Metagenome / Metatranscriptome Family F104271

Overview

Basic Information

• Family ID: F104271
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 100
• Average Sequence Length: 41 residues
• Representative Sequence: LVFFDSLAGKAFSARSIKLCLVDNQRSSGVTVAGFEFVSD
• Number of Associated Samples: 66
• Number of Associated Scaffolds: 100

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 0.00 %
• % of genes near scaffold ends (potentially truncated): 98.00 %
• % of genes from short scaffolds (< 2000 bps): 96.00 %
• Associated GOLD sequencing projects: 65
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (90.000 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (77.000 % of family members)
• Environment Ontology (ENVO): Unclassified (92.000 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface (87.000 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 36.76%
  β-sheet: 0.00%
  Coil/Unstructured: 63.24%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 100 Family Scaffolds
PF07727	RVT_2	1.00

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	10.00 %
Unclassified	root	N/A	90.00 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	10.00 %
Unclassified	root	N/A	90.00 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	1.00 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	9.00 %
Unclassified	root	N/A	90.00 %

Level 4

Name	Rank	Taxonomy	Distribution
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	1.00 %
Unclassified	root	N/A	90.00 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	9.00 %

Level 5

Name	Rank	Taxonomy	Distribution
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	1.00 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	9.00 %
Unclassified	root	N/A	90.00 %

Level 6

Name	Rank	Taxonomy	Distribution
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1.00 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	9.00 %
Unclassified	root	N/A	90.00 %

Level 7

Name	Rank	Taxonomy	Distribution
Chitinophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia	1.00 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	9.00 %
Unclassified	root	N/A	90.00 %

Level 8

Name	Rank	Taxonomy	Distribution
Chitinophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales	1.00 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	8.00 %
Unclassified	root	N/A	90.00 %

Level 9

Name	Rank	Taxonomy	Distribution
Chitinophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	1.00 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	8.00 %
Unclassified	root	N/A	90.00 %

Level 10

Name	Rank	Taxonomy	Distribution
Ferruginibacter	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ferruginibacter	1.00 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	8.00 %
Unclassified	root	N/A	90.00 %

Level 11

Name	Rank	Taxonomy	Distribution
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	8.00 %
Unclassified	root	N/A	90.00 %
unclassified Ferruginibacter	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ferruginibacter → unclassified Ferruginibacter	1.00 %

Level 12

Name	Rank	Taxonomy	Distribution
Ferruginibacter sp. HRS2-29	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ferruginibacter → unclassified Ferruginibacter → Ferruginibacter sp. HRS2-29	1.00 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	8.00 %
Unclassified	root	N/A	90.00 %

Level 13

Name	Rank	Taxonomy	Distribution
Ferruginibacter sp. HRS2-29	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ferruginibacter → unclassified Ferruginibacter → Ferruginibacter sp. HRS2-29	1.00 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	8.00 %
Unclassified	root	N/A	90.00 %

Level 14

Name	Rank	Taxonomy	Distribution
Ferruginibacter sp. HRS2-29	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ferruginibacter → unclassified Ferruginibacter → Ferruginibacter sp. HRS2-29	1.00 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	8.00 %
Unclassified	root	N/A	90.00 %

Level 15

Name	Rank	Taxonomy	Distribution
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	7.00 %
Ferruginibacter sp. HRS2-29	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ferruginibacter → unclassified Ferruginibacter → Ferruginibacter sp. HRS2-29	1.00 %
Unclassified	root	N/A	90.00 %

Level 16

Name	Rank	Taxonomy	Distribution
Ferruginibacter sp. HRS2-29	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ferruginibacter → unclassified Ferruginibacter → Ferruginibacter sp. HRS2-29	1.00 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	7.00 %
Unclassified	root	N/A	90.00 %

Level 17

Name	Rank	Taxonomy	Distribution
Ferruginibacter sp. HRS2-29	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ferruginibacter → unclassified Ferruginibacter → Ferruginibacter sp. HRS2-29	1.00 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	7.00 %
Unclassified	root	N/A	90.00 %

Level 18

Name	Rank	Taxonomy	Distribution
Ferruginibacter sp. HRS2-29	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ferruginibacter → unclassified Ferruginibacter → Ferruginibacter sp. HRS2-29	1.00 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	6.00 %
Unclassified	root	N/A	90.00 %

