| Basic Information | |
|---|---|
| Family ID | F104097 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MDAALGLLGLIVYAACVIVFAAACTWLVVKISPSGKKT |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 72.28 % |
| % of genes near scaffold ends (potentially truncated) | 18.81 % |
| % of genes from short scaffolds (< 2000 bps) | 78.22 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.248 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (26.733 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.733 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.475 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 45.45% β-sheet: 0.00% Coil/Unstructured: 54.55% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF01262 | AlaDh_PNT_C | 38.61 |
| PF05222 | AlaDh_PNT_N | 18.81 |
| PF01676 | Metalloenzyme | 11.88 |
| PF02885 | Glycos_trans_3N | 1.98 |
| PF00248 | Aldo_ket_red | 1.98 |
| PF12982 | DUF3866 | 0.99 |
| PF06418 | CTP_synth_N | 0.99 |
| PF07676 | PD40 | 0.99 |
| PF01149 | Fapy_DNA_glyco | 0.99 |
| PF00903 | Glyoxalase | 0.99 |
| PF04542 | Sigma70_r2 | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 0.99 |
| COG0504 | CTP synthase (UTP-ammonia lyase) | Nucleotide transport and metabolism [F] | 0.99 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.99 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.99 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.99 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.25 % |
| Unclassified | root | N/A | 24.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000156|NODE_c0694016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 3597 | Open in IMG/M |
| 3300000886|AL3A1W_1449075 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 796 | Open in IMG/M |
| 3300000887|AL16A1W_10451129 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300001205|C688J13580_1015064 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300001361|A30PFW6_1040309 | Not Available | 648 | Open in IMG/M |
| 3300002068|JGIcombinedJ21913_10067608 | Not Available | 1471 | Open in IMG/M |
| 3300004463|Ga0063356_100542126 | All Organisms → cellular organisms → Bacteria | 1553 | Open in IMG/M |
| 3300005294|Ga0065705_10383480 | Not Available | 905 | Open in IMG/M |
| 3300005332|Ga0066388_103400535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 813 | Open in IMG/M |
| 3300005336|Ga0070680_100482353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 1060 | Open in IMG/M |
| 3300005529|Ga0070741_10036583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6528 | Open in IMG/M |
| 3300005562|Ga0058697_10748694 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300005564|Ga0070664_101622459 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300005713|Ga0066905_100045897 | All Organisms → cellular organisms → Bacteria | 2634 | Open in IMG/M |
| 3300005719|Ga0068861_100380588 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300005764|Ga0066903_100038763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5576 | Open in IMG/M |
| 3300005764|Ga0066903_100496752 | All Organisms → cellular organisms → Bacteria | 2065 | Open in IMG/M |
| 3300005764|Ga0066903_101657243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 1216 | Open in IMG/M |
| 3300006175|Ga0070712_100024660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3988 | Open in IMG/M |
| 3300006579|Ga0074054_11771622 | Not Available | 505 | Open in IMG/M |
| 3300006755|Ga0079222_11044014 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300006845|Ga0075421_100172457 | All Organisms → cellular organisms → Bacteria | 2694 | Open in IMG/M |
| 3300006845|Ga0075421_100928291 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300006854|Ga0075425_101722422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 705 | Open in IMG/M |
