NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F104254

Metagenome Family F104254

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F104254
Family Type Metagenome
Number of Sequences 100
Average Sequence Length 41 residues
Representative Sequence RQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPNKK
Number of Associated Samples 33
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.01 %
% of genes near scaffold ends (potentially truncated) 99.00 %
% of genes from short scaffolds (< 2000 bps) 35.00 %
Associated GOLD sequencing projects 23
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge
(54.000 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(67.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 27.50%    β-sheet: 0.00%    Coil/Unstructured: 72.50%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF02620YceD 6.00
PF07661MORN_2 5.00
PF08245Mur_ligase_M 5.00
PF01553Acyltransferase 4.00
PF03793PASTA 4.00
PF03721UDPG_MGDP_dh_N 3.00
PF04468PSP1 2.00
PF01170UPF0020 2.00
PF01476LysM 2.00
PF14289DUF4369 2.00
PF01551Peptidase_M23 2.00
PF00677Lum_binding 2.00
PF09827CRISPR_Cas2 2.00
PF14903WG_beta_rep 2.00
PF13742tRNA_anti_2 2.00
PF00561Abhydrolase_1 2.00
PF00041fn3 2.00
PF00496SBP_bac_5 2.00
PF00929RNase_T 2.00
PF01255Prenyltransf 1.00
PF01965DJ-1_PfpI 1.00
PF01293PEPCK_ATP 1.00
PF07973tRNA_SAD 1.00
PF01712dNK 1.00
PF08126Propeptide_C25 1.00
PF13715CarbopepD_reg_2 1.00
PF11551Omp28 1.00
PF02272DHHA1 1.00
PF00528BPD_transp_1 1.00
PF00590TP_methylase 1.00
PF03938OmpH 1.00
PF09603Fib_succ_major 1.00
PF13505OMP_b-brl 1.00
PF01725Ham1p_like 1.00
PF04545Sigma70_r4 1.00
PF02577BFN_dom 1.00
PF04397LytTR 1.00
PF00085Thioredoxin 1.00
PF05746DALR_1 1.00
PF02348CTP_transf_3 1.00
PF01790LGT 1.00
PF00294PfkB 1.00
PF02926THUMP 1.00
PF00795CN_hydrolase 1.00
PF10365DUF2436 1.00
PF13573SprB 1.00
PF00829Ribosomal_L21p 1.00
PF08281Sigma70_r4_2 1.00
PF02545Maf 1.00
PF00403HMA 1.00
PF00156Pribosyltran 1.00
PF01656CbiA 1.00
PF02801Ketoacyl-synt_C 1.00
PF01609DDE_Tnp_1 1.00
PF13585CHU_C 1.00
PF13292DXP_synthase_N 1.00
PF03485Arg_tRNA_synt_N 1.00
PF01048PNP_UDP_1 1.00
PF12724Flavodoxin_5 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG139923S rRNA accumulation protein YceD (essential in plants, uncharacterized in bacteria)Translation, ribosomal structure and biogenesis [J] 6.00
COG2849Antitoxin component YwqK of the YwqJK toxin-antitoxin moduleDefense mechanisms [V] 5.00
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 3.00
COG1893Ketopantoate reductaseCoenzyme transport and metabolism [H] 3.00
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 3.00
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 3.00
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 3.00
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 2.00
COG2264Ribosomal protein L11 methylase PrmATranslation, ribosomal structure and biogenesis [J] 2.00
COG2263Predicted RNA methylaseGeneral function prediction only [R] 2.00
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 2.00
COG2265tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD familyTranslation, ribosomal structure and biogenesis [J] 2.00
COG281316S rRNA G1207 or 23S rRNA G1835 methylase RsmC/RlmGTranslation, ribosomal structure and biogenesis [J] 2.00
COG1774Cell fate regulator YaaT, PSP1 superfamily (controls sporulation, competence, biofilm development)Signal transduction mechanisms [T] 2.00
COG0018Arginyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 2.00
COG109223S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmITranslation, ribosomal structure and biogenesis [J] 2.00
COG2890Methylase of polypeptide chain release factorsTranslation, ribosomal structure and biogenesis [J] 2.00
COG4123tRNA1(Val) A37 N6-methylase TrmN6Translation, ribosomal structure and biogenesis [J] 2.00
COG0307Riboflavin synthase alpha chainCoenzyme transport and metabolism [H] 2.00
COG0286Type I restriction-modification system, DNA methylase subunitDefense mechanisms [V] 2.00
COG011623S rRNA G2445 N2-methylase RlmLTranslation, ribosomal structure and biogenesis [J] 2.00
COG1428Deoxyadenosine/deoxycytidine kinaseNucleotide transport and metabolism [F] 1.00
COG2825Periplasmic chaperone for outer membrane proteins, Skp familyCell wall/membrane/envelope biogenesis [M] 1.00
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 1.00
COG2820Uridine phosphorylaseNucleotide transport and metabolism [F] 1.00
