NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F104297

Metagenome Family F104297

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F104297
Family Type Metagenome
Number of Sequences 100
Average Sequence Length 87 residues
Representative Sequence MQDSELITPAYDRHMDGAPTRRELQKAFNKMGNNDSELMLMVDNLNLVTNLLCEKLNVTKGEIEVYVAKKAAEMNAFVEAQAK
Number of Associated Samples 80
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 76.00 %
% of genes near scaffold ends (potentially truncated) 52.00 %
% of genes from short scaffolds (< 2000 bps) 93.00 %
Associated GOLD sequencing projects 76
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (62.000 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(38.000 % of family members)
Environment Ontology (ENVO) Unclassified
(65.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(81.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 61.26%    β-sheet: 0.00%    Coil/Unstructured: 38.74%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF00166Cpn10 18.00
PF02945Endonuclease_7 18.00
PF01844HNH 1.00
PF07460NUMOD3 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 18.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A62.00 %
All OrganismsrootAll Organisms38.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000553|TBL_comb47_HYPODRAFT_10112252All Organisms → Viruses → Predicted Viral1298Open in IMG/M
3300002933|G310J44882_10056427Not Available864Open in IMG/M
3300002933|G310J44882_10071545Not Available746Open in IMG/M
3300003814|Ga0007877_1035675Not Available520Open in IMG/M
3300004152|Ga0062386_100929223Not Available719Open in IMG/M
3300004685|Ga0065177_1050492All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis781Open in IMG/M
3300004770|Ga0007804_1044840All Organisms → Viruses → Predicted Viral1171Open in IMG/M
3300004770|Ga0007804_1047089All Organisms → Viruses → Predicted Viral1138Open in IMG/M
3300006072|Ga0007881_1047076All Organisms → Viruses → Predicted Viral1130Open in IMG/M
3300006110|Ga0007871_1077816Not Available624Open in IMG/M
3300006120|Ga0007867_1078505All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis714Open in IMG/M
3300009518|Ga0116128_1140517Not Available694Open in IMG/M
3300009519|Ga0116108_1127301Not Available761Open in IMG/M
3300009519|Ga0116108_1170521Not Available643Open in IMG/M
3300009547|Ga0116136_1109758Not Available713Open in IMG/M
3300009548|Ga0116107_1142840Not Available667Open in IMG/M
3300009549|Ga0116137_1163830Not Available609Open in IMG/M
3300009614|Ga0116104_1027552All Organisms → Viruses → Predicted Viral1410Open in IMG/M
3300009616|Ga0116111_1062331All Organisms → Viruses → Predicted Viral1033Open in IMG/M
3300009618|Ga0116127_1027766All Organisms → Viruses → Predicted Viral1759Open in IMG/M
3300009629|Ga0116119_1064375All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium937Open in IMG/M
3300009631|Ga0116115_1162993Not Available565Open in IMG/M
3300009632|Ga0116102_1203794Not Available531Open in IMG/M
3300009634|Ga0116124_1173719Not Available601Open in IMG/M
3300009636|Ga0116112_1121949Not Available730Open in IMG/M
3300009640|Ga0116126_1213484Not Available617Open in IMG/M
3300014151|Ga0181539_1066544Not Available1618Open in IMG/M
