| Basic Information | |
|---|---|
| Family ID | F104216 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MLEINKAHEITSKSQAFGPQISHKIIHGKRMLGSKNQA |
| Number of Associated Samples | 65 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 23.00 % |
| % of genes near scaffold ends (potentially truncated) | 27.00 % |
| % of genes from short scaffolds (< 2000 bps) | 100.00 % |
| Associated GOLD sequencing projects | 63 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (98.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (73.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (93.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (92.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.03% β-sheet: 0.00% Coil/Unstructured: 46.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 98.00 % |
| All Organisms | root | All Organisms | 2.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 73.00% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 19.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.00% |
| Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300009980 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015273 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017408 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017435 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017692 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300020023 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300020223 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_31MAY2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028050 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028051 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028053 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028054 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028055 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028149 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028151 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028152 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028467 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028468 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028469 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028477 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028526 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300032915 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070668_1018558071 | 3300005347 | Switchgrass Rhizosphere | MHKLEINKAHEITSKSQALKPQFLHKTIHGKRMLGSKNQA* |
| Ga0068863_1013551182 | 3300005841 | Switchgrass Rhizosphere | MHMLEINKAHEIISKSLTFGSQISHKTIQGKWMLGSKNQAYQGYG* |
| Ga0105135_1114741 | 3300009980 | Switchgrass Associated | MLEINKAHEIISKNQAFGPQIFHKTIHGKRMLGAKN* |
| Ga0134124_126134271 | 3300010397 | Terrestrial Soil | MLEINKAHEITSKNQEFGPQISHNTIHGKRMLGSKNQV* |
| Ga0182183_10338171 | 3300015270 | Switchgrass Phyllosphere | ARNKQTHEIMSKIQVFEPQILCKTIHGKRMLGSKNQA* |
| Ga0182183_10426291 | 3300015270 | Switchgrass Phyllosphere | MLEINKTHEIKSKSQAFGPQISHNTINGERILGSKNQT |
| Ga0182102_10235282 | 3300015273 | Switchgrass Phyllosphere | MLEINKTHEITSKIQEFEPQILYKTTHGKRRLGFKNKV* |