COG3293TransposaseMobilome: prophages, transposons [X] 1.00
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 1.00
COG2608Copper chaperone CopZInorganic ion transport and metabolism [P] 1.00
COG5421TransposaseMobilome: prophages, transposons [X] 1.00
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 1.00
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 1.00
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 1.00
COG1866Phosphoenolpyruvate carboxykinase, ATP-dependentEnergy production and conversion [C] 1.00
COG1861Spore coat polysaccharide biosynthesis protein SpsF, cytidylyltransferase familyCell wall/membrane/envelope biogenesis [M] 1.00
COG1259Bifunctional DNase/RNaseGeneral function prediction only [R] 1.00
COG1212CMP-2-keto-3-deoxyoctulosonic acid synthetaseCell wall/membrane/envelope biogenesis [M] 1.00
COG1083CMP-N-acetylneuraminic acid synthetase, NeuA/PseF familyCell wall/membrane/envelope biogenesis [M] 1.00
COG0813Purine-nucleoside phosphorylaseNucleotide transport and metabolism [F] 1.00
COG0775Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnBNucleotide transport and metabolism [F] 1.00
COG0751Glycyl-tRNA synthetase, beta subunitTranslation, ribosomal structure and biogenesis [J] 1.00
COG0682Prolipoprotein diacylglyceryltransferaseCell wall/membrane/envelope biogenesis [M] 1.00
COG04247-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamilySecondary metabolites biosynthesis, transport and catabolism [Q] 1.00
COG0261Ribosomal protein L21Translation, ribosomal structure and biogenesis [J] 1.00
COG0127Inosine/xanthosine triphosphate pyrophosphatase, all-alpha NTP-PPase familyNucleotide transport and metabolism [F] 1.00
COG0020Undecaprenyl pyrophosphate synthaseLipid transport and metabolism [I] 1.00


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.00 %
UnclassifiedrootN/A6.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002168|JGI24712J26585_10004023All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Lentimicrobiaceae → Lentimicrobium → Lentimicrobium saccharophilum11378Open in IMG/M
3300002168|JGI24712J26585_10006392All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Lentimicrobiaceae → Lentimicrobium → Lentimicrobium saccharophilum8436Open in IMG/M
3300002168|JGI24712J26585_10010569All Organisms → cellular organisms → Bacteria5926Open in IMG/M
3300002168|JGI24712J26585_10011111All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales5719Open in IMG/M
3300002168|JGI24712J26585_10013659All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales4926Open in IMG/M
3300002168|JGI24712J26585_10018448All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales3936Open in IMG/M
3300002168|JGI24712J26585_10027857All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2850Open in IMG/M
3300002170|JGI24711J26586_10003061All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia11405Open in IMG/M
3300002170|JGI24711J26586_10003068All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales11382Open in IMG/M
3300002170|JGI24711J26586_10003095All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales11311Open in IMG/M
3300002170|JGI24711J26586_10005044All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales8068Open in IMG/M
3300002170|JGI24711J26586_10005443All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales7637Open in IMG/M
3300002170|JGI24711J26586_10006391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes6725Open in IMG/M
3300002170|JGI24711J26586_10012955All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales3922Open in IMG/M
3300002173|JGI24709J26583_10005866All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales8758Open in IMG/M
3300002173|JGI24709J26583_10009506All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales6194Open in IMG/M
3300002173|JGI24709J26583_10015226All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales4326Open in IMG/M
3300002173|JGI24709J26583_10015940All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4178Open in IMG/M
3300002173|JGI24709J26583_10022436All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3179Open in IMG/M
3300002173|JGI24709J26583_10025162All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2905Open in IMG/M
3300002173|JGI24709J26583_10034151All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2282Open in IMG/M