3300014158|Ga0181521_10304997Not Available815Open in IMG/M
3300014164|Ga0181532_10485935Not Available678Open in IMG/M
3300014495|Ga0182015_10046611All Organisms → Viruses → Predicted Viral3199Open in IMG/M
3300014495|Ga0182015_10056379All Organisms → Viruses → Predicted Viral2845Open in IMG/M
3300014501|Ga0182024_10208025All Organisms → Viruses → Predicted Viral2666Open in IMG/M
3300014654|Ga0181525_10493358Not Available677Open in IMG/M
3300014838|Ga0182030_10073630Not Available5026Open in IMG/M
3300017925|Ga0187856_1072970All Organisms → Viruses → Predicted Viral1426Open in IMG/M
3300017925|Ga0187856_1244852Not Available634Open in IMG/M
3300017929|Ga0187849_1113064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces triculaminicus1135Open in IMG/M
3300017929|Ga0187849_1291264Not Available613Open in IMG/M
3300017929|Ga0187849_1359674Not Available536Open in IMG/M
3300017929|Ga0187849_1397269Not Available503Open in IMG/M
3300017931|Ga0187877_1073470All Organisms → Viruses → Predicted Viral1484Open in IMG/M
3300017931|Ga0187877_1262794Not Available664Open in IMG/M
3300017931|Ga0187877_1391951Not Available525Open in IMG/M
3300017935|Ga0187848_10096571All Organisms → Viruses → Predicted Viral1350Open in IMG/M
3300017938|Ga0187854_10107945All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1298Open in IMG/M
3300017996|Ga0187891_1074598All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1342Open in IMG/M
3300018002|Ga0187868_1050397All Organisms → Viruses → Predicted Viral1783Open in IMG/M
3300018002|Ga0187868_1221339Not Available649Open in IMG/M
3300018003|Ga0187876_1091552All Organisms → Viruses → Predicted Viral1146Open in IMG/M
3300018004|Ga0187865_1071982All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1323Open in IMG/M
3300018004|Ga0187865_1287948Not Available543Open in IMG/M
3300018008|Ga0187888_1219056Not Available749Open in IMG/M
3300018009|Ga0187884_10099250All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1272Open in IMG/M
3300018013|Ga0187873_1125208All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon997Open in IMG/M
3300018015|Ga0187866_1284113Not Available584Open in IMG/M
3300018018|Ga0187886_1050452All Organisms → Viruses → Predicted Viral1928Open in IMG/M
3300018019|Ga0187874_10135155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces triculaminicus1051Open in IMG/M
3300018020|Ga0187861_10214029All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium855Open in IMG/M
3300018023|Ga0187889_10162113All Organisms → Viruses → Predicted Viral1052Open in IMG/M
3300018024|Ga0187881_10112600All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1218Open in IMG/M
3300018024|Ga0187881_10169249Not Available943Open in IMG/M
3300018025|Ga0187885_10343678Not Available672Open in IMG/M
3300018026|Ga0187857_10292706Not Available744Open in IMG/M
3300018026|Ga0187857_10345377Not Available675Open in IMG/M
3300018033|Ga0187867_10334424Not Available844Open in IMG/M
3300018034|Ga0187863_10882567Not Available508Open in IMG/M
3300018037|Ga0187883_10412763Not Available692Open in IMG/M
3300018038|Ga0187855_10719789Not Available582Open in IMG/M
3300018040|Ga0187862_10321325Not Available971Open in IMG/M
3300018040|Ga0187862_10846462Not Available527Open in IMG/M