| Ga0182102_10367411 | 3300015273 | Switchgrass Phyllosphere | MLEINKSHEITSKSQVFEPQISHNTIHGKRILGSKNQV* |
| Ga0182100_10120322 | 3300015280 | Switchgrass Phyllosphere | MLEINKAHKITSKIQAFGPQILYKTTYSKRMLGSKNQV* |
| Ga0182101_10307501 | 3300015284 | Switchgrass Phyllosphere | MLEINKTHEITSKIQAFEPQILYKTIHVKRRLGFKNQV* |
| Ga0182101_10711561 | 3300015284 | Switchgrass Phyllosphere | MHKIEINKAHEITSKIQGLKPQFLHKTIHGKEILSSKNQA* |
| Ga0182105_10890362 | 3300015290 | Switchgrass Phyllosphere | KQVYMLKLNKTHEITSKSQVFEPQISHNTIHGKRILGSKNQV* |
| Ga0182103_10063662 | 3300015293 | Switchgrass Phyllosphere | MLELSKAHEITSKIQAFDPQILYKTNHGKRRLGSKN* |
| Ga0182103_10262721 | 3300015293 | Switchgrass Phyllosphere | MLEINKSDEITSKSKVFEPQISHNTIHGKRMIGFKKQV* |
| Ga0182104_10982732 | 3300015297 | Switchgrass Phyllosphere | ALARNKQTYEIISKIQVFGPQISYNIIHGKRMLGSKN* |
| Ga0182104_11102451 | 3300015297 | Switchgrass Phyllosphere | MHKLEINKAHEITSKSQALKPQFLHKTIHGKKILSSKNQA* |
| Ga0182098_10364631 | 3300015309 | Switchgrass Phyllosphere | MLEITKAHEITTKDQVFGPQISHKTIHGIRILCSKNQA* |
| Ga0182098_10528841 | 3300015309 | Switchgrass Phyllosphere | MPEINKTHEIMRKNQAFEPQILYKTTHGNRRLGSKNQV* |
| Ga0182168_10227071 | 3300015312 | Switchgrass Phyllosphere | MLEINKAHEITSKNQAFEPQISHKTIHGKRILVPKIK |
| Ga0182168_10838291 | 3300015312 | Switchgrass Phyllosphere | MLELNKAHEIISKSQAFGPQILYKTIHGKRMLGSKKQA* |
| Ga0182120_10246511 | 3300015315 | Switchgrass Phyllosphere | MDMLEINKAHEIISKSQAFGQQIFQKTIHGKRMLGSKNQI* |
| Ga0182120_10966161 | 3300015315 | Switchgrass Phyllosphere | MLEINKSHEITSKSQAFEPQISHKTIHDKRILGFKNQV* |
| Ga0182136_10162021 | 3300015317 | Switchgrass Phyllosphere | MLKLNKTHEITSKSQVFEPQISHNTIHGKRILGSKNQV* |
| Ga0182130_10460991 | 3300015319 | Switchgrass Phyllosphere | MLEINKAHEIISKSLTFGSQISHKTIQGKWMLGSKNQ |
| Ga0182148_10335411 | 3300015325 | Switchgrass Phyllosphere | MLEINKAHEITSKSQALGPQISHNTIHGKGMLGFKNQA* |
| Ga0182148_10751422 | 3300015325 | Switchgrass Phyllosphere | MLEINKTHEITSKGQAFGLQILHKTIHGEKMLGSKNQA* |
| Ga0182148_11225461 | 3300015325 | Switchgrass Phyllosphere | VHKLEINKVHEIISKSQAFGPQISHKTIHGKSMLGFKN |
| Ga0182153_10568751 | 3300015328 | Switchgrass Phyllosphere | MLEINKTHEITSKSQAFEPQILYKTTHGKKRQGSKN |
| Ga0182135_10796882 | 3300015329 | Switchgrass Phyllosphere | MDMLEINKAHEIISKSQAFGQQFFQKTIHGKRMLGSKNQI* |
| Ga0182152_10449152 | 3300015330 | Switchgrass Phyllosphere | MLEITKAHEITSKSQAFGPQISHNTIHGKRMLGSKNQV* |
| Ga0182152_10680381 | 3300015330 | Switchgrass Phyllosphere | MLKLNKTHEITSKSQVFEPQITHNTIHGKRILGSKNQV* |
| Ga0182152_10812031 | 3300015330 | Switchgrass Phyllosphere | MLEINKTCEITSKSQVFGPQISHKTIHVKRMLDFKN |
| Ga0182131_10264971 | 3300015331 | Switchgrass Phyllosphere | MDMLEINKAHEIISKSQAFGPEIFQKTIHGNRMLGSKNHI* |
| Ga0182131_11416932 | 3300015331 | Switchgrass Phyllosphere | MPEINKTREIMRKNQAFEPQILYKTTHGNRRLGSKNQV* |
| Ga0182117_10635211 | 3300015332 | Switchgrass Phyllosphere | MDMLEINNAHEIISKSQSFGQQIFQKTIHGKRMLGSKNQI* |
| Ga0182117_11119811 | 3300015332 | Switchgrass Phyllosphere | MLEINKAHEIISKSQAFGPEIFQKTIHGKGMLGSKNQI* |
| Ga0182147_10783502 | 3300015333 | Switchgrass Phyllosphere | MLEINKKHEITSKSQAFGPQISHKTIHGKIMLGSKNKA* |