| 3300006954|Ga0079219_11987122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales | 552 | Open in IMG/M |
| 3300009148|Ga0105243_12638148 | Not Available | 542 | Open in IMG/M |
| 3300009551|Ga0105238_12201662 | Not Available | 586 | Open in IMG/M |
| 3300009789|Ga0126307_10003365 | All Organisms → cellular organisms → Bacteria | 10923 | Open in IMG/M |
| 3300010036|Ga0126305_10191347 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
| 3300010038|Ga0126315_10023983 | All Organisms → cellular organisms → Bacteria | 3106 | Open in IMG/M |
| 3300010039|Ga0126309_10041290 | All Organisms → cellular organisms → Bacteria | 2161 | Open in IMG/M |
| 3300010039|Ga0126309_10091036 | All Organisms → cellular organisms → Bacteria | 1552 | Open in IMG/M |
| 3300010039|Ga0126309_10266618 | Not Available | 977 | Open in IMG/M |
| 3300010040|Ga0126308_10004734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6313 | Open in IMG/M |
| 3300010040|Ga0126308_11206480 | Not Available | 536 | Open in IMG/M |
| 3300010041|Ga0126312_10098137 | All Organisms → cellular organisms → Bacteria | 2001 | Open in IMG/M |
| 3300010046|Ga0126384_10621822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 948 | Open in IMG/M |
| 3300010359|Ga0126376_11859447 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300010360|Ga0126372_11129552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 804 | Open in IMG/M |
| 3300010999|Ga0138505_100004889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1366 | Open in IMG/M |
| 3300010999|Ga0138505_100015213 | Not Available | 934 | Open in IMG/M |
| 3300011994|Ga0120157_1037263 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300011998|Ga0120114_1066000 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300012198|Ga0137364_10869605 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300012204|Ga0137374_10000249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 50849 | Open in IMG/M |
| 3300012212|Ga0150985_103322087 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300012212|Ga0150985_104440879 | Not Available | 588 | Open in IMG/M |
| 3300012910|Ga0157308_10162376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 723 | Open in IMG/M |
| 3300012951|Ga0164300_10273192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 870 | Open in IMG/M |
| 3300012958|Ga0164299_10449560 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300012977|Ga0134087_10173820 | Not Available | 951 | Open in IMG/M |
| 3300012977|Ga0134087_10564847 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300013102|Ga0157371_11373907 | Not Available | 548 | Open in IMG/M |
| 3300013766|Ga0120181_1010511 | All Organisms → cellular organisms → Bacteria | 2650 | Open in IMG/M |
| 3300015371|Ga0132258_13571330 | Not Available | 1064 | Open in IMG/M |
| 3300018027|Ga0184605_10031430 | All Organisms → cellular organisms → Bacteria | 2191 | Open in IMG/M |
| 3300018027|Ga0184605_10067082 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
| 3300018027|Ga0184605_10469800 | Not Available | 552 | Open in IMG/M |
| 3300018028|Ga0184608_10069068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales | 1429 | Open in IMG/M |
| 3300018031|Ga0184634_10566152 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300018051|Ga0184620_10079458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 980 | Open in IMG/M |
| 3300018078|Ga0184612_10359462 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300018081|Ga0184625_10050184 | All Organisms → cellular organisms → Bacteria | 2085 | Open in IMG/M |
| 3300018465|Ga0190269_10226181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 1034 | Open in IMG/M |