3300018057|Ga0187858_10317398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces triculaminicus984Open in IMG/M
3300018057|Ga0187858_10751656Not Available579Open in IMG/M
3300020733|Ga0214172_1061565Not Available513Open in IMG/M
3300025381|Ga0208871_1011738All Organisms → Viruses → Predicted Viral1436Open in IMG/M
3300025400|Ga0208387_1041891Not Available740Open in IMG/M
3300025416|Ga0208877_1073318Not Available536Open in IMG/M
3300025441|Ga0208456_1047707Not Available825Open in IMG/M
3300025441|Ga0208456_1072979Not Available615Open in IMG/M
3300025444|Ga0208189_1031587All Organisms → Viruses → Predicted Viral1067Open in IMG/M
3300025446|Ga0208038_1036030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces triculaminicus1032Open in IMG/M
3300025460|Ga0208562_1032135All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1209Open in IMG/M
3300025460|Ga0208562_1078693Not Available668Open in IMG/M
3300025470|Ga0208389_1041760All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis893Open in IMG/M
3300025507|Ga0208188_1073165Not Available812Open in IMG/M
3300025723|Ga0208741_10049798Not Available956Open in IMG/M
3300025723|Ga0208741_10114500Not Available618Open in IMG/M
3300027660|Ga0209736_1005336All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis4231Open in IMG/M
3300027825|Ga0209039_10230477Not Available745Open in IMG/M
3300028759|Ga0302224_10014602Not Available2876Open in IMG/M
3300028759|Ga0302224_10024449Not Available2223Open in IMG/M
3300028776|Ga0302303_10085471Not Available1172Open in IMG/M
3300028863|Ga0302218_10164439Not Available704Open in IMG/M
3300029817|Ga0247275_1087976Not Available833Open in IMG/M
3300029951|Ga0311371_10890656Not Available1078Open in IMG/M
3300029955|Ga0311342_10393996All Organisms → Viruses → Predicted Viral1206Open in IMG/M
3300030007|Ga0311338_11336356Not Available671Open in IMG/M
3300030399|Ga0311353_10744619Not Available841Open in IMG/M
3300031236|Ga0302324_102226373Not Available679Open in IMG/M
3300032117|Ga0316218_1241993All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis629Open in IMG/M
3300032753|Ga0316224_1063096Not Available1508Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland38.00%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland22.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater12.00%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa8.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater5.00%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog4.00%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.00%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa2.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.00%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.00%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.00%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.00%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000553Trout Bog Lake May 28 2007 Hypolimnion (Trout Bog Lake Combined Assembly 47 Hypolimnion Samples, Aug 2012 Assem)EnvironmentalOpen in IMG/M
3300002933Combined Assembly of freshwater hypolimnion microbial communities from Trout Bog Lake, Wisconsin, USAEnvironmentalOpen in IMG/M