3300002173|JGI24709J26583_10034203All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2279Open in IMG/M
3300002173|JGI24709J26583_10081372All Organisms → cellular organisms → Bacteria → FCB group1118Open in IMG/M
3300002173|JGI24709J26583_10103714All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium911Open in IMG/M
3300002174|JGI24710J26742_10004038All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes12238Open in IMG/M
3300002174|JGI24710J26742_10011917All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales5734Open in IMG/M
3300002174|JGI24710J26742_10037631All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2316Open in IMG/M
3300002174|JGI24710J26742_10084222All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1176Open in IMG/M
3300002174|JGI24710J26742_10192818Not Available590Open in IMG/M
3300002174|JGI24710J26742_10217921All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium537Open in IMG/M
3300002898|draft_10021256All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia7433Open in IMG/M
3300002898|draft_10140420All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium1549Open in IMG/M
3300009655|Ga0116190_1015292All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia4126Open in IMG/M
3300009655|Ga0116190_1045029Not Available1922Open in IMG/M
3300009658|Ga0116188_1019777All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3713Open in IMG/M
3300009658|Ga0116188_1027080All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales2967Open in IMG/M
3300009658|Ga0116188_1033010All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales2569Open in IMG/M
3300009658|Ga0116188_1043526All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2100Open in IMG/M
3300009658|Ga0116188_1067051Not Available1539Open in IMG/M
3300009658|Ga0116188_1092217All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium1224Open in IMG/M
3300009664|Ga0116146_1026173All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales3051Open in IMG/M
3300009664|Ga0116146_1030628All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2737Open in IMG/M
3300009664|Ga0116146_1030881All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium2722Open in IMG/M
3300009664|Ga0116146_1076324Not Available1480Open in IMG/M
3300009666|Ga0116182_1015421All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes5379Open in IMG/M
3300009666|Ga0116182_1047588All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales2453Open in IMG/M
3300009666|Ga0116182_1062377All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium2031Open in IMG/M
3300009666|Ga0116182_1072941All Organisms → cellular organisms → Bacteria1821Open in IMG/M
3300009666|Ga0116182_1093193All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1535Open in IMG/M
3300009667|Ga0116147_1002016All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes21379Open in IMG/M
3300009667|Ga0116147_1005172All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes11202Open in IMG/M
3300009667|Ga0116147_1029411All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2963Open in IMG/M
3300009670|Ga0116183_1019222All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4961Open in IMG/M
3300009704|Ga0116145_1184341Not Available816Open in IMG/M
3300009714|Ga0116189_1004601All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes9605Open in IMG/M
3300009714|Ga0116189_1016205All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4293Open in IMG/M
3300009714|Ga0116189_1028096All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2912Open in IMG/M
3300009714|Ga0116189_1043542All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales2124Open in IMG/M
3300009714|Ga0116189_1047471All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium1994Open in IMG/M
3300009714|Ga0116189_1076895All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1403Open in IMG/M
3300009715|Ga0116160_1149882All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium951Open in IMG/M
3300009720|Ga0116159_1027791All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3266Open in IMG/M
3300009720|Ga0116159_1190147All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium846Open in IMG/M
3300009767|Ga0116161_1004329All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes12039Open in IMG/M
3300010344|Ga0116243_10002633All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes33064Open in IMG/M