| Ga0182147_10802231 | 3300015333 | Switchgrass Phyllosphere | MLELRKAHEITSKIQEFDPQILYKTNHGKRRLGSKN* |
| Ga0182132_10799161 | 3300015334 | Switchgrass Phyllosphere | MIEINKAQEIISKSQAFGPQIFHKTIHGKRMLGAKN* |
| Ga0182132_11373831 | 3300015334 | Switchgrass Phyllosphere | MLEINKAHEIISKSQEFGPQISHKPIHGKRMLGFKN* |
| Ga0182132_11548882 | 3300015334 | Switchgrass Phyllosphere | LEINKAHEITSKSQALGPKISHNTIHGKGMLGFKNQA* |
| Ga0182116_11080032 | 3300015335 | Switchgrass Phyllosphere | LEINKAHKLTSKSQAFGPQISHKTIQGKRIVGFKNQT* |
| Ga0182150_10740572 | 3300015336 | Switchgrass Phyllosphere | ILEINKTHEITSKSQAFEPQILYKTTHGKRRLGFKNQA* |
| Ga0182150_10905672 | 3300015336 | Switchgrass Phyllosphere | MLDLNKTRELTSKNQAFEPQILFKTIHGKMMLGSKNQA* |
| Ga0182150_11176251 | 3300015336 | Switchgrass Phyllosphere | NLNKVHEITSKSLALGLQFLHKIICGKRMLGFKKKA* |
| Ga0182151_10705231 | 3300015337 | Switchgrass Phyllosphere | MLEINKAHEITSKNQAFEPQISHKTIHGKRILGSKNQA* |
| Ga0182151_11487112 | 3300015337 | Switchgrass Phyllosphere | MHKLEINKAHEITSKSQALKPQFLHKTIHGKRMLGSKTQAQQGNG* |
| Ga0182133_10447501 | 3300015340 | Switchgrass Phyllosphere | MLEINKTHEIKSKSQAFGPQISHKTIHGKRILTSKNQA* |
| Ga0182115_10537981 | 3300015348 | Switchgrass Phyllosphere | AYARNKQTHGIIDKSQAFGPQISHNTINGERILGSKNQT* |
| Ga0182185_12461302 | 3300015349 | Switchgrass Phyllosphere | VYKLEINKAHEIRRKSKEFGLQILYNTKHGKTVLGSKNQA* |
| Ga0182163_10659261 | 3300015350 | Switchgrass Phyllosphere | MLELSKAHEITSKSQAFDPQILYKTTHGERRLGSKN* |
| Ga0182163_11030612 | 3300015350 | Switchgrass Phyllosphere | MLEITKAHEITSKIQAFGLQISHKTIHGKRMLGFKNKA* |
| Ga0182163_11850202 | 3300015350 | Switchgrass Phyllosphere | MLEINEAHEITRKNQVFGPQISHKIKHGKRVLGSKNQE* |
| Ga0182169_12069171 | 3300015352 | Switchgrass Phyllosphere | MIEINKAHEIISKSQAFGPQNLYKTIHGKRMLGSKKQA* |
| Ga0182169_12601281 | 3300015352 | Switchgrass Phyllosphere | MPEINKTHEIMRKNQAFEPQILYKTTHGNRRLGSKNQ |
| Ga0182179_11376161 | 3300015353 | Switchgrass Phyllosphere | MLMLEINKAHEILSKIQEFGPQISHKPIHGKMMLGFKN* |
| Ga0182167_12077581 | 3300015354 | Switchgrass Phyllosphere | MLEINKAHEIISKRQAFGPQIFHKTIHGKRMLGAKN* |
| Ga0182167_13459171 | 3300015354 | Switchgrass Phyllosphere | MLEINKAHEITSKNQAFEPQISHKTIHGKRILGSKNKV* |
| Ga0182197_10644961 | 3300017408 | Switchgrass Phyllosphere | MLEINKAHEITSKNQVFGPQISHKTIQGKRIVGFKNQT |
| Ga0182197_11111761 | 3300017408 | Switchgrass Phyllosphere | MLEINKVHEIISKNQVLGPQNLHKIIHGKRMLGSKNQV |
| Ga0182195_10299801 | 3300017414 | Switchgrass Phyllosphere | MDMLEINKAHEIISKSQAFGQQFFQKTIHGKRMLGFKKQA |
| Ga0182195_11168991 | 3300017414 | Switchgrass Phyllosphere | MLEITKAHEITSKIQAFGLQISHKTIHGKRMLGFKNKS |
| Ga0182195_11774221 | 3300017414 | Switchgrass Phyllosphere | MLEINKAHEIISKSQAFGPQIFHKTIHGKRMLGAKN |
| Ga0182195_12125591 | 3300017414 | Switchgrass Phyllosphere | NKAHEITNKSQALGPQILHKDIHGKRMLGFKNQAYQGDG |
| Ga0182196_11567501 | 3300017432 | Switchgrass Phyllosphere | MLEINKAHEIISKSQAFRPQLFHKTKHGKRMVGCKNQAQQGYG |
| Ga0182194_10580781 | 3300017435 | Switchgrass Phyllosphere | VYKLEISKVHKIISKSQAFGPQILHKIIHGKRMLGSNKASIARLW |
| Ga0182194_10883302 | 3300017435 | Switchgrass Phyllosphere | MPEINKTHEIMRKNQAFEPQILYKTTHGNRRLGSKNQV |