3300003814Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Jul09EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004685Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (version 2)EnvironmentalOpen in IMG/M
3300004770Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07EnvironmentalOpen in IMG/M
3300006072Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09EnvironmentalOpen in IMG/M
3300006110Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Jun09EnvironmentalOpen in IMG/M
3300006120Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08EnvironmentalOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009547Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40EnvironmentalOpen in IMG/M
3300009548Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100EnvironmentalOpen in IMG/M
3300009549Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100EnvironmentalOpen in IMG/M
3300009614Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_150EnvironmentalOpen in IMG/M
3300009616Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100EnvironmentalOpen in IMG/M
3300009618Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100EnvironmentalOpen in IMG/M
3300009629Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100EnvironmentalOpen in IMG/M
3300009631Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100EnvironmentalOpen in IMG/M
3300009632Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40EnvironmentalOpen in IMG/M
3300009634Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150EnvironmentalOpen in IMG/M
3300009636Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150EnvironmentalOpen in IMG/M
3300009640Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40EnvironmentalOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018003Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40EnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018015Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150EnvironmentalOpen in IMG/M
3300018018Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300020733Freshwater microbial communities from Trout Bog Lake, WI - 12JUL2007 epilimnionEnvironmentalOpen in IMG/M
3300025381Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07 (SPAdes)EnvironmentalOpen in IMG/M
3300025400Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09 (SPAdes)EnvironmentalOpen in IMG/M
3300025416Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH29Jun09 (SPAdes)EnvironmentalOpen in IMG/M
3300025441Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025444Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025446Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025460Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025470Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 (SPAdes)EnvironmentalOpen in IMG/M
3300025507Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025723Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 (SPAdes)EnvironmentalOpen in IMG/M
3300027660Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300028759Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1EnvironmentalOpen in IMG/M
3300028776Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028863Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1EnvironmentalOpen in IMG/M
