| Basic Information | |
|---|---|
| Family ID | F104217 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MEIPAKKTNRSAPKPPDNVGVKTIQLQEGDPSKTALIGTGLTDK |
| Number of Associated Samples | 69 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 69 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.25 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (77.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (89.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (74.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 11.11% Coil/Unstructured: 88.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF00078 | RVT_1 | 11.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 77.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 7.00% |
| Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 7.00% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 5.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300009973 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaG | Host-Associated | Open in IMG/M |
| 3300009975 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaG | Host-Associated | Open in IMG/M |
| 3300009981 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG | Host-Associated | Open in IMG/M |
| 3300009992 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG | Host-Associated | Open in IMG/M |
| 3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015278 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015306 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017408 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017447 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017691 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028054 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028143 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028262 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028474 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300032465 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032466 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032502 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032514 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032591 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032593 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032697 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032698 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032757 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032760 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032790 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032824 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032875 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032915 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032959 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070668_1021306451 | 3300005347 | Switchgrass Rhizosphere | PAKKTNRSVPKPPNNVGVKTIQLQEGDPSKTALIGTGLTDK* |
| Ga0105136_1138122 | 3300009973 | Switchgrass Associated | QQYSASGSEIPTKKTNRSAPMPPDNIGVKTIQLQEDDPSKTALIGTGLSDK* |
| Ga0105129_1080601 | 3300009975 | Switchgrass Associated | AGHQYSVSGSEIPTKKINRSAPMPPDNIGVKAIQLQEDDPSKTALIGTGLSDK* |
| Ga0105133_1241711 | 3300009981 | Switchgrass Associated | TKKTNRSTPKPPDNVRVKTIQLQEGDPSKMALIGSGLTDK* |
| Ga0105120_10100212 | 3300009992 | Switchgrass Associated | MEIPAKKTDRSAPKPPDNAGVKTIQLQEGDPSKTALIGTGLTDK* |
| Ga0105120_10480451 | 3300009992 | Switchgrass Associated | ASGSEIPTKKTNRYAPKPPDNIGVKAIQLQEDDPSKTALIGTGLTDK* |
| Ga0105139_10137382 | 3300009995 | Switchgrass Associated | VLVAAQQFSASGMEISTKKANRSAPKPPDNVGVKVIQLQDDDSSKIALIGTGLTDK* |
| Ga0105139_10469672 | 3300009995 | Switchgrass Associated | MEIPTKKANQFAPRAPDNVGIKAIQLQEGDSSKTTLIGIGLTDK* |
| Ga0134125_114776872 | 3300010371 | Terrestrial Soil | KPLCPKTIDNVGVKAIQLQEVNSSKTTLIGTELTDK* |
| Ga0134125_131414212 | 3300010371 | Terrestrial Soil | MLPPIDYQTPQEKYSASGTEIPTKKINRSTPKPPDNVGVKAIQLQEGDSSKTTLIGTRLTDKKKT |
| Ga0134126_111533151 | 3300010396 | Terrestrial Soil | KKISRSAPKPPDNIGVKAIQLQEDDPSKTALIGTRLSDK* |
| Ga0134126_125598382 | 3300010396 | Terrestrial Soil | SRSAPKPPDNIGVKAIQLQEDDPSKTALIGTGLSDK* |
| Ga0134127_119768022 | 3300010399 | Terrestrial Soil | MKKANQSAPKPLDNVGNKTIQLHESDPSKTALIGIELGDK* |
| Ga0134123_104906511 | 3300010403 | Terrestrial Soil | SEIPTKKTNHSAPKRPDNVGVKSIQLQEDDPSKTALIGTWLSDK* |
| Ga0134123_127039192 | 3300010403 | Terrestrial Soil | QQYSASGSEIPTKKTNRSAPKPPDNIGVKAIQLQEDNPSKTALIGTGLTDK* |
| Ga0157379_108134481 | 3300014968 | Switchgrass Rhizosphere | MEIPTKKTNRSAPKPPDNVEVKATQLQEGDPSKTDLIGTGLTNK* |
| Ga0157379_108379972 | 3300014968 | Switchgrass Rhizosphere | MPTKKISRSAPKPLDNIGVKAIQLEEDDPTKTALIGIGLTDK* |
| Ga0157379_119083812 | 3300014968 | Switchgrass Rhizosphere | LTTAQQYSASGIEISMKKTNRSTPKPPDSVGVKTIKLQEGDPSKTALIGTGLTDK* |
| Ga0182183_10703911 | 3300015270 | Switchgrass Phyllosphere | NCSTPKPPDNIGVKAIQLQESDPSKTALIGTGLTDK* |
| Ga0182183_10737571 | 3300015270 | Switchgrass Phyllosphere | RMEIPTKKTNRSAPKPPDNVEVKATQLQEGDPSKTDLIGTGLTDK* |
| Ga0182099_10191262 | 3300015278 | Switchgrass Phyllosphere | MKQANRAAPKPLDDVGNKTIQLHESDPSKTALIGTELGDK* |
| Ga0182100_10247291 | 3300015280 | Switchgrass Phyllosphere | TAQQYSASGSEIPTKKINRSAPKPPDNIGVKAIQLQECDPSKTALIGTWLTDK* |
| Ga0182100_10452472 | 3300015280 | Switchgrass Phyllosphere | LAAGHQYSVSGSEIPTKKINRSAPMPPDNIGVKAIQLQEDDPSKTALIGTGLSDK* |
| Ga0182101_10290792 | 3300015284 | Switchgrass Phyllosphere | QQYSASGTEIPTKKINRSAPKPPDNVGVKAIQLQEGDPSKTALIGIGLTDK* |
