NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F104097

Metagenome / Metatranscriptome Family F104097

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F104097
Family Type Metagenome / Metatranscriptome
Number of Sequences 101
Average Sequence Length 38 residues
Representative Sequence MDAALGLLGLIVYAACVIVFAAACTWLVVKISPSGKKT
Number of Associated Samples 86
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 72.28 %
% of genes near scaffold ends (potentially truncated) 18.81 %
% of genes from short scaffolds (< 2000 bps) 78.22 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (75.248 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(26.733 % of family members)
Environment Ontology (ENVO) Unclassified
(26.733 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.475 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: Yes Secondary Structure distribution: α-helix: 45.45%    β-sheet: 0.00%    Coil/Unstructured: 54.55%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF01262AlaDh_PNT_C 38.61
PF05222AlaDh_PNT_N 18.81
PF01676Metalloenzyme 11.88
PF02885Glycos_trans_3N 1.98
PF00248Aldo_ket_red 1.98
PF12982DUF3866 0.99
PF06418CTP_synth_N 0.99
PF07676PD40 0.99
PF01149Fapy_DNA_glyco 0.99
PF00903Glyoxalase 0.99
PF04542Sigma70_r2 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG0266Formamidopyrimidine-DNA glycosylaseReplication, recombination and repair [L] 0.99
COG0504CTP synthase (UTP-ammonia lyase)Nucleotide transport and metabolism [F] 0.99
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.99
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.99
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.99
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.99

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms75.25 %
UnclassifiedrootN/A24.75 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000156|NODE_c0694016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes3597Open in IMG/M
3300000886|AL3A1W_1449075All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium796Open in IMG/M
3300000887|AL16A1W_10451129All Organisms → cellular organisms → Bacteria948Open in IMG/M
3300001205|C688J13580_1015064All Organisms → cellular organisms → Bacteria895Open in IMG/M
3300001361|A30PFW6_1040309Not Available648Open in IMG/M
3300002068|JGIcombinedJ21913_10067608Not Available1471Open in IMG/M
3300004463|Ga0063356_100542126All Organisms → cellular organisms → Bacteria1553Open in IMG/M
3300005294|Ga0065705_10383480Not Available905Open in IMG/M
3300005332|Ga0066388_103400535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia813Open in IMG/M
3300005336|Ga0070680_100482353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia1060Open in IMG/M
3300005529|Ga0070741_10036583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6528Open in IMG/M
3300005562|Ga0058697_10748694All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300005564|Ga0070664_101622459All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300005713|Ga0066905_100045897All Organisms → cellular organisms → Bacteria2634Open in IMG/M
3300005719|Ga0068861_100380588All Organisms → cellular organisms → Bacteria1247Open in IMG/M
3300005764|Ga0066903_100038763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5576Open in IMG/M
3300005764|Ga0066903_100496752All Organisms → cellular organisms → Bacteria2065Open in IMG/M
3300005764|Ga0066903_101657243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia1216Open in IMG/M
3300006175|Ga0070712_100024660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3988Open in IMG/M
3300006579|Ga0074054_11771622Not Available505Open in IMG/M
3300006755|Ga0079222_11044014All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300006845|Ga0075421_100172457All Organisms → cellular organisms → Bacteria2694Open in IMG/M
3300006845|Ga0075421_100928291All Organisms → cellular organisms → Bacteria991Open in IMG/M
3300006854|Ga0075425_101722422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes705Open in IMG/M
3300006954|Ga0079219_11987122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales552Open in IMG/M
3300009148|Ga0105243_12638148Not Available542Open in IMG/M
3300009551|Ga0105238_12201662Not Available586Open in IMG/M
3300009789|Ga0126307_10003365All Organisms → cellular organisms → Bacteria10923Open in IMG/M
3300010036|Ga0126305_10191347All Organisms → cellular organisms → Bacteria1293Open in IMG/M
3300010038|Ga0126315_10023983All Organisms → cellular organisms → Bacteria3106Open in IMG/M