3300029817Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25EnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300032117Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003EnvironmentalOpen in IMG/M
3300032753Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18013EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
TBL_comb47_HYPODRAFT_1011225213300000553FreshwaterMQDSELITPAYDRHMDGAPTRRELQRAFNKMGTNDSELMLMVDNLNLVVNLLCEKLNVTKGEIDVYVEKKAAEMNAFVEA
G310J44882_1005642713300002933FreshwaterMQDSELITPAYDAFLDGKPSRREMQKAFQKMGENDGNLMLMVDNLNHVANLLCEKAGVTAGEIEAYTAKKAAEMKAFTEAQEKAAAETTNVQPD*
G310J44882_1007154523300002933FreshwaterMQDSELITPAYDRHMDGAPTRRELQRAFNKMGTNDSELMLMVDNLNLVVNLLCEKLNVTKGEIDVYVEKKAAEMNAFVEAQKAAMVSEGGNE*
Ga0007877_103567513300003814FreshwaterMQDSELITPAYDRXMDGAPTRRELQRAFNKMGTNDSELMLMVDNLNLVVNLLCEKLNVTKGEIDVYVEK
Ga0062386_10092922323300004152Bog Forest SoilMSSIVTDSELIAPAFDKFLDGHPTRRELQKAFNKMGNNDSELMLMVDNLNLVCNCLCEKLNITRGELDTYVSKKVEEMKAWQEAQQKTQEQPNEQPNG*
Ga0065177_105049213300004685FreshwaterAFTALRSSMQDSELITPAYDAFLDGKPSRREMQKAFQKMGENDGNLMLMVDNLNHVANLLCEKAGVTAGEIEAYTAKKAAEMKAFTEAQEKAAAETTNVQPD*
Ga0007804_104484013300004770FreshwaterMQDSELITPAYDRFLDGTPTRRELQKAFNKMGNNDAELFSMIDTQALVGNFLCEKLGVTRGELDAYVAKKAEEVKA
Ga0007804_104708913300004770FreshwaterMIDSELITPAYDRFKDSSPTRREMQAAFNKMGNNDSELMLMIDNLNLVVNLLCEKAGVTKGEIEVYVAKKAAEMNALTEAKAQEAANERSNSSVSE*
Ga0007881_104707633300006072FreshwaterELITPAYDAFLDGKPSRREMQKAFQKMGENDGNLMLMVDNLNHVANLLCEKAGVTAGEIEAYTAKKAAEMKAFTEAQEKAAAETTNVQPD*
Ga0007871_107781623300006110FreshwaterMQDSELITPAYDAFLDGKPSRREMQKAFQKMGENDGNLMLMVDNLNHVANLLCEKAGVTAGEIEAYTAKKAAEMKAFTEAQENAAAETTNVQPD*
Ga0007867_107850513300006120FreshwaterIYVAFTALRSNMQDSELITPAYDAFLDGKPSRREMQKAFQKMGENDGNLMLMVDNLNHVANLLCEKAGVTAGEIEAYTAKKAAEMKAFTEAQEKAAAETTNVQPD*
Ga0116128_114051723300009518PeatlandMQDSELITPAYDRHMDGAPTRRELQKAFNKMGNNDSELMLMVDNLNLVTNLLCEKLNVTKGEIEVYVAKKAAEMNAFVEAQAK
Ga0116108_112730123300009519PeatlandMSNLDSELITPAYDAFLDGKPSRREMQKAFQKMGENDGNLMLMVDNLNHVANLLCEKAGVTAGEIEAYTSKKAAEMKAFTEAQEKAAAETTNVQPD*
Ga0116108_117052123300009519PeatlandMQDSELITPAYDRHMDGAPTRRELQKAFNKMGNNDSELMLMVDNLNLVTNLLCEKLNVTKGEIEVYVAKKAAEMNAFVEAQAKAAAEAADVITNG*
Ga0116136_110975823300009547PeatlandMDGAPTRRELQRAFNKMGTNDSELMLMVDNLNLVVNLLCEKLNVTKGEIDVYVEKKAAEMNAFVEAQKAAMVSEGGNE*
Ga0116107_114284023300009548PeatlandFKDSSPTRREMQAAFNKMGNNDSELMLMIDNLNLVVNLLCEKAGVTKGEIEVYVAKKAAEMNALAAGALDSAESGD*
Ga0116137_116383023300009549PeatlandMQDSELITPAYDRFLDGTPTRRELQKAFNKMGNNDAELFSMIDTQALVGNFLCEKLGVTRGELD
Ga0116104_102755223300009614PeatlandMQDSELITPAYDAFLYGKPSRREMQKAFQKMGENDGNLMLMVDNLNHVANLLCEKAGVTAGEIEAYTAKKAAEMKAFTEAQEKAAAETTNVQPD*
Ga0116111_106233113300009616PeatlandFTALRSNMQDSELITPAYDAFLDGKPSRREMQKAFQKMGENDGNLMLMVDNLNHVANLLCEKAGVTAGEIEAYTAKKAAEMKAFTEAQEKAAAETTNVQPD*
Ga0116127_102776623300009618PeatlandMSNLDSELITPAYDAFLDGKPSRREMQKAFQKMGENDGNLMLMVDNLNHVANLLCEKAGVTAGEIEAYTSKKAAEMKAFTEAQEKVQEPPNDAL*
Ga0116119_106437513300009629PeatlandMQDSELITPAYDSYLDGSPSRRELQRAFNKMGNNDSELFLMLDNLNLVANCLCEKAGVTRGELDAFVEKKKAEMAAVVEAQKATMASEGGKDAV*
Ga0116115_116299313300009631PeatlandAYDAFLDGKPSRREMQKAFQKMGENDGNLMLMVDNLNHVANLLCEKAGVTAGEIEAYTAKKAAEMKAFTEAQEKAAAETTNVQPD*