Level 19

Name	Rank	Taxonomy	Distribution
Arundinoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae	1.00 %
Ferruginibacter sp. HRS2-29	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ferruginibacter → unclassified Ferruginibacter → Ferruginibacter sp. HRS2-29	1.00 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	5.00 %
Unclassified	root	N/A	90.00 %

Level 20

Name	Rank	Taxonomy	Distribution
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	1.00 %
Arundineae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae	1.00 %
Ferruginibacter sp. HRS2-29	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ferruginibacter → unclassified Ferruginibacter → Ferruginibacter sp. HRS2-29	1.00 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	4.00 %
Unclassified	root	N/A	90.00 %

Level 21

Name	Rank	Taxonomy	Distribution
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	1.00 %
Arundo	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo	1.00 %
Ferruginibacter sp. HRS2-29	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ferruginibacter → unclassified Ferruginibacter → Ferruginibacter sp. HRS2-29	1.00 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	4.00 %
Unclassified	root	N/A	90.00 %

Level 22

Name	Rank	Taxonomy	Distribution
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	1.00 %
Ferruginibacter sp. HRS2-29	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ferruginibacter → unclassified Ferruginibacter → Ferruginibacter sp. HRS2-29	1.00 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	4.00 %
Saccharinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae	1.00 %
Unclassified	root	N/A	90.00 %

Level 23

Name	Rank	Taxonomy	Distribution
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	1.00 %
Ferruginibacter sp. HRS2-29	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ferruginibacter → unclassified Ferruginibacter → Ferruginibacter sp. HRS2-29	1.00 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	4.00 %
Saccharum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum	1.00 %
Unclassified	root	N/A	90.00 %

Level 24

Name	Rank	Taxonomy	Distribution
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	1.00 %
Ferruginibacter sp. HRS2-29	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ferruginibacter → unclassified Ferruginibacter → Ferruginibacter sp. HRS2-29	1.00 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1.00 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	3.00 %
Saccharum officinarum complex	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex	1.00 %
Unclassified	root	N/A	90.00 %

Level 25

Name	Rank	Taxonomy	Distribution
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	1.00 %
Ferruginibacter sp. HRS2-29	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ferruginibacter → unclassified Ferruginibacter → Ferruginibacter sp. HRS2-29	1.00 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1.00 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	3.00 %
Saccharum officinarum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum officinarum	1.00 %
Unclassified	root	N/A	90.00 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300005618|Ga0068864_101199383	Not Available	757
3300005841|Ga0068863_101780737	Not Available	626
3300005841|Ga0068863_101817246	Not Available	619
3300009553|Ga0105249_10833658	Not Available	987
3300009553|Ga0105249_12571371	Not Available	581
3300009975|Ga0105129_117435	Not Available	541
3300009980|Ga0105135_112192	Not Available	677
3300014486|Ga0182004_10147521	Not Available	892
3300014968|Ga0157379_11124789	Not Available	753
3300015278|Ga0182099_1002781	Not Available	1185

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Category

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	89.00%
Rhizoplane	Host-Associated → Plants → Rhizoplane	5.00%
Rhizosphere	Host-Associated → Plants → Rhizosphere	3.00%
Roots	Host-Associated → Plants → Roots	1.00%
Unclassified	Host-Associated → Plants → Unclassified	2.00%

Type

Habitat	Taxonomy	Distribution
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.00%
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	89.00%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	3.00%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	2.00%
Unclassified	Host-Associated → Plants → Roots → Unclassified	1.00%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	89.00%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.00%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	3.00%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	2.00%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	1.00%