| 3300019361|Ga0173482_10045810 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
| 3300019361|Ga0173482_10786197 | Not Available | 503 | Open in IMG/M |
| 3300019866|Ga0193756_1032547 | Not Available | 736 | Open in IMG/M |
| 3300019867|Ga0193704_1016534 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
| 3300020002|Ga0193730_1064355 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300020015|Ga0193734_1052013 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300021080|Ga0210382_10006533 | All Organisms → cellular organisms → Bacteria | 3825 | Open in IMG/M |
| 3300021080|Ga0210382_10396234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 611 | Open in IMG/M |
| 3300021413|Ga0193750_1013663 | All Organisms → cellular organisms → Bacteria | 2014 | Open in IMG/M |
| 3300024055|Ga0247794_10070929 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300025899|Ga0207642_10030679 | Not Available | 2242 | Open in IMG/M |
| 3300025927|Ga0207687_10275327 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300026078|Ga0207702_10428476 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
| 3300027907|Ga0207428_10005252 | All Organisms → cellular organisms → Bacteria | 12103 | Open in IMG/M |
| 3300028704|Ga0307321_1044120 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 836 | Open in IMG/M |
| 3300028704|Ga0307321_1065402 | Not Available | 705 | Open in IMG/M |
| 3300028705|Ga0307276_10084936 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300028712|Ga0307285_10013391 | All Organisms → cellular organisms → Bacteria | 1802 | Open in IMG/M |
| 3300028714|Ga0307309_10146216 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300028715|Ga0307313_10182543 | Not Available | 650 | Open in IMG/M |
| 3300028719|Ga0307301_10043386 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
| 3300028782|Ga0307306_10218871 | Not Available | 550 | Open in IMG/M |
| 3300028784|Ga0307282_10073825 | Not Available | 1554 | Open in IMG/M |
| 3300028784|Ga0307282_10094442 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
| 3300028787|Ga0307323_10004168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4684 | Open in IMG/M |
| 3300028799|Ga0307284_10218345 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 752 | Open in IMG/M |
| 3300028880|Ga0307300_10045637 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
| 3300028881|Ga0307277_10133036 | Not Available | 1072 | Open in IMG/M |
| 3300028885|Ga0307304_10003995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4317 | Open in IMG/M |
| 3300028889|Ga0247827_10222578 | Not Available | 1057 | Open in IMG/M |
| 3300030511|Ga0268241_10045084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 933 | Open in IMG/M |
| 3300031184|Ga0307499_10084897 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300031740|Ga0307468_101479704 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300031911|Ga0307412_11347559 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300031938|Ga0308175_102813198 | Not Available | 544 | Open in IMG/M |
| 3300031996|Ga0308176_10241653 | All Organisms → cellular organisms → Bacteria | 1725 | Open in IMG/M |
| 3300032122|Ga0310895_10300665 | Not Available | 759 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 26.73% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 8.91% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 7.92% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 5.