Ga0116102_120379423300009632PeatlandMQDSELITPAYDRFLDGTPTRRELQKAFNKMGNNDAELFSMIDTQALVGNFLCEKLGVTRGELDAYVAKKAEEVKALNE
Ga0116124_117371923300009634PeatlandMQDSELITPAYDAYLDGSPSRRELQRAFNKMGNNDSELFLMLDNLNLVANCLCEKAGVTRGELDAFVEKKKAEMVAITEAQKATMASEGGKDAV*
Ga0116112_112194923300009636PeatlandMIDSELIIPAHDRFLDGTPTRREMQAAFNKMGNNDSELMLMIDNLNLVVNLLCEKAGVTKGEIEVYVAKKAAEMNALTEAKAQKAANE*
Ga0116126_121348423300009640PeatlandMIDSELITPAHDRFLDGYPTRREMQKAFNKMGENDSNLFAAIDTQALVGNFLCEKLGVTRGELDAYVAKKAEEV
Ga0181539_106654433300014151BogMDGAPTRRELQRAFNKMGTNDSELMLMVDNLNLVVNLLCEKLNVTKGEIDVYVEKKAAEVNAFVEAQKAAMVSEGGNE*
Ga0181521_1030499723300014158BogMDEAPTRRELQRAFNKMGTNDSELMLMVDNLNLVVNLLCEKLNVTKGEIDVYVEKKAAEMNAFVEAQKAAMVSEGGNE*
Ga0181532_1048593513300014164BogMQDSELITPAYDAFLDGKPSRREMQKAFQKMGENDGNLMLMVDNLNHVANLLCEKAGVTAGEIEAYTAKKAAE
Ga0182015_1004661133300014495PalsaMSSLGSSLINPAYDSFLDGKPTRREMQEAFNRMGTNDGNLMLMLDNLNHVVNLLCEKSGVTAGEIEAYTAKKAAEMKAFLEAQEAANVVPNG*
Ga0182015_1005637923300014495PalsaMDGAPTRREMQKAFNKMGTNDSELMLMVDNLNLVVNLLCEKLNVTKGEIDVYVEKKAAEMNAFVEAQKAAMVSEGGNE*
Ga0182024_1020802533300014501PermafrostMIDSELITPAYDRHMDGAPTRREMQKAFNKMGTNDSELMLMVDNLNLVVNLLCEKLNVTKGEIEVYVTKKAKEMNAFVEAQTKAATEAANVITNG*
Ga0181525_1049335823300014654BogMQDSELITPAFDSFLDGNPTRREMQKAFNKMGNNDSELMLMVDNLNLVCNCLCEKLGITKGELDAFVQKKAEEMKAFTEAQQKLQEKTANAVSNG*
Ga0182030_1007363053300014838BogMQDSGLITPAYDEFMDGKPTRREMQKAFNKIGNNDSELMLMVDNLNLVVNLLCEKAGVTKGEIEVYVAKKAEEMKAYQEQQEKEAAIGGV*
Ga0187856_107297023300017925PeatlandMIDSELITPAYDRFKDSSPTRREMQAAFNKMGNNDSELMLMIDNLNLVVNLLCEKAGVTKGEIEVYVAKKAAEMNALTEAKAQEATDGV
Ga0187856_124485213300017925PeatlandMSNLDSELITPAYDAFLDGKPSRREMQKAFQKMGENDGNLMLMVDNLNHVANLLCEKAGVTAGEIEAYTAKKAAEMKAFTEAQEKAAAETTNV
Ga0187849_111306433300017929PeatlandMSDSELITPAYDKFLDGYATRREMQRAFNKMGNNDSELFLMLDNLNHVANLLCEKAGVTAGEIEAYTAKKAAEMKAFTEAQEKAAAETTNVQPD
Ga0187849_129126423300017929PeatlandMIDSELITPAYDRFKDSSPTRREMQAAFNKMGNNDSELMLMIDNLNLVVNLLCEKAGVTKGEIEVYVAKKAAEMNALTEAKAQEAANKRSNSSVS
Ga0187849_135967423300017929PeatlandMQDSELITPAYDAYLDGSPSRRELQRAFNKMGNNDSELFLMLDNLNLVANCLCEKAGVTRGELDAFVEKKKAEMVAITEAQKAAMVSEGGNE
Ga0187849_139726923300017929PeatlandMQDSELITPAYDAFLDGKPSRREMQKAFQKMGENDGNLMLMVDNLNHVANLLCEKAGVTAGEIEAYTAKKAAEMKAFTEAQEKAAAETTNVQPD
Ga0187877_107347033300017931PeatlandMIDSELITPAYDRFKDSSPTRREMQAAFNKMGNNDSELMLMIDNLNLVVNLLCEKAGVTKGEIEVYVAKKAAEMNALTEAKAQEAANERSNSSVSE
Ga0187877_126279423300017931PeatlandMQDSELITPAYDRHMDGAPTRRELQRAFNKMGTNDSELMLMVDNLNLVVNLLCEKLNVTKGEIDVYVEKKAAEMNAFVEAQKAAMVSEGGNE
Ga0187877_139195123300017931PeatlandMQDSELITPAYDSYLDGSPSRRELQRAFNKMGNNDSELFLMLDNLNLVANCLCEKAGVTRGELDAFVEKKKAEMVAITEAQKAAMVSEGGNE
Ga0187848_1009657123300017935PeatlandMIDSELITPAYDRFKDSSPTRREMQAAFNKMGNNDSELMLMIDNLNLVVNLLCEKAGVTKGEIEVYVAKKAAEMNALTEAKAQEAANERSNSSVS
Ga0187854_1010794523300017938PeatlandMQDSELITPAYDSYLDGSPSRRELQRAFNKMGNNDSELFLMLDNLNLVANCLCEKAGVTRGELDAFVEKKKAEMAAVVEAQKATMASEGGKDAV
Ga0187891_107459823300017996PeatlandMQDSELITPAYDSFLDGKPSRREMQAAFNKMGNNDSELFLMLDNLNLVANCLCEKAGVTRGELDAFVEKKKAEMAAVVEAQKATMASEGGKDAV
Ga0187868_105039733300018002PeatlandMSNLDSELITPAYDAFLDGKPSRREMQKAFQKMGENDGNLMLMVDNLNHVANLLCEKAGVTAGEIEAYTSKKAAEMKAFTEAQEKVQEPPNDAL
Ga0187868_122133913300018002PeatlandECKIYVAFTALRSNMQDSELITPAYDAFLDGKPSRREMQKAFQKMGENDGNLMLMVDNLNHVANLLCEKAGVTAGEIEAYTAKKAAEMKAFTEAQEKAAAETTNVQPD