3300010344|Ga0116243_10051188All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium3511Open in IMG/M
3300010344|Ga0116243_10076543All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium2606Open in IMG/M
3300010347|Ga0116238_10012929All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales9538Open in IMG/M
3300010353|Ga0116236_10720994All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium808Open in IMG/M
3300010365|Ga0116251_10005778All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes17136Open in IMG/M
3300010365|Ga0116251_10006041All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes16556Open in IMG/M
3300010365|Ga0116251_10016867All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes7409Open in IMG/M
3300025613|Ga0208461_1041759All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1584Open in IMG/M
3300025629|Ga0208824_1053534All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales1439Open in IMG/M
3300025629|Ga0208824_1129738All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium701Open in IMG/M
3300025629|Ga0208824_1132093All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes690Open in IMG/M
3300025677|Ga0209719_1128096All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium727Open in IMG/M
3300025682|Ga0209718_1074404All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium1182Open in IMG/M
3300025686|Ga0209506_1070368All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium1161Open in IMG/M
3300025713|Ga0208195_1011154All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes5395Open in IMG/M
3300025713|Ga0208195_1047424All Organisms → cellular organisms → Bacteria1822Open in IMG/M
3300025713|Ga0208195_1059703All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1539Open in IMG/M
3300025737|Ga0208694_1031103All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2752Open in IMG/M
3300025737|Ga0208694_1041090All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia2206Open in IMG/M
3300025737|Ga0208694_1079512All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium1316Open in IMG/M
3300026311|Ga0209723_1287252All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium554Open in IMG/M
(restricted) 3300028564|Ga0255344_1001460All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes31704Open in IMG/M
(restricted) 3300028564|Ga0255344_1047715All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium2302Open in IMG/M
(restricted) 3300028564|Ga0255344_1073912All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales1651Open in IMG/M
(restricted) 3300028570|Ga0255341_1006840All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes10483Open in IMG/M
(restricted) 3300028570|Ga0255341_1136374All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1070Open in IMG/M
(restricted) 3300028576|Ga0255340_1014842All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales5520Open in IMG/M
(restricted) 3300028576|Ga0255340_1059448All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium2040Open in IMG/M
(restricted) 3300028576|Ga0255340_1063486All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1944Open in IMG/M
(restricted) 3300028576|Ga0255340_1088515All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium1522Open in IMG/M
(restricted) 3300028576|Ga0255340_1244314All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium711Open in IMG/M
(restricted) 3300028593|Ga0255347_1013300All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes7387Open in IMG/M
(restricted) 3300028593|Ga0255347_1163695All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium1090Open in IMG/M
(restricted) 3300028677|Ga0255346_1022297All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales4195Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge54.00%
Biogas FermentantionEngineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion30.00%
WastewaterEngineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater13.00%
Biogas FermenterEngineered → Unclassified → Unclassified → Unclassified → Unclassified → Biogas Fermenter2.00%
Anaerobic Biogas ReactorEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor1.00%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002168Biogas fermentation microbial communities from Germany - Plant 3 DNA2EngineeredOpen in IMG/M
3300002170Biogas fermentation microbial communities from Germany - Plant 3 DNA1EngineeredOpen in IMG/M
3300002173Biogas fermentation microbial communities from Germany - Plant 2 DNA1EngineeredOpen in IMG/M