3300010039|Ga0126309_10041290All Organisms → cellular organisms → Bacteria2161Open in IMG/M
3300010039|Ga0126309_10091036All Organisms → cellular organisms → Bacteria1552Open in IMG/M
3300010039|Ga0126309_10266618Not Available977Open in IMG/M
3300010040|Ga0126308_10004734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6313Open in IMG/M
3300010040|Ga0126308_11206480Not Available536Open in IMG/M
3300010041|Ga0126312_10098137All Organisms → cellular organisms → Bacteria2001Open in IMG/M
3300010046|Ga0126384_10621822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium948Open in IMG/M
3300010359|Ga0126376_11859447All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300010360|Ga0126372_11129552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia804Open in IMG/M
3300010999|Ga0138505_100004889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales1366Open in IMG/M
3300010999|Ga0138505_100015213Not Available934Open in IMG/M
3300011994|Ga0120157_1037263All Organisms → cellular organisms → Bacteria1093Open in IMG/M
3300011998|Ga0120114_1066000All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300012198|Ga0137364_10869605All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300012204|Ga0137374_10000249All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria50849Open in IMG/M
3300012212|Ga0150985_103322087All Organisms → cellular organisms → Bacteria900Open in IMG/M
3300012212|Ga0150985_104440879Not Available588Open in IMG/M
3300012910|Ga0157308_10162376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes723Open in IMG/M
3300012951|Ga0164300_10273192All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria870Open in IMG/M
3300012958|Ga0164299_10449560All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300012977|Ga0134087_10173820Not Available951Open in IMG/M
3300012977|Ga0134087_10564847All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300013102|Ga0157371_11373907Not Available548Open in IMG/M
3300013766|Ga0120181_1010511All Organisms → cellular organisms → Bacteria2650Open in IMG/M
3300015371|Ga0132258_13571330Not Available1064Open in IMG/M
3300018027|Ga0184605_10031430All Organisms → cellular organisms → Bacteria2191Open in IMG/M
3300018027|Ga0184605_10067082All Organisms → cellular organisms → Bacteria1549Open in IMG/M
3300018027|Ga0184605_10469800Not Available552Open in IMG/M
3300018028|Ga0184608_10069068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales1429Open in IMG/M
3300018031|Ga0184634_10566152All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300018051|Ga0184620_10079458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes980Open in IMG/M
3300018078|Ga0184612_10359462All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300018081|Ga0184625_10050184All Organisms → cellular organisms → Bacteria2085Open in IMG/M
3300018465|Ga0190269_10226181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia1034Open in IMG/M
3300019361|Ga0173482_10045810All Organisms → cellular organisms → Bacteria1398Open in IMG/M
3300019361|Ga0173482_10786197Not Available503Open in IMG/M
3300019866|Ga0193756_1032547Not Available736Open in IMG/M
3300019867|Ga0193704_1016534All Organisms → cellular organisms → Bacteria1497Open in IMG/M
3300020002|Ga0193730_1064355All Organisms → cellular organisms → Bacteria1049Open in IMG/M
3300020015|Ga0193734_1052013All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300021080|Ga0210382_10006533All Organisms → cellular organisms → Bacteria3825Open in IMG/M
3300021080|Ga0210382_10396234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia611Open in IMG/M
3300021413|Ga0193750_1013663All Organisms → cellular organisms → Bacteria2014Open in IMG/M
3300024055|Ga0247794_10070929All Organisms → cellular organisms → Bacteria992Open in IMG/M
3300025899|Ga0207642_10030679Not Available2242Open in IMG/M
3300025927|Ga0207687_10275327All Organisms → cellular organisms → Bacteria1347Open in IMG/M
3300026078|Ga0207702_10428476All Organisms → cellular organisms → Bacteria1280Open in IMG/M
3300027907|Ga0207428_10005252All Organisms → cellular organisms → Bacteria12103Open in IMG/M
3300028704|Ga0307321_1044120All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium836Open in IMG/M
3300028704|Ga0307321_1065402Not Available705Open in IMG/M
3300028705|Ga0307276_10084936All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300028712|Ga0307285_10013391All Organisms → cellular organisms → Bacteria1802Open in IMG/M