| Ga0182105_10584342 | 3300015290 | Switchgrass Phyllosphere | GEVLAIAQQYSASGTEIPTKKINRSARKPPDNVGVKAIQLQEGDPSKTDLIGTGLTDK* |
| Ga0182103_10923501 | 3300015293 | Switchgrass Phyllosphere | MKKANQSAPKPLDNVGIKTIQLHENDASKTAVIGTELGDK* |
| Ga0182184_10993512 | 3300015301 | Switchgrass Phyllosphere | MAVAQQYSALGSEIPTKKINRSASKPPKNIGVKAIQLQEDDPSKTALIGTELSDK* |
| Ga0182180_10720761 | 3300015306 | Switchgrass Phyllosphere | MKKTNRSSPKPPDSIGVKTIQLQEDDPSKTALIGTGLIDK* |
| Ga0182098_10716951 | 3300015309 | Switchgrass Phyllosphere | MEIPTKKTNRSAPKPPDNVEVKATQLQEGDPSKTDLIGTGLTDK |
| Ga0182098_10948422 | 3300015309 | Switchgrass Phyllosphere | MASGTEIPTKKINRSAPKPPDNVGVKAIQLQEGDPSKTALIGIGLTDK* |
| Ga0182098_11192171 | 3300015309 | Switchgrass Phyllosphere | TKRINRSAPKPPDNIEVKAIQLQEDDPSKTALIRTGLSDK* |
| Ga0182162_10957562 | 3300015310 | Switchgrass Phyllosphere | MPTKKISRSAPKPLDNIGVKAIQLEEDDPSKTALIGIGLTDK* |
| Ga0182182_10468881 | 3300015311 | Switchgrass Phyllosphere | MEISMKKANRSAPKPPDNVGVKVIQLQDDDSSKIALIGTGLTDK* |
| Ga0182182_10995002 | 3300015311 | Switchgrass Phyllosphere | MENPMKKANQSAPKPLDNVGNKTIQLHESEPSKTALIGTELGDK* |
| Ga0182130_10546881 | 3300015319 | Switchgrass Phyllosphere | MKKANHSTPKPPDNVGVKAIYLQDGDSSKTTLIGTGLTDK* |
| Ga0182130_10605771 | 3300015319 | Switchgrass Phyllosphere | ASGTEIPTKKINRSAPKPPDNVGVKAIQLQEDDPSKTALIGTGLTDK* |
| Ga0182130_11287921 | 3300015319 | Switchgrass Phyllosphere | SKQLSQSGMEIPMKKANQSAPKPLDNVCIKTIQLHENDRSKTALIGIELGDK* |
| Ga0182165_11092542 | 3300015320 | Switchgrass Phyllosphere | MEIPTKKTNRSAPKPPDNVEVKATQLQEGDPSKSDLIGTGLSDK* |
| Ga0182148_10540051 | 3300015325 | Switchgrass Phyllosphere | TKKINCSTPKPPDNIGVKAIQLQEDDPSKTALIGTGLTDK* |
| Ga0182148_10776312 | 3300015325 | Switchgrass Phyllosphere | NQFAPRAPDNVGIKAIQLQEGDSSKTTLIGIGLTDK* |
| Ga0182148_10783401 | 3300015325 | Switchgrass Phyllosphere | KKINRSAPKPPDNVGVKAIQLQEGDPSKTALIGIGLTDK* |
| Ga0182114_11386592 | 3300015327 | Switchgrass Phyllosphere | KKINRSAPKPPDNIGVKAIQLQEDDPSKTALIGTGLSDK* |
| Ga0182153_11515961 | 3300015328 | Switchgrass Phyllosphere | QQYSASGIEISMKKTNRSTPKPPDSVGVKTIQLQEGDPSKTALIGTGLTDK* |
| Ga0182135_10971181 | 3300015329 | Switchgrass Phyllosphere | SAPKPPDNIGVKAIQLQEDDPSKTALIGTWLSDK* |
| Ga0182117_10827052 | 3300015332 | Switchgrass Phyllosphere | MKKINRSAPKPPDNIGVKAIQLQEGDPSKTALIGTGLTDK* |
| Ga0182117_11016782 | 3300015332 | Switchgrass Phyllosphere | MEIPAKKTNRSAPKPPDNVGVKTIQLQEGDPSKTALIGTGLTDK* |
| Ga0182147_10878291 | 3300015333 | Switchgrass Phyllosphere | MEIPMKKENQSAPKPLDNVGNKTIQLHESDPSKTALIGTELGDK* |
| Ga0182116_11023441 | 3300015335 | Switchgrass Phyllosphere | MENPMKKANQSAPKPLDNVGIKTIQLHENDPSKTALIGTELGDK* |
| Ga0182116_11154301 | 3300015335 | Switchgrass Phyllosphere | YSASGSEIPTKKINRSAPKPPDNIGVKAIQLQEYDPSKTALIGTGLTDK* |