Habitat

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	1.00%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	11.00%
Root	Host-Associated → Plants → Roots → Unclassified → Unclassified → Root	1.00%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	2.00%
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	77.00%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	5.00%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.00%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.00%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated
3300009975	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaG	Host-Associated
3300009980	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG	Host-Associated
3300014486	Endophyte microbial communities from Sorghum bicolor roots, Mead, Nebraska, USA - 072115-40_1 MetaG	Host-Associated
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated
3300015278	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015280	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015290	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068864_1011993831	3300005618	Switchgrass Rhizosphere	VFFDSLAGKAFSARSIKLCLVDNQRSGGVTVAGFEFVSD*
Ga0068863_1017807371	3300005841	Switchgrass Rhizosphere	LAGKAFSARSIKLCLVDNQRSIGLMIAGLRIMSD*
Ga0068863_1018172462	3300005841	Switchgrass Rhizosphere	FLLVFFDSLVEKVFLASSIKSCLVDNQWSYVVTIAGLGIVSD*
Ga0105249_108336581	3300009553	Switchgrass Rhizosphere	FLLVFFDSLAGKAFSARSIKLCLVDNQWSGGVTVAGFEFVYD*
Ga0105249_125713711	3300009553	Switchgrass Rhizosphere	LVFFDSLAGKAFSARSIKLCLVDNQRSGGVTVAGFEFVSD*
Ga0105129_1174351	3300009975	Switchgrass Associated	LAGKAFLARSFKLCLVDNQRSCGVTVAGFEFVSD*
Ga0105135_1121921	3300009980	Switchgrass Associated	IIRLRIYIVLLVSFDSLVGKAFSARSITLCLVDNQRSGGVTVAGFEFVFD*
Ga0182004_101475211	3300014486	Root	LVFLDLLAGTTFLARLIKLCLVDNQRSSGVTVAGFESC*
Ga0157379_111247891	3300014968	Switchgrass Rhizosphere	DCVVYIFLLVFFDSLAGKAFSVRSIKLCLVDNQWSSGVTVA*
Ga0182099_10027811	3300015278	Switchgrass Phyllosphere	PFLLVFFDSLAGKAFSARSIKLCLVDNQRSGGVTVAGFEFVSD*
Ga0182100_10457581	3300015280	Switchgrass Phyllosphere	VFFDSLAGKAFLARSIELCSVDNQQSSSVMVAGLQIISD*
Ga0182105_10891502	3300015290	Switchgrass Phyllosphere	RVYIFLLVSFDSLAGKAFSARSIKLFLVDNQRSSGVAVAGFESC*
Ga0182103_10283381	3300015293	Switchgrass Phyllosphere	FDSLAGKAFSARSIKLCLVDNQRSGGVTVAGFEFMSD*
Ga0182104_10796851	3300015297	Switchgrass Phyllosphere	GSFAGKAFSARSIKLCLVDNQRSSGVTIAGFEFVFD*
Ga0182184_10150422	3300015301	Switchgrass Phyllosphere	CNFRLRVYPFLLVFFDSLARKAFSARSIKLCLVDNQRSGGVTVAGFEFISD*
Ga0182184_11024642	3300015301	Switchgrass Phyllosphere	VYIFLLVFFDSLAGKAFSARSIKLCLVDNQQSSGVTVA*