3300002174Biogas fermentation microbial communities from Germany - Plant 2 DNA2EngineeredOpen in IMG/M
3300002898Metagenome Biopara biogasfermenter May 2013 pooledEngineeredOpen in IMG/M
3300009655Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaGEngineeredOpen in IMG/M
3300009658Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR2_MetaGEngineeredOpen in IMG/M
3300009664Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG2_MetaGEngineeredOpen in IMG/M
3300009666Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaGEngineeredOpen in IMG/M
3300009667Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG3_MetaGEngineeredOpen in IMG/M
3300009670Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaGEngineeredOpen in IMG/M
3300009704Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG1_MetaGEngineeredOpen in IMG/M
3300009714Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR3_MetaGEngineeredOpen in IMG/M
3300009715Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS2_MetaGEngineeredOpen in IMG/M
3300009720Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS1_MetaGEngineeredOpen in IMG/M
3300009767Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS3_MetaGEngineeredOpen in IMG/M
3300010344AD_JPAScaEngineeredOpen in IMG/M
3300010347AD_JPHGcaEngineeredOpen in IMG/M
3300010353AD_USCAcaEngineeredOpen in IMG/M
3300010365AD_USDIcaEngineeredOpen in IMG/M
3300025613Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025629Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR3_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025677Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS2_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025682Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS1_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025686Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG2_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025713Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025737Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG (SPAdes)EngineeredOpen in IMG/M
3300026311Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA (SPAdes)EngineeredOpen in IMG/M
3300028564 (restricted)Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant18EngineeredOpen in IMG/M
3300028570 (restricted)Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant12EngineeredOpen in IMG/M
3300028576 (restricted)Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant10EngineeredOpen in IMG/M
3300028593 (restricted)Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant24EngineeredOpen in IMG/M
3300028677 (restricted)Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant22EngineeredOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI24712J26585_10004023103300002168Biogas FermentantionVSSFCRLASPRLVPADLEPGADPERSEGARPNIKTNY*
JGI24712J26585_10006392103300002168Biogas FermentantionPMGTRRQKSELVSSFCRLASPRLVPXDLEPGADPERSEGARPNKK*
JGI24712J26585_1001056913300002168Biogas FermentantionLVSSFCRLATPRLVPADLEPGADPERSEGARPNNFYII*
JGI24712J26585_1001111153300002168Biogas FermentantionQKSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNKNKK*
JGI24712J26585_1001365973300002168Biogas FermentantionQKSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNKKYNYI*
JGI24712J26585_1001844853300002168Biogas FermentantionQKSELVSSFCRLASPRLVPADLEPGADPERSEGTRPNKK*
JGI24712J26585_1002785713300002168Biogas FermentantionQKSELVSSFCRLASPRLVPADLXPGADPERSEGARPNXK*
JGI24711J26586_1000306113300002170Biogas FermentantionSELVSSFCRLASPRLVPADLEPGADPERSEGARPNIKTNY*
JGI24711J26586_1000306813300002170Biogas FermentantionQKSELVSSFCRLASPRLVPADLQPGADPERSEGTRPKNHHP*
JGI24711J26586_10003095113300002170Biogas FermentantionSELVSSFCRLASPRLVPEDLEPGADPERSEGARPNKK*
JGI24711J26586_1000504413300002170Biogas FermentantionQKSELVSSFCRLASPRLVPADLQPGADPERSEGARPNKK*
JGI24711J26586_10005443113300002170Biogas FermentantionQKSELVSSFCRFASPRLVPADLEPGADPERSEGARPKEN*
JGI24711J26586_1000639113300002170Biogas FermentantionQKSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNNK*
JGI24711J26586_1001295513300002170Biogas FermentantionLVSSFCRLASPRLVPADLEPGADPERSEGTRPNKK*
JGI24709J26583_10005866133300002173Biogas FermentantionKSELVSSFCRFASPRLVPADLEPGADPERSEGAHPNKKN*
JGI24709J26583_1000950613300002173Biogas FermentantionKPMGTRRQKSELVSSFCRLASPRLVPEDLEPGADPERSEGARPNKK*