3300028714|Ga0307309_10146216All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300028715|Ga0307313_10182543Not Available650Open in IMG/M
3300028719|Ga0307301_10043386All Organisms → cellular organisms → Bacteria1374Open in IMG/M
3300028782|Ga0307306_10218871Not Available550Open in IMG/M
3300028784|Ga0307282_10073825Not Available1554Open in IMG/M
3300028784|Ga0307282_10094442All Organisms → cellular organisms → Bacteria1382Open in IMG/M
3300028787|Ga0307323_10004168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4684Open in IMG/M
3300028799|Ga0307284_10218345All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium752Open in IMG/M
3300028880|Ga0307300_10045637All Organisms → cellular organisms → Bacteria1230Open in IMG/M
3300028881|Ga0307277_10133036Not Available1072Open in IMG/M
3300028885|Ga0307304_10003995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4317Open in IMG/M
3300028889|Ga0247827_10222578Not Available1057Open in IMG/M
3300030511|Ga0268241_10045084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales933Open in IMG/M
3300031184|Ga0307499_10084897All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300031740|Ga0307468_101479704All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300031911|Ga0307412_11347559All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300031938|Ga0308175_102813198Not Available544Open in IMG/M
3300031996|Ga0308176_10241653All Organisms → cellular organisms → Bacteria1725Open in IMG/M
3300032122|Ga0310895_10300665Not Available759Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil26.73%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil8.91%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment7.92%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost5.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.96%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.97%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.98%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.98%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.98%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.98%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil1.98%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.98%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.99%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.99%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.99%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.99%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.99%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.99%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.99%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.99%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.99%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.99%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.99%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.99%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.99%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave0.99%
Sugar Cane Bagasse Incubating BioreactorEngineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000156Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobicEngineeredOpen in IMG/M
3300000886Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-65cm-3A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300000887Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-65cm-16A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001205Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300001361Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-PF)- 6 month illuminaEnvironmentalOpen in IMG/M
3300002068Barrow Graham LP Ref core NGADG0004-212 (Barrow Graham LP Ref core NGADG0004-212,NGADG0011-311, ASSEMBLY_DATE=20131010)EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005562Agave microbial communities from Guanajuato, Mexico - As.Ma.eHost-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010999Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015EnvironmentalOpen in IMG/M
3300011994Permafrost microbial communities from Nunavut, Canada - A7_65cm_12MEnvironmentalOpen in IMG/M
3300011998Permafrost microbial communities from Nunavut, Canada - A30_35cm_6MEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013766Permafrost microbial communities from Nunavut, Canada - A26_65cm_6MEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019866Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1EnvironmentalOpen in IMG/M