| Ga0182116_11661572 | 3300015335 | Switchgrass Phyllosphere | MEIPIKKANQSAPKPLDNVGNKTIQLHESDPSKTVLIGTELGDK* |
| Ga0182116_11666601 | 3300015335 | Switchgrass Phyllosphere | NKPLCPKTIDNVGVKAIQLQEVDSSKTALIGTELIDK* |
| Ga0182116_11726031 | 3300015335 | Switchgrass Phyllosphere | MEIPTKKAKQSAPKPPDNVCVKVIQLMEGGMSKTALIGTGLTNK* |
| Ga0182150_10798831 | 3300015336 | Switchgrass Phyllosphere | RSAPKPPDNVGVKTIQLQEDDPSKTALIGTGLSDK* |
| Ga0182150_10826581 | 3300015336 | Switchgrass Phyllosphere | MEIPTKKTNRSAPKPPDNVEVKATQLQEGDPSKTDLIGTGLTDK* |
| Ga0182151_10751261 | 3300015337 | Switchgrass Phyllosphere | YSASGSEIPTKKINRSAPKPPDNIGVKAIQLQEDDPSKTALIGTWLSDK* |
| Ga0182151_11460692 | 3300015337 | Switchgrass Phyllosphere | TAQQYSASGSEIPTKKINRSAPNPPDNIGVKAIQLQEDDPSKIALIGTGLTDK* |
| Ga0182137_10489061 | 3300015338 | Switchgrass Phyllosphere | KKANQSAPKPLDNVCIKTIQLHENDPSKTALIGTELGDK* |
| Ga0182137_11652731 | 3300015338 | Switchgrass Phyllosphere | EKTNRSTPKPLDNVGVKTIQLQDGNSSKTALIRTVISDK* |
| Ga0182149_10038142 | 3300015339 | Switchgrass Phyllosphere | MEIPTKKTNRNTPKPPDNVEVKATQLQEGDPSKTDLIGTGLTDK* |
| Ga0182149_10197921 | 3300015339 | Switchgrass Phyllosphere | TKKVNCSALKPPDNIGVKAIQLQEDDPSKTALIGTWLTNK* |
| Ga0182149_10475502 | 3300015339 | Switchgrass Phyllosphere | MEIPTKKTNRTTLKSPDNVEVKAIQPQEGDPSKTAL |
| Ga0182115_12082132 | 3300015348 | Switchgrass Phyllosphere | MEIPTKKTNRNTPKPPDNVEVKAIQLQEGDLSKTALIGTGLTYK* |
| Ga0182185_10680672 | 3300015349 | Switchgrass Phyllosphere | AAKQLSQSRMEIPTKKANQSAPKPPDNVGVKTIQLLEGDSSKTALIGTGLTDK* |
| Ga0182185_11689232 | 3300015349 | Switchgrass Phyllosphere | MEIPAKKTNRSAPKPPDNVGVKTIQLQEGDPSKTALVGTGLTDK* |
| Ga0182163_12718351 | 3300015350 | Switchgrass Phyllosphere | NRFAPKPPDNIGVKAIQLQDDDPSKTALIGTGLTDK* |
| Ga0182169_10434341 | 3300015352 | Switchgrass Phyllosphere | KTNRSAPKLPDDVDVKAIQLQEDNPSKTALIMTGLTDK* |
| Ga0182169_11353051 | 3300015352 | Switchgrass Phyllosphere | MEIPAKKTNRSAPKPPDNVGVKTIQLQEGDPSKTTLIGTGLTDK* |
| Ga0182169_12432952 | 3300015352 | Switchgrass Phyllosphere | SQSGMEIPTKKAKQSAPKPPDNVCVKVIQLMEGGMSKTALIGTGLTNK* |
| Ga0182179_12257161 | 3300015353 | Switchgrass Phyllosphere | QYSASGMEIPAKKTNRSVPKPPNNVGVKTIQLQEGDPSKTALIGTGLTDK* |
| Ga0182167_13216732 | 3300015354 | Switchgrass Phyllosphere | MEIPTKKTNHSTPKPPDSVGVKTIQMQEGDPSKTALIGIGLTDK |
| Ga0182197_11395121 | 3300017408 | Switchgrass Phyllosphere | EVLATAQLYSASGTEIPTKKINRSAPKPLDNVGVKAIQLQEDGPSKTALIGIGLTDK |
| Ga0182201_10850611 | 3300017422 | Switchgrass Phyllosphere | KKTNRSAPKPPDNIGVKTIQLQQDDPLKTALIGTGLSNK |
| Ga0182196_10593471 | 3300017432 | Switchgrass Phyllosphere | AQQYSASGMEIPAKKTNRSAPKPPDNVGVKTIQLQEGDPSKTALIGTGLTDK |
| Ga0182214_11237671 | 3300017440 | Switchgrass Phyllosphere | SGMEIPMKKTNRSAPKAPDNVGVKTIQLQDHPSKTALIGTGLTDK |