JGI24709J26583_1001522613300002173Biogas FermentantionKSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNKKLNYFYCTKNRN*
JGI24709J26583_1001594013300002173Biogas FermentantionGTRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPN*
JGI24709J26583_1002243613300002173Biogas FermentantionRQKSELVSSFCRFATPRLATEDLEPKTDPERSEGTRPNKKIKLFLS*
JGI24709J26583_1002516213300002173Biogas FermentantionSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNKNKK*
JGI24709J26583_1003415113300002173Biogas FermentantionLVSSFCRLATPRLATADLEPGADPERSEGTRPNNKYN*
JGI24709J26583_1003420313300002173Biogas FermentantionKSELVSSFCRFASPRLVPADLEPGADPERSEGARPKEN*
JGI24709J26583_1008137213300002173Biogas FermentantionKSELVSSFCRFASPRLPPADLEPKTDPERSEGTRPKYKYR*
JGI24709J26583_1010371423300002173Biogas FermentantionELVSSFCRLASPRLVPADLQPKTDPERSEGARPKKNYSY*
JGI24710J26742_10004038163300002174Biogas FermentantionVSSFCRLASPRLATADLEPKTDPERSEGARPNKN*
JGI24710J26742_1001191713300002174Biogas FermentantionGTRRQKSELVSSFCRFATPRLVPADLEPGADPERSEGTRPNKN*
JGI24710J26742_1003763113300002174Biogas FermentantionQKSELVSSFCRFASPRLVPADLEPGADPERSEGTRPNNNYN*
JGI24710J26742_1008422213300002174Biogas FermentantionKSELVSSFCRLASPRLVPADLEPGADPEHSEGARPN*
JGI24710J26742_1019281823300002174Biogas FermentantionLGTRRQKSELVSSFCRLASPRLVPADLEPETDPERSEGARPNKN*
JGI24710J26742_1021792113300002174Biogas FermentantionQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPN*
draft_1002125693300002898Biogas FermenterRRQKSELVSSFCRLASPRLATADLEPDADPERSEGTRPKKKYLYD*
draft_1014042033300002898Biogas FermenterRRQKSELVSSFCRLATPRLVPADLEPETDPERSEGARPNKK*
Ga0116190_101529253300009655Anaerobic Digestor SludgeRQKSELVSSFCRLASPRLATADLEPGADPERSEGARPKKYYLYN*
Ga0116190_104502923300009655Anaerobic Digestor SludgeLGTRRQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKK*
Ga0116188_101977763300009658Anaerobic Digestor SludgeRQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKKYNYI*
Ga0116188_102708033300009658Anaerobic Digestor SludgeRQKSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNNK*
Ga0116188_103301033300009658Anaerobic Digestor SludgeRRQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKNNKK*
Ga0116188_104352633300009658Anaerobic Digestor SludgeRQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPKEK*
Ga0116188_106705123300009658Anaerobic Digestor SludgeRQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKK*
Ga0116188_109221723300009658Anaerobic Digestor SludgeRQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPKEN*
Ga0116146_102617333300009664Anaerobic Digestor SludgeTRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNNK*
Ga0116146_103062813300009664Anaerobic Digestor SludgeGTQRQKSELVSSFCRFASPRLVPADLEPGADPERSEGARPDKN*
Ga0116146_103088113300009664Anaerobic Digestor SludgeTRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNKK*
Ga0116146_107632413300009664Anaerobic Digestor SludgeQRQKSELVSSFCRFASPRLVPADLEPGADPERSEGARPNKKYN*
Ga0116182_101542153300009666Anaerobic Digestor SludgeELVSSFCRLATPRLVPADLEPGADPERSEGARPDKK*
Ga0116182_104758813300009666Anaerobic Digestor SludgeSELVSSFCRFATPRLAAADLQAKTDPERSEGARPNKK*
Ga0116182_106237743300009666Anaerobic Digestor SludgeGTRRQKSELVSSFCRLASPRLVPADLEPGADPERSEGTRPKKK*
Ga0116182_107294133300009666Anaerobic Digestor SludgeGTRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPNNK*
Ga0116182_109319313300009666Anaerobic Digestor SludgeQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKN*
Ga0116147_100201613300009667Anaerobic Digestor SludgeGTRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNNK*
Ga0116147_100517213300009667Anaerobic Digestor SludgeRQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPNKN*
Ga0116147_100746123300009667Anaerobic Digestor SludgeKPLGTRRQKSELVSSFRRFATPRLVPADLEPGADPERSEGARPN*
Ga0116147_102941153300009667Anaerobic Digestor SludgeRQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPNKK*
Ga0116183_101922213300009670Anaerobic Digestor SludgeSELVSSFCRLATPRLVPADLEPGADPERSEGARPDKK*
Ga0116145_118434133300009704Anaerobic Digestor SludgeLGTQRQKSELVSSFCRFASPRLVPADLEPGADPERSEGARPNKKYN*
Ga0116189_100460113300009714Anaerobic Digestor SludgeLGTRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPKEK*
Ga0116189_101620533300009714Anaerobic Digestor SludgeRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNNFYII*
Ga0116189_102809613300009714Anaerobic Digestor SludgeSELVSSFCRLASPRLVPADLEPGADPERSEGARPKKNKNR*