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.97% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.98% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.98% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.98% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 1.98% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.98% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.99% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.99% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.99% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.99% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.99% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.99% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.99% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.99% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000886 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-65cm-3A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300000887 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-65cm-16A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001205 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300001361 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-PF)- 6 month illumina | Environmental | Open in IMG/M |
| 3300002068 | Barrow Graham LP Ref core NGADG0004-212 (Barrow Graham LP Ref core NGADG0004-212,NGADG0011-311, ASSEMBLY_DATE=20131010) | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
| 3300011994 | Permafrost microbial communities from Nunavut, Canada - A7_65cm_12M | Environmental | Open in IMG/M |
| 3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013766 | Permafrost microbial communities from Nunavut, Canada - A26_65cm_6M | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
| 3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021413 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
| 3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| NODE_06940162 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MDTVLGIVGLIVFGACIILLAAATTWLVVKISPSRKS* |
| AL3A1W_14490752 | 3300000886 | Permafrost | VDAVLGLLGLIVYAACVIVFAAVCTWLVVKISPSGKKT* |
| AL16A1W_104511292 | 3300000887 | Permafrost | MNAALGLLGLIVYAACVIAIAAVCTWLVVKISPSGKKT* |
| C688J13580_10150642 | 3300001205 | Soil | VAAVLGLLGLIVFGVCVIVLAAGMTWLVVKISPTKS* |
| A30PFW6_10403091 | 3300001361 | Permafrost | MNAALGLLGLIVYAACVIVLAAVCTWLVVKISPSGKKT* |
| JGIcombinedJ21913_100676081 | 3300002068 | Arctic Peat Soil | MWLFYESMDTALGLLGLTLYIAFVIALAAVITWLV |
| Ga0063356_1005421262 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MGAVLGLLGLVVYAACVIAFAAACTWAVVKISPAGGRKAKA* |
| Ga0065705_103834801 | 3300005294 | Switchgrass Rhizosphere | MDAVLGLLGLIVYAACVISFAAACTWAVVKISPSGGKKT* |
| Ga0066388_1034005352 | 3300005332 | Tropical Forest Soil | MGAVLGLLGLAVYAACVIVFAAACTWVVVKISPSGGRKAKAQP* |
| Ga0070680_1004823532 | 3300005336 | Corn Rhizosphere | MDAVLGLLGLIIYGACVIAFAAACTWAVVKISPSGGKKT* |
| Ga0070741_100365834 | 3300005529 | Surface Soil | VADVLGLIGIVVFVACVIALAAGVTWLVVKIFPAKT* |
| Ga0058697_107486942 | 3300005562 | Agave | MDAVLGLLGLVVFAACVIALAAGTTWVVVKIFPTK* |
| Ga0070664_1016224592 | 3300005564 | Corn Rhizosphere | VTTVLGLLGLIVFIVCVILLAAATTWLVVKVSPSKR* |
| Ga0066905_1000458972 | 3300005713 | Tropical Forest Soil | MDVVLGLLGLVVFGVCVMALAAGTTWLVVKVFPTK* |
| Ga0068861_1003805882 | 3300005719 | Switchgrass Rhizosphere | MDAVLGLLGLVVFGACVIALAAGTTWLVVKIFPTK* |
| Ga0066903_1000387634 | 3300005764 | Tropical Forest Soil | VTTVLGLIGLIIFIVCVILLAAATTWIVVKVSPSKR* |
| Ga0066903_1004967522 | 3300005764 | Tropical Forest Soil | MDAVFGLLGLTVFIVCVIALAAGTTWLVVKVFPTK* |
| Ga0066903_1016572432 | 3300005764 | Tropical Forest Soil | VGTVLGLLGLLVYIVCVILLAAATTWLVVKVSPSKR* |
| Ga0070712_1000246604 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VTTALGLLGLLVYIICVILLAAATTWLVVKVSPSKR* |
| Ga0074054_117716221 | 3300006579 | Soil | VVLGLLGLLVFIVCVIALAAATTWLVVRISPAKS* |
| Ga0079222_110440142 | 3300006755 | Agricultural Soil | MGAVLGLLGLVVFAACVIVFAAACTWAVVKISPSGGRKAKA* |
