERGLLNSNLEQKSNENPRAKFERV
Ga0207668_1053081713300025972Switchgrass RhizosphereERDELPPVIFLNAPKTFHPKPFMMEQIHVQLETSYVSETEMNVLTRELLLLSCSKEMRERGLLNSNLEQKSNENPRAKFERV
Ga0207658_1111895613300025986Switchgrass RhizosphereVLGVGVGSGVYELEPPRERDDLPPVIFLNAPETFHPKPFMMEQKHVQLETGYVSETELNVLTRELLLLSCSKEMRERGLLNSNLEQKSNENPRAKFERV
Ga0207675_10263582913300026118Switchgrass RhizosphereMLGVGVGLGVYELEPPREWDELPPVIFLNAPETFRSMPFMMEQKDVQLETGYVSETELNVLTRELLLLSCSKEMRERGLLKSNLEQKSNENPRAKFERI
Ga0268322_101003813300028049PhyllosphereVLGVGVGSGVYELEPPRERDELPPVIFLNAPETFRPMPFMMEQKHVQLETGYVSETELNVLTRELLLLSCSKEMRERGLLNSNLEQKSNENPRAKFERV
Ga0268346_101257423300028053PhyllosphereYELDPPRERDELPPVIFLNAPKAFHPKPFMMEQKHVQLETGYVSETELNVLTRELLLLSCSKEMRERGLLNSNLEQKSNENP
Ga0268330_106199113300028056PhyllosphereVLGVGVGSGVHELEPPREWDELPPVIFLNTPETFRPMPFMMEQRQVQLETGYVSKTELNVLTCELLLLSCNKEMRERGLLNSNFEQKSNENPRAKFERI
Ga0268352_101996613300028057PhyllosphereVLGVGVGSGVYELELPQERDELPPIIFLNASETFRPMPFMMEQKHVQLETGYVSETELNVLTRELLLLFCSKEMRERGLLKSNLEQKSNENPRAKFERV
Ga0268332_106062723300028058PhyllosphereVLGVGIGSGVYELEPPREWDELPPVIFLNAPETFCPNPFIMEQKHVQLKTGYVSETELNVLTRELLLLSCSKGMRERERKRGLLNSNIEQKSNKNPRAKFERV
Ga0268326_100228713300028141PhyllosphereVLGVGVGSGVYELEPPREWDELPPVIFLNAQETFRPMPFMMEQKHVQLETGYVSETELNVLTRELLLLSCSKEMRERGLLNSNLEQKSNENPRAKFERV
Ga0268324_100619313300028251PhyllosphereMLGVGVGSRVYELEPPRERDELPPIIFLNAPETFRPKPFMMEQKHVQLETGYVSETELNVLTRELLLLSCSKEMRERGLLNSNLEQKSNENPRAKFERVLRESE
Ga0268321_10648413300028466PhyllosphereGVYELQPPREWDELPPVIFLNAPETFRPMPFMMERKQVQLETGYVSETEMNVLTRELFLLSCSKEMRERGLLKSNLEQKSNEIPRAKFERV
Ga0268315_101136913300028472PhyllosphereVGSGVYELKPPRERDELPPVIFLNAPETFRPKPFMMEQKHVQLETGYVSETELNVLTRELLLLSCSKEMRERGLLNSNLEQKSNENPRAKFERV
Ga0268319_100703713300028473PhyllosphereVLGVGIGSGVYELEPPREWDELPPVIFLNAPETFCPNPFIMEQKHVQLKTGYVSETELNVLTRELLLLSYSKEMRERGLLNSNFD
Ga0268331_100208413300028474PhyllosphereVLGVGVGSGVYELEPPRERDELPPVIFLNAPGTFRPNPFMMEQKHMQLETGYVSETELNVLTRELLLLSCSKEMRERGLLNSNLEQKSNENPRAKFERV
Ga0214493_114267013300032465Switchgrass PhyllosphereVLGVGVGLGVYELEPPREWDELPPVIFLNVPETFRPKPFMMEQKYVQLETGYISETEMNVLTRELFLLSLQQRNERERERERFLEIKFEQKSNESPRAKSERV
Ga0214495_100278723300032490Switchgrass PhyllosphereVLDVGVGLGVYDLEQPREWDELPPVIFLNVPETFRPKPFMMEQKYVQLETGYISETEMNVLTREKLLLSCSKEMREGERGFLNSKLEQKSNENPRVKFERV
Ga0214495_115517513300032490Switchgrass PhyllosphereMLGIGVGSAMCKLEPPRERDELPPVIFLNVPETFRPMPFMMEQRQVQLETGYVSETELNVLTRELLLLSCSKEMRERGFLKSNLSKNPMKT
Ga0214490_104415213300032502Switchgrass PhyllosphereVLGVGVDSGVYELEPPRERDELLPVIFLNVPETFRPKHFMMEQTQVQLETGYVSETKMNALTHELLLLSCNKEIRERGFLKSNL
Ga0214490_106448723300032502Switchgrass PhyllosphereVLGVGVGSGVYELEPPRERDELPPIIFLNAPETFRPKPFMMEQKHVQLETGYVSETELNVLTHELLLLSCSKEMRERERGFLNSKLEQKSNENPRVKFERV
Ga0214484_112369923300032591Switchgrass PhyllosphereVLDVGVGLGVYDLEQPREWDELPPVIFLNVPETFRPKPFMMEQKYVQLETGYISETELNDLTRELLLLYCSKEMRERERGLLNSNLEHKSNENPREKFE
Ga0214501_124661013300032625Switchgrass PhyllosphereVGSGVYELEPPRERDELPPVIFLNALETFRPMPFMMQRKQVQLETGYVSETELNVLTRELLLLSCSKEMRERGLLNSNLEQKSNENPRAKFERV
Ga0214499_123368923300032697Switchgrass PhyllosphereVLGVGVGSGVYELEPPHERDELPPVIFLNAPETFRPMPFMMERKQVQLETGYISETEMNVLTREKLLLSCSKEMRERERGFLNSKLEQKSKNIFER
Ga0214494_105722923300032699Switchgrass PhyllosphereVLGVGVCSGVYELEPPREQDELPPIIFLNAPETFRPKPFMMEQKHVQLETGYVSETELNVLTRELLLLSCSKEMRERGLLKSNLSTNLMKTREQSLREFERE
Ga0314746_103187123300032758Switchgrass PhyllosphereVYDLEQPREWDELPPVIFLNVPETFRPKPFMMEQKHVQLRTGCVSETKMNVLTRELLLLSCSKEMRKRGLLNSNFKQKSNEIPRAKFGRV
Ga0314750_111833423300032914Switchgrass PhyllosphereVLDVGVGLGVYDLEQPREWDELPPVIFLNVPETFRPKPFMMEQKYVQLETGYISETEMNVLTREKLLLSCSKEMRERERGFLNSKLE
Ga0314738_103531523300032959Switchgrass PhyllosphereVLDVGVGLGVYDLEQPREWDELPPVIFLNVPETFRPKPFMMEQKYVQLETGYISETEMNVLTREKLLLSCSKEMRERERGFLNSKLEQKSNENPRVKFESLRGNE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.