| Ga0182198_10787231 | 3300017445 | Switchgrass Phyllosphere | MEIPTKKANHSAPKPPDNVGVKAIQLSDGDSSKTALIDTGLTDK |
| Ga0182198_10944401 | 3300017445 | Switchgrass Phyllosphere | MEIPTKKTNRSAPKPPDNVEVKATQLQEGDPSKSDLIGTGL |
| Ga0182215_11344322 | 3300017447 | Switchgrass Phyllosphere | KINRSAPKPPDNIGVKAIQLQDDDPSKTALIGTGLTDK |
| Ga0182215_11477801 | 3300017447 | Switchgrass Phyllosphere | IPTKKINHSAPKPLDNVGVKAIQLQEDDLSKTALIGTGLTDK |
| Ga0182212_10970492 | 3300017691 | Switchgrass Phyllosphere | QQYSASGTEIRTKKTNRSAQKPPDNIGVKAIQLQEGDSSKTALIGIGLADK |
| Ga0182216_11723521 | 3300017693 | Switchgrass Phyllosphere | NRSAPKPPDNIGVKAFQLQEDDPSKTALIGTGLTDK |
| Ga0268322_10290582 | 3300028049 | Phyllosphere | MEIPTKKTNRSTPKPPDNVEVKATQLQEGDPSKTDLIGTGLTDK |
| Ga0268306_10257262 | 3300028054 | Phyllosphere | NRSAPKPPDNVEVKATQLQEGDPSKTDLIGTGLTDK |
| Ga0268348_10218021 | 3300028143 | Phyllosphere | GSEIPTKKINRSAPKPPDNIGVKAFQLQEDDPSKTTLIGTGLTDK |
| Ga0268310_10381171 | 3300028262 | Phyllosphere | IPTKKTNRSAPKPPDNIGVKAIQLQEDDSSKTALIGTGLTNK |
| Ga0268331_10152502 | 3300028474 | Phyllosphere | QYSASGSDIPTKKTNRSAPKPPDNIGVKAIQLQEDDPSKTALIGTGLSDK |
| Ga0214493_11565092 | 3300032465 | Switchgrass Phyllosphere | SGTEIPTKKINRSSPKPPDNVGVKAIQLQEGDPSKTALIGTGLTDK |
| Ga0214503_11003231 | 3300032466 | Switchgrass Phyllosphere | EIPTKKTNRSASKSPDDIGVKAIQLQEYDPSKTALIGTGLSDK |
| Ga0214490_11428441 | 3300032502 | Switchgrass Phyllosphere | AQQYSASGTEFPTKKINRSALKPPDNVGVKAIQLQEDDLSKTALIGTGLTDK |
| Ga0214502_10414811 | 3300032514 | Switchgrass Phyllosphere | NDSAPKPPDNVGVKAFQLVEGDSSKTALISTGLTDK |
| Ga0214484_10527331 | 3300032591 | Switchgrass Phyllosphere | PQQYSTLGSEIPTKKISRSAPKPPDNIGVKAIQLQKDDPSKTALIGTGLSDK |
| Ga0321338_10075299 | 3300032593 | Switchgrass Phyllosphere | TKKTNRSASKSPDDIGVKAIQLQEYDPSKTALIGTRLSDK |
| Ga0214499_10591841 | 3300032697 | Switchgrass Phyllosphere | SGSEIPTKKINCFAPKPPDNVGVKAIQLQEDDLSKTALIGTGLTDK |
| Ga0214485_11118631 | 3300032698 | Switchgrass Phyllosphere | ATAQQYSASGSEIPTKKINRSTPKPPDKIGVKAIQLQEDDPSKTALIGTGLTDK |
| Ga0314753_10861221 | 3300032757 | Switchgrass Phyllosphere | KYSASGIEIPTKKTNRSAPKPPDNIGVKAIQLQEGDLSKTALIGTGLTDN |
| Ga0314754_10493492 | 3300032760 | Switchgrass Phyllosphere | MKKANQSAPKPLDNVGNKTIQLHESDPSKTALIGTELGDK |
| Ga0314731_10078991 | 3300032790 | Switchgrass Phyllosphere | KKTNRSASKSPDDIGVKAIQLQEYDPSKTALIGTRLSDK |
| Ga0314735_10069701 | 3300032824 | Switchgrass Phyllosphere | NRSASKSPDDIGVKAIQLQEYDPSKTALIGTGLSDK |
| Ga0314737_10082855 | 3300032875 | Switchgrass Phyllosphere | SGSEIPTKKTNRSASKSPDDIGVKAIQLQEYDPSKTALIGTRLSDK |
| Ga0314749_10172071 | 3300032915 | Switchgrass Phyllosphere | SEIPTKKTNRSASKSPDDIGVKAIQLQEYDPSKTALIGTRLSDK |
| Ga0314738_10772251 | 3300032959 | Switchgrass Phyllosphere | KTNRSASKSPDDIGVKAIQLQEYDPSKTALIGTGLSDK |
| ⦗Top⦘ |