| Ga0075421_1001724575 | 3300006845 | Populus Rhizosphere | MDAVLGLLGLLVFGACVIALAAGTTWLVVKIFPTK* |
| Ga0075421_1009282912 | 3300006845 | Populus Rhizosphere | MGAVLGLLGLVVFAACVIVFAAACTWAVVKISPAGGRKAKA* |
| Ga0075425_1017224222 | 3300006854 | Populus Rhizosphere | MGAVLGLLGLIVFAACVIVFAAACTWAVVKISPAGGRKAKA* |
| Ga0079219_119871222 | 3300006954 | Agricultural Soil | MDVVLGMLGLLVFIMCVILLAAAMTWLVVRISPSKS* |
| Ga0105243_126381482 | 3300009148 | Miscanthus Rhizosphere | DAVLGLLGLIIYGACVIAFAAACTWAVVKISPSGGKKT* |
| Ga0105238_122016621 | 3300009551 | Corn Rhizosphere | MDVVLGLLGLLVFIVCAIAPAGATTRLVVRISPAK* |
| Ga0126307_1000336510 | 3300009789 | Serpentine Soil | MDLALGLLGLIFYAACVIVFAAACTWLVVRISPSGKKT* |
| Ga0126305_101913472 | 3300010036 | Serpentine Soil | MDVALGLLGLILYAACVIVLAAACTWLVVRISPSGKKT* |
| Ga0126315_100239834 | 3300010038 | Serpentine Soil | MDAVLGLLGLVVFAACVIALAAGTTWLVVKIFPTK* |
| Ga0126309_100412902 | 3300010039 | Serpentine Soil | VHVALGLFGLIVFAACVIVLAAATTWLVVKISPAKS* |
| Ga0126309_100910362 | 3300010039 | Serpentine Soil | VAAVLGLVGLIVFGACVIALAAGMTWLVVKISPSKSP* |
| Ga0126309_102666182 | 3300010039 | Serpentine Soil | VDAVLGLLGLIVFGACVIVLAAGMTWLVVKISPSKTP* |
| Ga0126308_100047346 | 3300010040 | Serpentine Soil | MDAVLGLLGLVVFAACVIALAAGTTWLVVRIFPTK* |
| Ga0126308_112064802 | 3300010040 | Serpentine Soil | VATALGLGGIVVFIACVIALAAGASWLVVKISPNPE |
| Ga0126312_100981372 | 3300010041 | Serpentine Soil | VDAVLGLLGLVVFSACVILLAAGTTWLVVKIFPTK* |
| Ga0126384_106218221 | 3300010046 | Tropical Forest Soil | VDVALGLLGLLVFIVCVILLAAATTWLVVKLSPSKR* |
| Ga0126376_118594472 | 3300010359 | Tropical Forest Soil | VEDVLGLLGLLVFIVCVILLAAATTWLVVKLSPSKR* |
| Ga0126372_111295522 | 3300010360 | Tropical Forest Soil | VTTVLGLLGLLVFIVCVILLAAATTWVVVKVSPSKR* |
| Ga0138505_1000048892 | 3300010999 | Soil | MDAVLGLLGLIVYAACVIAFAAACTWAVVKISPSGGKKT* |
| Ga0138505_1000152131 | 3300010999 | Soil | MDAVLGMLGLIVFGFCVIALAALTTWLVVKISPAR* |
| Ga0120157_10372632 | 3300011994 | Permafrost | MNAALGLLGLIVYAACVIVIAAVCTWLVVKISPSGKKT* |
| Ga0120114_10660002 | 3300011998 | Permafrost | VDAVLGLLGLIVYAACVIVIAAVCTWLVVKISPSGKKT* |
| Ga0137364_108696052 | 3300012198 | Vadose Zone Soil | MDVALGLLGLTFYAACVIVFAAACTWLVVKISPSGKKT* |
| Ga0137374_1000024921 | 3300012204 | Vadose Zone Soil | MGAVLGLLGLIIFAACVIVLAAACTWLVVKISPSGKKT* |
| Ga0150985_1033220872 | 3300012212 | Avena Fatua Rhizosphere | VGAVLGLLGLIVYAACVIALAAACTWLVVKISPSGKKA* |
| Ga0150985_1044408791 | 3300012212 | Avena Fatua Rhizosphere | TALGLLGLLVFIVSVITLASGITWLVVKISPKRS* |
| Ga0157308_101623762 | 3300012910 | Soil | MDAVLGLLGLVVFGACVIALAAGTTWLVVKIYPTK* |
| Ga0164300_102731922 | 3300012951 | Soil | MDVALGLLGLIFYAACVIVLAAACTWLVVRISPSGKKT* |
| Ga0164299_104495602 | 3300012958 | Soil | MDVALGLLGLIFYAACVIVFAAACTWLVVRISPSGKKT* |
| Ga0134087_101738202 | 3300012977 | Grasslands Soil | MATALGLLGLLGFIVGVIALASGITWLVVKVSPQK |
| Ga0134087_105648472 | 3300012977 | Grasslands Soil | MMRSTRNVVLGLLGLLVFIVCVIALAAATSWIVVKISPAK* |
| Ga0157371_113739071 | 3300013102 | Corn Rhizosphere | RGYSRAVMDAVLGLLGLIIYGACVIAFAAACTWAVVKISPSGGKKT* |
| Ga0120181_10105113 | 3300013766 | Permafrost | MNAALGLLGLIVYAACVIVFAAVCTWLVVKISPSGKKT* |
| Ga0132258_135713301 | 3300015371 | Arabidopsis Rhizosphere | MGAVLGLLGLVVFAACVIVFAAACTWSVVKISPSGGRKAKA* |
| Ga0184605_100314303 | 3300018027 | Groundwater Sediment | MDAVLGMLGLIVFGSCVIALAAVTTWLVVKISPSR |
| Ga0184605_100670822 | 3300018027 | Groundwater Sediment | MYVALGLLGLIFYAACVIVFAAACTWLVVRISPSGKKT |
| Ga0184605_104698001 | 3300018027 | Groundwater Sediment | MDAVLGMLGLVVFGACVIALAAVTTWLVVKISPSR |
| Ga0184608_100690682 | 3300018028 | Groundwater Sediment | MYVALGLLGLIFYAACVIVLAAACTWLVVRISPSGKKT |