Ga0182162_10276711	3300015310	Switchgrass Phyllosphere	LLVFFDFLAGKAFFVRLIELCLVDNQWSNGVTVVGVQIVF
Ga0182182_10853092	3300015311	Switchgrass Phyllosphere	LLVFFDSLAGKAFLARSIKLFLVDNQWSGGVTVAGFEFVSD*
Ga0182164_10411492	3300015313	Switchgrass Phyllosphere	VYIFLLVSFDSLAGKAFLARSIKLCLVDNERSNGVAVAGFESC*
Ga0182121_10449262	3300015316	Switchgrass Phyllosphere	VFFDLRAGKAFLATSIKLCLVDNQRCGGITVAGFEFVSD*
Ga0182136_10768351	3300015317	Switchgrass Phyllosphere	IYNFRLCVYPFLLVFFDFLAGKAFFVRLIELCLVDNQWSSGVTVVGVQIVSD*
Ga0182136_11178791	3300015317	Switchgrass Phyllosphere	ILRVYIFLLVSFDSLVGKAFSARSIKLSFVDNQRSSGVAVAGFESC*
Ga0182130_10169471	3300015319	Switchgrass Phyllosphere	YPFLLVFFDSLAGKAFSARSIKLCLVDNQRSGGVMVAGFEFVSD*
Ga0182130_11243471	3300015319	Switchgrass Phyllosphere	LVFFDSLARKAFLARSIKLCLVDNQRSGGVTVAGFEFMSD*
Ga0182165_10233851	3300015320	Switchgrass Phyllosphere	LLVFFDSLVGKTFLARSIKLCLVDNQRSTGVMVAGFESCLI*
Ga0182165_10457001	3300015320	Switchgrass Phyllosphere	FDSLAGKAFLARSIKLCLVDKQWSSGVTVAGLRIMSD*
Ga0182134_10419821	3300015324	Switchgrass Phyllosphere	YPFLLVFFDSLAGKAFLARSIKLCLVDNQWSSGVTVAGL*
Ga0182134_10707151	3300015324	Switchgrass Phyllosphere	VYSFLLVFFDSVAGKTFLARLIKLYLIDNQWNSGVMVAGLRIVSD*
Ga0182148_10535061	3300015325	Switchgrass Phyllosphere	LLVFFDSLAGKAFLERSIKLCLVDNQWSGGVMVAGFEF
Ga0182166_10337562	3300015326	Switchgrass Phyllosphere	FAEKDFSARSIKLCLVDNQRSNDVTVAVLRIVYD*
Ga0182166_10974321	3300015326	Switchgrass Phyllosphere	LVFFDSLAEKAFLARSIKLCLVDNQWSGGVMVAGFEFMSD*
Ga0182135_10230862	3300015329	Switchgrass Phyllosphere	VYIFLLVSFDSLAGKAFLARSIKLCLVDNQRSSGVALAVFESS*
Ga0182135_10800611	3300015329	Switchgrass Phyllosphere	FLLVFFDSLVGKAFSARSIKMCLVDNQRSSGVTVA*
Ga0182152_11146431	3300015330	Switchgrass Phyllosphere	FLLVFFDSLAGKAFLARSIKLCLVDNQWSGGVTVAGFELVSD*
Ga0182117_10698351	3300015332	Switchgrass Phyllosphere	SFILAIIRLCVYPFLLVFFDSLVEKAFLARSIKLCLVDNQRSSGVAVAGFESC*
Ga0182147_10756701	3300015333	Switchgrass Phyllosphere	TFLLVFFDSLAGKVFSVRSIKLCLVDNQWSSGVTVAGLRIVSD*
Ga0182147_10859322	3300015333	Switchgrass Phyllosphere	FDSLARKAFSARSIKLCLVDNQRSGGVTVAGFEFVSD*
Ga0182132_10702091	3300015334	Switchgrass Phyllosphere	FDSLAGKAFSVRSIKLCLVDNQRSGGVTVAGFEFVFD*
Ga0182132_11641531	3300015334	Switchgrass Phyllosphere	NLLAEKVFLARSIKLCLVDNQRSSGVTVAGLRIVSD*
Ga0182116_11470251	3300015335	Switchgrass Phyllosphere	LVGKAFLARSIKLCLVDNQRSSGVTVAGLRIVSD*
Ga0182150_10331981	3300015336	Switchgrass Phyllosphere	RLRVYPFLLVFFDSLAGKAFSARSIKLCLVDNQWSSGVAVVGFESC*
Ga0182150_11009041	3300015336	Switchgrass Phyllosphere	SLAGKAFSARSIKLCLVDNQRSGGVTVAGFEFVSD*
Ga0182151_10456532	3300015337	Switchgrass Phyllosphere	FFDSLAGKAFSARSIKLCLVDNQRSGGVTVAGFEFVSD*
Ga0182151_11140901	3300015337	Switchgrass Phyllosphere	LRVYPFLLVFFDSLARKAFSARSIKLCLVDNQRSGGVTVAGFEFVSY*