Ga0187876_109155213300018003PeatlandIMIDSELITPAYDRFKDSSPTRREMQAAFNKMGNNDSELMLMIDNLNLVVNLLCEKAGVTKGEIEVYVAKKAAEMNALTEAKAQEAANERSNSSVSE
Ga0187865_107198223300018004PeatlandMQDSELITPAYDSYLDGSPSRRELQRAFNKMGNNDSELFLMLDNLNLVANCLCEKAGVTRGELDAFVEKKKAEMVAITEAQKAAMVSEGGKDAV
Ga0187865_128794813300018004PeatlandGKPSRREMQKAFQKMGENDGNLMLMVDNLNHVANLLCEKAGVTAGEIEAYTAKKAAEMKAFTEAQEKAAAETTNVQPD
Ga0187888_121905613300018008PeatlandMSNLDSELITPAYDAFLDGKPSRREMQKAFQKMGENDGNLMLMVDNLNHVANLLCEKAGVTAGEIEAYTSKKAAEMKAFTEAQ
Ga0187884_1009925023300018009PeatlandMQDSELITPAYDSYLDGSPSRRELQRAFNKMGNNDSELFLMLDNLNLVANCLCEKAVVTRGELDAFVEKKKAEMVAITEAQKAAMVSEGGKDAV
Ga0187873_112520813300018013PeatlandSPSRRELQRAFNKMGNNDSELFLMLDNLNLVANCLCEKAGVTRGELDAFVEKKKAEMVAITEAQKATMASEGGNAQEAKDA
Ga0187866_128411313300018015PeatlandMQDSELITPAHDRFLDGYPTRREMQKAFNKMGENDSNLFAAIDTQALVGNFLCEKLGVTRGELDAYVAKKAEEV
Ga0187886_105045223300018018PeatlandMIDSELITPAYDRFKDSSPTRREMQAAFNKMGNNDSELMLMIDNLNLVVNLLCEKAGVTKGEIEVYVAKKAAEMNALTEAKAQEAANERPNSSVSE
Ga0187874_1013515533300018019PeatlandMSDSELITPAYDKFLDGYATRREMQRAFNKMGNNDSELFLMLDNLNHVANLLCEKAGVTAGEIEAYTAKKAAEMKAFTEAQEK
Ga0187861_1021402923300018020PeatlandMQDSELITPAYDSYLDGSPSRRELQRAFNKMGNNDSELFLMLDNLNLVANCLCEKAGVTRGELDAFVEKKKAEMVAITEAQKATMASEGGKDAV
Ga0187889_1016211333300018023PeatlandMQDSELITPAYDRHMDGAPTRRELQKAFNKMGNNDSELMLMVDNLNLVTNLLCEKLNVTKGEIEVYVAKKAAEMNAFVEAQAKAAAEAADVITNG
Ga0187881_1011260023300018024PeatlandMQDSELITPAYDAYLDGSPSRRELQRAFNKMGNNDSELFLMLDNLNLVANCLCEKAGVTRGELDAFVEKKKAEMAAVVEAQKATMASEGGKDAV
Ga0187881_1016924913300018024PeatlandMQDSELITPAYDRFLDGTPTRRELQKAFNKMGENDSNLFAAIDTQALVGNFLCEKLGVTRGELDAYV
Ga0187885_1034367823300018025PeatlandMSNLDSELITPAYDAFLDGKPSRREMQKAFQKMGENDGNLMLMVDNLNHVANLLCEKAGVTAGEIEAYTAKKAAEMKAFTEAQEKAAAETTNVQPD
Ga0187857_1029270623300018026PeatlandMIDSELIIPAHDRFLDGTPTRREMQAAFNKMGNNDSELMLMIDNLNLVVNLLCEKAGVTKGEIEVYVAKKAAEMNALTEAKAQKAANE
Ga0187857_1034537713300018026PeatlandMIDSELITPAYDRFKDSSPTRREMQAAFNKMGNNDSELMLMIDNLNLVVNLLCEKAGVTKGEIEVYVAKKAAEMNALTEAKAQE
Ga0187867_1033442423300018033PeatlandMQDSELITPAYDRHMDEAPTRRELQRAFNKMGTNDSELMLMVDNLNLVVNLLCEKLNVTKGEIDVYVEKKAAEM
Ga0187863_1088256713300018034PeatlandPWRVTIMIDSELITPAYDRFKDSSPTRREMQAAFNKMGNNDSELMLMIDNLNLVVNLLCEKAGVTKGEIEVYVAKKAAEMNALAAGALDSAESGD
Ga0187883_1041276313300018037PeatlandELITPAYDAYLDGSPSRRELQRAFNKMGNNDSELFLMLDNLNLVANCLCEKAGVTRGELDAFVEKKKAEMVAITEAQKATMASEGGKDAV
Ga0187855_1071978923300018038PeatlandMQDSELITPAYDRHMDGAPTRREMQKAFNKMGNNDSELMLMVDNLNLVVNLLCEKLNVTKGEIE
Ga0187862_1032132523300018040PeatlandMQDSELITPAYDRFLDGTPTRRELQKAFNKMGNNDAELFSMIDTQALVGNFLCEKLGVTRGELDAYVAKKAEE
Ga0187862_1084646223300018040PeatlandMQDSELITPAYDSYLDGSPSRRELQRAFNKMGNNDSELFLMLDNLNLVANCLCEKAGVTRGELDAFVEKKKAEMVAITEA
Ga0187858_1031739833300018057PeatlandMSDSELITPAYDKFLDGYATRREMQRAFNKMGNNDSELFLMLDNLNHVANLLCEKAGVTAGEIEAYTAKKA
Ga0187858_1075165623300018057PeatlandMSNLDSELITPAYDAFLDGKPSRREMQKAFQKMGENDGNLMLMVDNLNHVANLLCEKAGVTAGEIEAYTSKKAAEMKAF
Ga0214172_106156513300020733FreshwaterMQDSELITPAYDRHMDEAPTRRELQRAFNKMGTNDSELMLMVDNLNLVVNLLCEKLNVTKGEIDVYVEKKAAEMNAFVEAQKAAMVSEGGNE
Ga0208871_101173833300025381FreshwaterSELITPAYDRHMDGAPTRRELQRAFNKMGTNDSELMLMVDNLNLVVNLLCEKLNVTKGEIDVYVEKKAAEMNAFVEAQKAAMVSEGGNE