| Ga0184634_105661522 | 3300018031 | Groundwater Sediment | MDAVLGLLGLIVYGACVIAFAAACTWAVVKISPAGGKKT |
| Ga0184620_100794582 | 3300018051 | Groundwater Sediment | VATVLGLLGLIVFGVCVILLAAGTTWLVVKISPSRN |
| Ga0184612_103594622 | 3300018078 | Groundwater Sediment | MDAVLGMLGLVVFGFCVIVLAAATTWLVVKISPTR |
| Ga0184625_100501842 | 3300018081 | Groundwater Sediment | MDAVLGLLGLIVYAACVISFAAACTWAVVKISPAGGKKT |
| Ga0190269_102261812 | 3300018465 | Soil | MDAVLGMLGLIVFGFCVIALAALTTWLVVKISPAR |
| Ga0173482_100458102 | 3300019361 | Soil | MDAVLGLLGLVVFGACVIALAAGTTWLVVKIFPTK |
| Ga0173482_107861972 | 3300019361 | Soil | EVMGAVLGLLGLAVYAACVIVFAAACTWAVVKISPAGGRKAKA |
| Ga0193756_10325471 | 3300019866 | Soil | VATALGLLGLIVFIVCVITLASGITLLVVKLSPKRS |
| Ga0193704_10165342 | 3300019867 | Soil | MDAILGLLGLIVYGACVIAFAAACTWAVVKISPAGGKKT |
| Ga0193730_10643552 | 3300020002 | Soil | VDTVLGLLGLIVYGVCVVVLAAACTWLVVKISPSGKKT |
| Ga0193734_10520132 | 3300020015 | Soil | MDAVLGMLGLIVYGACVIAFAAACTWAVVKISPAGGKKT |
| Ga0210382_100065333 | 3300021080 | Groundwater Sediment | VDVALGLLGLIFYAACVIVLAAVCTWLVVKISPSGKKT |
| Ga0210382_103962342 | 3300021080 | Groundwater Sediment | MDVALGLLGLIFYAACVIVFAAACTWLVVRISPSGKKT |
| Ga0193750_10136632 | 3300021413 | Soil | MDAALGLLGLIVYAACVIVFAAACTWLVVKISPSGKKT |
| Ga0247794_100709292 | 3300024055 | Soil | VETVLGLIGLVVFIVCVILLAAATTWLVVKVSPSKR |
| Ga0207642_100306792 | 3300025899 | Miscanthus Rhizosphere | MDAVLGLLGLIIYGACVIAFAAACTWAVVKISPSGGKKT |
| Ga0207687_102753272 | 3300025927 | Miscanthus Rhizosphere | MDAVLGLLGLIVYAACVISFAAACTWAVVKISPSGGKKT |
| Ga0207702_104284761 | 3300026078 | Corn Rhizosphere | GNRPRLLGLIVFIVCVILLAAATTWLVVKVSPSKR |
| Ga0207428_100052529 | 3300027907 | Populus Rhizosphere | MDAVLGLLGLLVFGACVIALAAGTTWLVVKIFPTK |
| Ga0307321_10441202 | 3300028704 | Soil | MDVALGLLGLIFYAACVIVLAAACTWLVVRISPSGKKT |
| Ga0307321_10654022 | 3300028704 | Soil | MDAVLGLLGLIVYAACVIAFAAACTWAVVKISPSGGKKT |
| Ga0307276_100849362 | 3300028705 | Soil | VDTALGLLGLIVFGACVIVLAAAMTWLVVKISPAK |
| Ga0307285_100133912 | 3300028712 | Soil | MDAVLGLLGLIVYGACVIAFAAACTWAVVKISPSGGKKT |
| Ga0307309_101462162 | 3300028714 | Soil | MYVALGLLGLIFYAACVIVFAAVCTWLVVRISPSGKKT |
| Ga0307313_101825431 | 3300028715 | Soil | AILGLLGLIVYGACVIAFAAACTWAVVKISPAGGKKT |
| Ga0307301_100433862 | 3300028719 | Soil | MDAVLGILGLVVFGFCVIVLAAAMTWLVVKISPTR |
| Ga0307306_102188711 | 3300028782 | Soil | ARGYSRAVMDAVLGLLGLIVYGACVIAFAAACTWAVVKISPAGGKKT |
| Ga0307282_100738253 | 3300028784 | Soil | MYVALGLLGLIFYAACVIVFAAACTWLVVRISPSGKK |
| Ga0307282_100944422 | 3300028784 | Soil | RAVMYVALGLLGLIFYAACVIVFAAACTWLVVRISPSGKKT |
| Ga0307323_100041684 | 3300028787 | Soil | VETALGLLGLLVFIVCVITLASGITLLVVKLSPKRS |
| Ga0307284_102183452 | 3300028799 | Soil | MDAVLGLLGLVVFGACVIFLAAATTWLVVKVSPSRSSN |
| Ga0307300_100456371 | 3300028880 | Soil | YSRAVMYVALGLLGLIFYAACVIVFAAACTWLVVRISPSGKKT |
| Ga0307277_101330361 | 3300028881 | Soil | MDAVLGLLGLAVFAACVIVFAAAMTWVVVKVSPSR |
| Ga0307304_100039952 | 3300028885 | Soil | VETALGLLGLLVFIVCVNTLASGITWLVVKLSPKRS |
| Ga0247827_102225781 | 3300028889 | Soil | GYSRAVMDAVLGLLGLIVYAACVISFAAACTWAVVKISPSGGKKT |
| Ga0268241_100450842 | 3300030511 | Soil | MDAVLGLLGLMVFIACVILFAAATTWVVVKISPTK |
| Ga0307499_100848972 | 3300031184 | Soil | MDAVLGMLGLIIYGACVIAFAAACTWAVVKISPAGGKKT |
| Ga0307468_1014797042 | 3300031740 | Hardwood Forest Soil | MGAVLGLLGLAVYAACVIAFAAACTWAVVKISPAGGRKAKV |
| Ga0307412_113475592 | 3300031911 | Rhizosphere | MDAVLGLLGLVVFAACVIALAAGTTWLVVRIFPTK |
| Ga0308175_1028131982 | 3300031938 | Soil | MDAVLGLLGLIVYAACVIAFAAMCTWVVVKISPAGG |
| Ga0308176_102416532 | 3300031996 | Soil | MDAVLGLLGLIVYAACVIAFAAMCTWVVVKISPAGGKKT |
| Ga0310895_103006651 | 3300032122 | Soil | SVVTTVLGLLGLIVFIVCVILLAAATTWLVVKVSPSKR |
| ⦗Top⦘ |