Ga0182137_10590671	3300015338	Switchgrass Phyllosphere	VSFDSLAGKAFSARSIKLCLVDNQRNSGVAVAGFESC*
Ga0182137_11427862	3300015338	Switchgrass Phyllosphere	NSLAGKAFLARSIKLCLVDNQRSSGVAVTGFESC*
Ga0182149_10047721	3300015339	Switchgrass Phyllosphere	IFLLVSFDSLAEKVFSARSIKLCLVDNQQSSGVAVAGFESC*
Ga0182149_11098282	3300015339	Switchgrass Phyllosphere	FLLVSFDLLAEKAFSARSIKLCLVDNQRSSGVAVAGFESC*
Ga0182133_11704301	3300015340	Switchgrass Phyllosphere	FNLLVGKAFSTRSIKLCLVDNQRSSGVAVAGFELR*
Ga0182115_11857222	3300015348	Switchgrass Phyllosphere	VFFDSLAGKAFSARSIKLCLVDNQRSGGVMVAGFEFVSD*
Ga0182115_11859561	3300015348	Switchgrass Phyllosphere	LLVFFDSLAGKAFSARSIKLCLVDNQRSCGVMVA*
Ga0182115_12370111	3300015348	Switchgrass Phyllosphere	VFFDSLAGKAFLTRSIKLCLVDNQQSSGVTVAGH*
Ga0182185_10029181	3300015349	Switchgrass Phyllosphere	NFRLCVYPFLLVFFDSLAGKAFSARSIKLCLVDNQRSGGVTVAGFEFVSD*
Ga0182185_10964632	3300015349	Switchgrass Phyllosphere	FFDSLAGKAFLARTIKLCLVDNQQSSDVTVVGLRIVSD*
Ga0182185_10996752	3300015349	Switchgrass Phyllosphere	FLLVFFDSLAGKAFLARSIKLCLVDNQRSSGVMVASFEFVSD*
Ga0182185_12173781	3300015349	Switchgrass Phyllosphere	VYTFLLVFFDSLAGKAFLVRSIKLCLVGNQQSSGVTIVGFEFVSD*
Ga0182163_11775931	3300015350	Switchgrass Phyllosphere	MSFDSLAGKAFSARSTNLCLVDNQRSSGVVVAGFESC*
Ga0182163_12576821	3300015350	Switchgrass Phyllosphere	VYPLLLMFFDSLARKAFLVRLVKLCLVDNQWSSGVTVA*
Ga0182163_12599061	3300015350	Switchgrass Phyllosphere	FDSLVGKAFLARSIKLCLVDNQRSSGVTVAELQIVFD*
Ga0182169_11539621	3300015352	Switchgrass Phyllosphere	LAGKAFLARSIKLYLVDNQWSGGVTVAGFEFVSD*
Ga0182169_11781301	3300015352	Switchgrass Phyllosphere	CVYIFLLVFFDSLAGKAFSAMSIKLCMVDNQRSSGVTVA*
Ga0182169_12603681	3300015352	Switchgrass Phyllosphere	FLLVFFDSLAGKAFSARSIKLCLVDNQRSSGVAVAGFESC*
Ga0182179_12419031	3300015353	Switchgrass Phyllosphere	LVFFDSLAGKAFLVRSIKLCLIDNQRSGGVMVAGFEFMSD*
Ga0182179_12968982	3300015353	Switchgrass Phyllosphere	VSFDSLAGKAFSARSIKLCLVDNQRSSGVGVAGFESC*
Ga0182167_10443061	3300015354	Switchgrass Phyllosphere	RVYPFLLVFFDSLAGKAFSVRSIKLCLVDNQQSSGVMVAGLQIVSD*
Ga0182167_10838401	3300015354	Switchgrass Phyllosphere	FDSLAGKAFSARSIKLCLVDNQRSGGVTVVGFEFVSD*
Ga0182167_11173682	3300015354	Switchgrass Phyllosphere	LLVFFDSLAGKAFSARSIKLCLVDNQWSSGVAVAGFESC*
Ga0182167_11634791	3300015354	Switchgrass Phyllosphere	DSLAGKAFLARSIKLCLVDNQQNSGVTVAELRIVSD*
Ga0182167_11982191	3300015354	Switchgrass Phyllosphere	RLRVYTFLLVFFDSLAEKAFLARSIKLCLVDNQQSRGVAVAGFESC*
Ga0182167_13326361	3300015354	Switchgrass Phyllosphere	VFFDSLAGKVFLARLIKLCLVDNQRSGGVIVADFEFVSD*
Ga0182197_10183482	3300017408	Switchgrass Phyllosphere	FDSLAGKAFLARSIRLCLVDNQWSGGVTVVGFEFVSD