Ga0116189_104354233300009714Anaerobic Digestor SludgeRQKSELVSSFCRLASPRLATADLEPGADPERSEGTRPNNKYN*
Ga0116189_104747113300009714Anaerobic Digestor SludgeKSELVSSFCRLATPRLVPADLEPGADPERSEGARPKEN*
Ga0116189_107689513300009714Anaerobic Digestor SludgeKSELVSSFCRLATPRLVPADLEPGADPERSEGARPNKN*
Ga0116160_114988233300009715Anaerobic Digestor SludgeQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKKYNYI*
Ga0116159_102779113300009720Anaerobic Digestor SludgeQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPNKN*
Ga0116159_119014713300009720Anaerobic Digestor SludgeSELVSSFCRLATPRLVPADLEPGADPERSEGTRPDKY*
Ga0116161_1004329153300009767Anaerobic Digestor SludgeGTRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNKK*
Ga0116243_10002633323300010344Anaerobic Digestor SludgeGTRRQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKKYNYI*
Ga0116243_1005118833300010344Anaerobic Digestor SludgeRRQKSELVSSFCRFATPRLVPADLEPGADPERSEGTRPKENYDYYF*
Ga0116243_1007654323300010344Anaerobic Digestor SludgeRQKSELVSSFRRFATPRLVPADLEPGADPERSEGARPN*
Ga0116238_1001292973300010347Anaerobic Digestor SludgeKSELVSSFCRLATPRLVPADLEPGADPERSEGARPKEK*
Ga0116236_1072099413300010353Anaerobic Digestor SludgeSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNKKYNYI*
Ga0116251_1000577813300010365Anaerobic Digestor SludgeKSELVSSFCRLATPRLVPADLEPGADPERSEGARPDKK*
Ga0116251_10006041143300010365Anaerobic Digestor SludgeRQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKN*
Ga0116251_1001686763300010365Anaerobic Digestor SludgePMGTRRQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKN*
Ga0208461_104175913300025613Anaerobic Digestor SludgeRQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPNKN
Ga0208824_105353443300025629Anaerobic Digestor SludgeSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKKYNYI
Ga0208824_112973813300025629Anaerobic Digestor SludgeKSELVSSFCRLATPRLVPADLEPGADPERSEGARPKEN
Ga0208824_113209323300025629Anaerobic Digestor SludgeKSELVSSFCRLATPRLVPADLEPGADPERSEGARPNKN
Ga0209719_112809613300025677Anaerobic Digestor SludgeQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKKYNYI
Ga0209718_107440423300025682Anaerobic Digestor SludgeELVSSFCRLATPRLVPADLEPGADPERSEGARPKEK
Ga0209506_107036833300025686Anaerobic Digestor SludgeTRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNKK
Ga0208195_101115413300025713Anaerobic Digestor SludgeRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPDKK
Ga0208195_104742413300025713Anaerobic Digestor SludgeGTRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPNNK
Ga0208195_105970313300025713Anaerobic Digestor SludgeRQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKN
Ga0208694_103110333300025737Anaerobic Digestor SludgeKSELVSSFCRLASPRLVPADLEPGADPERSEGTRPNLKTNYY
Ga0208694_104109033300025737Anaerobic Digestor SludgeELVSSFCRLATPRLVPADLEPGADPERSEGARPDKK
Ga0208694_107951213300025737Anaerobic Digestor SludgeLVSSFCRLATPRLVPADLEPGADPERSEGARPNNK
Ga0209723_128725213300026311Anaerobic Biogas ReactorMGTQRQKSELVSSFCRFASPRLVPADLEPGADPERSEGAH
(restricted) Ga0255344_100146013300028564WastewaterTRRQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKK
(restricted) Ga0255344_104771513300028564WastewaterPLGTRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPKEK
(restricted) Ga0255344_107391233300028564WastewaterQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNIKTNY
(restricted) Ga0255341_1006840153300028570WastewaterKSELVSSFCRLATPRLVPADLEPGADPERSEGARPNNK
(restricted) Ga0255341_113637433300028570WastewaterSRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPNKK
(restricted) Ga0255340_101484213300028576WastewaterRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNKKYNYI
(restricted) Ga0255340_105944813300028576WastewaterSELVSSFCRHATPRLVPADLEPGADPERSEGARPNKN
(restricted) Ga0255340_106348633300028576WastewaterRRQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKK
(restricted) Ga0255340_108851513300028576WastewaterKPQGSRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPNKK
(restricted) Ga0255340_124431413300028576WastewaterQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPDKK
(restricted) Ga0255347_101330053300028593WastewaterGTRRQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKN
(restricted) Ga0255347_116369513300028593WastewaterELVSSFCRLATPRLVPADLEPGADPERSEGARPNNK
(restricted) Ga0255346_102229773300028677WastewaterFCRLATPRLVPADLEPGADPERSEGTRPNKKYNYI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.