Ga0208387_104189123300025400FreshwaterMQDSELITPAYDAFLDGKPSRREMQKAFQKMGENDGNLMLMVDNLNHVANLLCEKAGVTAGEIEAYTAKKAAEMKAFTEAQEKAAA
Ga0208877_107331823300025416FreshwaterMQDSELITPAYDRHMDGAPTRRELQRAFNKMGTNDSELMLMVDNLNLVVNLLCEKLNVTKGEIDVYVEK
Ga0208456_104770723300025441PeatlandMQDSELITPAYDRHMDEAPTRRELQRAFNKMGTNDSELMLMVDNLNLVVNLLCEKLNVTKGEIDVYVEKKAAEMNAFV
Ga0208456_107297913300025441PeatlandHMDGAPTRRELQRAFNKMGTNDSELMLMVDNLNLVVNLLCEKLNVTKGEIDVYVEKKAAEMNAFVEAQKAAMVSEGGNE
Ga0208189_103158723300025444PeatlandDRFKDSSPTRREMQAAFNKMGNNDSELMLMIDNLNLVVNLLCEKAGVTKGEIEVYVAKKAAEMNALTEAKAQEAANERSNSSVS
Ga0208038_103603033300025446PeatlandMSDSELITPAYDKFLDGYATRREMQRAFNKMGNNDSELFLMLDNLNHVANLLCEKAGVTAGEIEAYTAKKAAEMKAFTEAQEKA
Ga0208562_103213513300025460PeatlandRFENCGVSNMQDSELITPAYDSYLDGSPSRRELQRAFNKMGNNDSELFLMLDNLNLVANCLCEKAGVTRGELDAFVEKKKAEMAAVVEAQKATMASEGGKDAV
Ga0208562_107869313300025460PeatlandMQDSELITPAYDRHMDGAPTRRELQKAFNKMGNNDSELMLMVDNLNLVTNLLCEKLNVTKGEIEVYVAKKAAEM
Ga0208389_104176023300025470FreshwaterELITPAYDAFLDGKPSRREMQKAFQKMGENDGNLMLMVDNLNHVANLLCEKAGVTAGEIEAYTAKKAAEMKAFTEAQEKAAAETTNVQPD
Ga0208188_107316513300025507PeatlandKDSSPTRREMQAAFNKMGNNDSELMLMIDNLNLVVNLLCEKAGVTKGEIEVYVAKKAAEMNALTEAKAQEAANERSNSSVSE
Ga0208741_1004979813300025723FreshwaterMQDSELITPAYDRHMDGAPTRRELQRAFNKMGTNDSELMLMVDNLNLVVNLLCEKLNVTKGEIDVY
Ga0208741_1011450023300025723FreshwaterTPAYDRHMDGAPTRRELQRAFNKMGTNDSELMLMVDNLNLVVNLLCEKLNVTKGEIDVYVEKKAAEMNAFVEAQKAAMVSEGGNE
Ga0209736_100533623300027660Forest SoilMEDSELITPAFDRFLDEPPTRREMQKAFNKMGNNDSELMLMVDNLNLVANLLCEKAGVTKGEIEVYVAKKAAEMKAFIEDQAKIKESEAANVKLD
Ga0209039_1023047723300027825Bog Forest SoilMSSIVTDSELIAPAFDKFLDGHPTRRELQKAFNKMGNNDSELMLMVDNLNLVCNCLCEKLNITRGELDTYVSKKVEEMKAWQEAQQKTQEQPNEQPNG
Ga0302224_1001460253300028759PalsaMSDSGLITPAYNKHMDGHPTRREMQLAFNKMGTNDSELMLMVDNLNLVVNLLCEKAGVTKGEIEVYVAKKAAEMNAYIEAQKAAAEAASAKSNG
Ga0302224_1002444923300028759PalsaMSELITPAFDRFLDGQPTRREMQKAFNKMGSNDSELMLMLDNLNLVCNCLCEKLNVTKGELDAFVQKKTAEMLAYTAAKLAAEKEAKDAEATNVVTNG
Ga0302303_1008547123300028776PalsaMSDSGLITPAYDKHMDGHPTRREMQLAFNKMGTNDSELMLMVDNLNLVVNLLCEKAGVTKGEIEVYVAKKAAEMNAYIEAQKAAAEAASAKSNG
Ga0302218_1016443913300028863PalsaKHMDGHPTRREMQLAFNKMGTNDSELMLMVDNLNLVVNLLCEKAGVTKGEIEVYVAKKAAEMNAYIEAQKAAAEAASAKSNG
Ga0247275_108797623300029817SoilMQDSELITPAYDRFLDGTPTRRELQKAFNKMGNNDAELFSMIDTQALVGNFLCEKLGVTRGELDAYVAKKAEEV
Ga0311371_1089065613300029951PalsaDGHPTRREMQLAFNKMGTNDSELMLMVDNLNLVVNLLCEKAGVTKGEIEVYVAKKAAEMNAYIEAQKAAAEAASAKSNG
Ga0311342_1039399613300029955BogMQDSGLITPAYDEFMDGKPTRREMQKAFNKLGNNDSELMLMVDNLNLVVNLLCEKAGVTKGEIEVYVAKKAEEMKAYQEQQEK
Ga0311338_1133635613300030007PalsaMSELITPAFDRFLDGQPTRREMQKAFNKMGSNDSELMLMLDNLNLVCNCLCEKLNVTKGELDAFVQKKTAEMLA
Ga0311353_1074461913300030399PalsaMSDSGLITPAYDKHMDGHPTRREMQLAFNKMGTNDSELMLMVDNLNLVVNLLCEKAGVTKGEIEVYVAKKAAEMNAYI
Ga0302324_10222637323300031236PalsaMPDSELITPAYDKFLDGYATRREMQKAFNKMGNNDSELMLMVDNLNLVCNCLCEKAGVTKGELDAFVARKTAEMQAYTAAQLAREAEAKKEALSE
Ga0316218_124199323300032117FreshwaterITPAYDAFLDGKPSRREMQKAFQKMGENDGNLMLMVDNLNHVANLLCEKAGVTAGEIEAYTAKKAAEMKAFTEAQEKAAAETTNVQPD
Ga0316224_106309633300032753FreshwaterITPAYDRHMDGAPTRRELQRAFNKMGTNDSELMLMVDNLNLVVNLLCEKLNVTKGEIDVYVEKKAAEMNAFVEAQKAAMVSEGGNE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.