Ga0182199_10559392	3300017412	Switchgrass Phyllosphere	LLVFFDSLAGKAFSARSIKLCLVDNQRSGGVTVAGFEFMSD
Ga0182199_11037061	3300017412	Switchgrass Phyllosphere	VFFDSLAGKDFLARSIKLCLVDNQRSSGVMVAGLRIVS
Ga0182195_10496531	3300017414	Switchgrass Phyllosphere	DSLAGKAFSARSIKLCLIDNQWSSGVTVAGLRIVSD
Ga0182201_10281861	3300017422	Switchgrass Phyllosphere	VFFDSLAGKAFLARSIKLCLVDNQWSSGVAVAGFETC
Ga0182219_10406971	3300017424	Miscanthus Phyllosphere	FLLVLFDSLAGKAFLARSIKLCLVDNQRSSGVMVAGFESRLI
Ga0182194_11118811	3300017435	Switchgrass Phyllosphere	NFRLRVYPFLLVFFDSRAGKVFSARSIKLCLVDNQWSSGVAVVGFESC
Ga0182200_10094944	3300017439	Switchgrass Phyllosphere	SFDSLTEKVFSARSIKLCLVDNQQSSGVAVAGFESC
Ga0182200_10899862	3300017439	Switchgrass Phyllosphere	RVYHFLLMFFDSLAGKAFSARSIKLCLVDNQRSGGVMVAGFEFVSD
Ga0182200_11041112	3300017439	Switchgrass Phyllosphere	VYPFLLVFFDSLAGKAFSARSIKLCLVDNQRSGGVTVAGFEFVSD
Ga0182217_10653781	3300017446	Switchgrass Phyllosphere	ICNIRLRVYIFLLVFFDSLAGKAFSARSIKLCLVDNQRSSGVTVA
Ga0182215_11467331	3300017447	Switchgrass Phyllosphere	NFRLRVSTFLLVFFDSLAGKAFLARSIKLCLVDNQRSSGVMVAGFESVSD
Ga0182216_10327692	3300017693	Switchgrass Phyllosphere	FWLVFFDSLAGKAFLARSIELCSVDNQQSSSVMVAGLQIISD
Ga0207676_113329122	3300026095	Switchgrass Rhizosphere	LRVYIFLLVFFDSLVGKAFSARSIKLCLVDNQQSSGVTVA
Ga0268322_10049902	3300028049	Phyllosphere	LLLVFFDLFAGKAFSARSIKLCLFDNKWSSGVTVA
Ga0268352_10161731	3300028057	Phyllosphere	FLLVFFDSLAGKAFSARSIKLCLVDNQRSYGVAVAGFESCMI
Ga0268320_10263721	3300028153	Phyllosphere	RLRVSTFLLVFFDSLAGKAFSARSIKLCLVDNQRSSGVTVEGLRIVSD
Ga0268320_10301831	3300028153	Phyllosphere	HSLVGKTFLARSIELCLVDNQWSSGVMVAGLRIVSD
Ga0268341_10055391	3300028154	Phyllosphere	DSLAGKAFSARSIKLYLVDNQRSGGVTVAGFEFVSD
Ga0268316_10030181	3300028253	Phyllosphere	FDSLAGKAFSVRSIKLCLVNNQRSGGVTVAGFEFMSD
Ga0268264_101092641	3300028381	Switchgrass Rhizosphere	LLVFFDALAGKAFSERSIKLCLVDNQRSYGVAVAGFESCMI
Ga0268302_1033571	3300028464	Phyllosphere	VYPFLLVFFDSLAGKAFSARSIKLCLVDNQRSGGVTVAGFEFMSD
Ga0268315_10115981	3300028472	Phyllosphere	LRVYPFLLVFFDSLAGKAFSARSIKLCLVDNQRSGGVTVAGFEFVSD
Ga0268319_10159621	3300028473	Phyllosphere	DSLARKAFSARSIKLCLVDNQRSGGVTVVGFEFVSD
Ga0268305_1031262	3300028525	Phyllosphere	LVFFDSLAGKAFSARSIKLCLVDNQRSSGVTVAGFEFVSD
Ga0268311_10057191	3300028529	Phyllosphere	FDSLAGKAFSARSIKLCLVDNQRSGGVTVAGFEFVSD
Ga0214493_11305821	3300032465	Switchgrass Phyllosphere	PFLLVFFDSLAEKAFSARSIKLCLVDNQRSGGVMVAGFEFVSD
Ga0314734_10616571	3300032916	Switchgrass Phyllosphere	PFLHVFFDLLAGKAFLARSIKLFLVDNQWSSGVTVAGLRIVSD
Ga0314741_10428721	3300032934	Switchgrass Phyllosphere	LVFFDSLAGKAFSARSIKLCLVDNQRSGDVTVAGFEFVSN
Ga0314759_12020351	3300033535	Switchgrass Phyllosphere	FDSLAGKAFSARSIKLCLVDNQRSGDVTVAGFEFVSD