| Ga0182200_10711161 | 3300017439 | Switchgrass Phyllosphere | YMLEINKAHKITSKRQAFGPQISHKTIHGKRNLGFKNQA |
| Ga0182200_10798531 | 3300017439 | Switchgrass Phyllosphere | MLEINKAHELISKSQAFGPQISHKTIHGKRILTSKNQA |
| Ga0182200_11461361 | 3300017439 | Switchgrass Phyllosphere | QMHILEINKPHEITSKIQIFEPQILYKTTHGKRRLGSKNQA |
| Ga0182214_11490441 | 3300017440 | Switchgrass Phyllosphere | VYRLEINKAHKIISKSQVFGSQILHKAIYGKRMLGSKN |
| Ga0182214_11526772 | 3300017440 | Switchgrass Phyllosphere | MLELRKAHEITSKIQAFDPQILYKTTHGKRVPGCKNHV |
| Ga0182210_11045912 | 3300017692 | Switchgrass Phyllosphere | MLEIKKTHEIISKSQAFGPQISHNTIHGKRMLGSKNQI |
| Ga0182216_12244542 | 3300017693 | Switchgrass Phyllosphere | MLEINKAHEITSKSQAFGPQISHKIIHGKRMLGSKNQA |
| Ga0182178_10054711 | 3300020023 | Switchgrass Phyllosphere | MLEINKAHEIISKSQAFGQQFFQKTIHGKRMLGSKNQI |
| Ga0182118_1097451 | 3300020223 | Switchgrass Phyllosphere | MLEINKAHEITSKSQEFGPQISHKNIHGKRMLGSKNQA |
| Ga0207668_108619961 | 3300025972 | Switchgrass Rhizosphere | MLEINKAHEIISKSQAFGPQNLYKTIPGKRMLGSKKQA |
| Ga0207658_109761672 | 3300025986 | Switchgrass Rhizosphere | MLEINKAHEIISKSQAFGQQFFQKTIHGKRMLGSKNQV |
| Ga0207641_109709131 | 3300026088 | Switchgrass Rhizosphere | MLEITKAHEIIRKIQEFRLQISHKTIHGKRMLSSKNQV |
| Ga0207675_1027164281 | 3300026118 | Switchgrass Rhizosphere | MLEINKAHEITSKNQEFGPQISHNTIHGKRMLGSKNQV |
| Ga0268322_10065592 | 3300028049 | Phyllosphere | LKLNKTHEITSKSQVFEPQISHNTIHGKRILGSKNQV |
| Ga0268322_10303442 | 3300028049 | Phyllosphere | MLEINKSDEITSKSKVFEPQISHNTIHGKRMIGFKKQV |
| Ga0268328_10134501 | 3300028050 | Phyllosphere | MLEINKAHEITSKNQAFEPQISHKTIHGKRILGSKNQA |
| Ga0268328_10248781 | 3300028050 | Phyllosphere | MLEINKVHEIISKNQVLGPQNLHKIIHGKRMLGSKNQA |
| Ga0268344_10088661 | 3300028051 | Phyllosphere | MLEINKTHEITSKSQAFGPQISHKTIHGKIMLGSKNKA |
| Ga0268346_10269181 | 3300028053 | Phyllosphere | VYILEINKTHEITSKSQALGPQISHKTIRGIRILC |
| Ga0268306_10048131 | 3300028054 | Phyllosphere | MLKLNKTHEITSKSQVFEPQISHNTIHGKRILGSKNQV |
| Ga0268338_10311351 | 3300028055 | Phyllosphere | MLEINKSDEITSKSQVFEPQISHNTIHGKRMIGFKKQV |
| Ga0268330_10045711 | 3300028056 | Phyllosphere | MHILELNQVHKITSKNQASGPQILHKTMHGKRMLGSKKQA |
| Ga0268330_10543101 | 3300028056 | Phyllosphere | VHKLELNKVPEITSKSQALGPQIFHKTIHGKRKLGSKRQAEQGYG |
| Ga0268332_10516101 | 3300028058 | Phyllosphere | MLELNKAHEITSKNQAFGPQISHNTINGKRMLGSKNQV |
| Ga0268353_1102461 | 3300028149 | Phyllosphere | MLEINKTHEITSKSQVFEPQISHNTIHGKRILGSKNQV |
| Ga0268308_10093552 | 3300028151 | Phyllosphere | MLEINKAHEIISKSQAFGPQIFHKTIHGKRMLGTKN |
| Ga0268336_10304121 | 3300028152 | Phyllosphere | LELNKTHEITSKNQAFGTQISHNISHGKKMLGSKNQA |
| Ga0268333_10066381 | 3300028467 | Phyllosphere | MLEINKTHEITSKSQVFKPQVLCKTIHGKRMLGSKNQA |
| Ga0268317_10130991 | 3300028468 | Phyllosphere | MLEINKTHEIMRKKIQAFGSQISHKTIHVKRMLGFKKLS |
| Ga0268337_10056191 | 3300028469 | Phyllosphere | MLELRKAHEITSKIQAFDPQILYKTTHGKRRLGSKN |
| Ga0268309_10165892 | 3300028477 | Phyllosphere | MLEINKSDEITRKSQVFEPQISHNTIHGKRMIGFKKKV |
| Ga0268339_10113021 | 3300028526 | Phyllosphere | MLEINKAHEITSKSQALGPQISHNTIHGKGMLGFKNQA |
| Ga0314749_10811492 | 3300032915 | Switchgrass Phyllosphere | MLEITKAHEITSKSQALRLQISHKTIHDKRMLGSKN |
| ⦗Top⦘ |