3300019867Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300020015Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021413Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028704Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379EnvironmentalOpen in IMG/M
3300028705Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300030511Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
NODE_069401623300000156Sugar Cane Bagasse Incubating BioreactorMDTVLGIVGLIVFGACIILLAAATTWLVVKISPSRKS*
AL3A1W_144907523300000886PermafrostVDAVLGLLGLIVYAACVIVFAAVCTWLVVKISPSGKKT*
AL16A1W_1045112923300000887PermafrostMNAALGLLGLIVYAACVIAIAAVCTWLVVKISPSGKKT*
C688J13580_101506423300001205SoilVAAVLGLLGLIVFGVCVIVLAAGMTWLVVKISPTKS*
A30PFW6_104030913300001361PermafrostMNAALGLLGLIVYAACVIVLAAVCTWLVVKISPSGKKT*
JGIcombinedJ21913_1006760813300002068Arctic Peat SoilMWLFYESMDTALGLLGLTLYIAFVIALAAVITWLV
Ga0063356_10054212623300004463Arabidopsis Thaliana RhizosphereMGAVLGLLGLVVYAACVIAFAAACTWAVVKISPAGGRKAKA*
Ga0065705_1038348013300005294Switchgrass RhizosphereMDAVLGLLGLIVYAACVISFAAACTWAVVKISPSGGKKT*
Ga0066388_10340053523300005332Tropical Forest SoilMGAVLGLLGLAVYAACVIVFAAACTWVVVKISPSGGRKAKAQP*
Ga0070680_10048235323300005336Corn RhizosphereMDAVLGLLGLIIYGACVIAFAAACTWAVVKISPSGGKKT*
Ga0070741_1003658343300005529Surface SoilVADVLGLIGIVVFVACVIALAAGVTWLVVKIFPAKT*
Ga0058697_1074869423300005562AgaveMDAVLGLLGLVVFAACVIALAAGTTWVVVKIFPTK*
Ga0070664_10162245923300005564Corn RhizosphereVTTVLGLLGLIVFIVCVILLAAATTWLVVKVSPSKR*
Ga0066905_10004589723300005713Tropical Forest SoilMDVVLGLLGLVVFGVCVMALAAGTTWLVVKVFPTK*
Ga0068861_10038058823300005719Switchgrass RhizosphereMDAVLGLLGLVVFGACVIALAAGTTWLVVKIFPTK*
Ga0066903_10003876343300005764Tropical Forest SoilVTTVLGLIGLIIFIVCVILLAAATTWIVVKVSPSKR*
Ga0066903_10049675223300005764Tropical Forest SoilMDAVFGLLGLTVFIVCVIALAAGTTWLVVKVFPTK*
Ga0066903_10165724323300005764Tropical Forest SoilVGTVLGLLGLLVYIVCVILLAAATTWLVVKVSPSKR*
Ga0070712_10002466043300006175Corn, Switchgrass And Miscanthus RhizosphereVTTALGLLGLLVYIICVILLAAATTWLVVKVSPSKR*
Ga0074054_1177162213300006579SoilVVLGLLGLLVFIVCVIALAAATTWLVVRISPAKS*
Ga0079222_1104401423300006755Agricultural SoilMGAVLGLLGLVVFAACVIVFAAACTWAVVKISPSGGRKAKA*
Ga0075421_10017245753300006845Populus RhizosphereMDAVLGLLGLLVFGACVIALAAGTTWLVVKIFPTK*
Ga0075421_10092829123300006845Populus RhizosphereMGAVLGLLGLVVFAACVIVFAAACTWAVVKISPAGGRKAKA*
Ga0075425_10172242223300006854Populus RhizosphereMGAVLGLLGLIVFAACVIVFAAACTWAVVKISPAGGRKAKA*
Ga0079219_1198712223300006954Agricultural SoilMDVVLGMLGLLVFIMCVILLAAAMTWLVVRISPSKS*
Ga0105243_1263814823300009148Miscanthus RhizosphereDAVLGLLGLIIYGACVIAFAAACTWAVVKISPSGGKKT*
Ga0105238_1220166213300009551Corn RhizosphereMDVVLGLLGLLVFIVCAIAPAGATTRLVVRISPAK*
Ga0126307_10003365103300009789Serpentine SoilMDLALGLLGLIFYAACVIVFAAACTWLVVRISPSGKKT*
Ga0126305_1019134723300010036Serpentine SoilMDVALGLLGLILYAACVIVLAAACTWLVVRISPSGKKT*
Ga0126315_1002398343300010038Serpentine SoilMDAVLGLLGLVVFAACVIALAAGTTWLVVKIFPTK*
Ga0126309_1004129023300010039Serpentine SoilVHVALGLFGLIVFAACVIVLAAATTWLVVKISPAKS*
Ga0126309_1009103623300010039Serpentine SoilVAAVLGLVGLIVFGACVIALAAGMTWLVVKISPSKSP*
Ga0126309_1026661823300010039Serpentine SoilVDAVLGLLGLIVFGACVIVLAAGMTWLVVKISPSKTP*
Ga0126308_1000473463300010040Serpentine SoilMDAVLGLLGLVVFAACVIALAAGTTWLVVRIFPTK*
Ga0126308_1120648023300010040Serpentine SoilVATALGLGGIVVFIACVIALAAGASWLVVKISPNPE
Ga0126312_1009813723300010041Serpentine SoilVDAVLGLLGLVVFSACVILLAAGTTWLVVKIFPTK*
Ga0126384_1062182213300010046Tropical Forest SoilVDVALGLLGLLVFIVCVILLAAATTWLVVKLSPSKR*
Ga0126376_1185944723300010359Tropical Forest SoilVEDVLGLLGLLVFIVCVILLAAATTWLVVKLSPSKR*
Ga0126372_1112955223300010360Tropical Forest SoilVTTVLGLLGLLVFIVCVILLAAATTWVVVKVSPSKR*
Ga0138505_10000488923300010999SoilMDAVLGLLGLIVYAACVIAFAAACTWAVVKISPSGGKKT*
Ga0138505_10001521313300010999SoilMDAVLGMLGLIVFGFCVIALAALTTWLVVKISPAR*
Ga0120157_103726323300011994PermafrostMNAALGLLGLIVYAACVIVIAAVCTWLVVKISPSGKKT*
Ga0120114_106600023300011998PermafrostVDAVLGLLGLIVYAACVIVIAAVCTWLVVKISPSGKKT*
Ga0137364_1086960523300012198Vadose Zone SoilMDVALGLLGLTFYAACVIVFAAACTWLVVKISPSGKKT*
Ga0137374_10000249213300012204Vadose Zone SoilMGAVLGLLGLIIFAACVIVLAAACTWLVVKISPSGKKT*
Ga0150985_10332208723300012212Avena Fatua RhizosphereVGAVLGLLGLIVYAACVIALAAACTWLVVKISPSGKKA*
Ga0150985_10444087913300012212Avena Fatua RhizosphereTALGLLGLLVFIVSVITLASGITWLVVKISPKRS*
Ga0157308_1016237623300012910SoilMDAVLGLLGLVVFGACVIALAAGTTWLVVKIYPTK*
Ga0164300_1027319223300012951SoilMDVALGLLGLIFYAACVIVLAAACTWLVVRISPSGKKT*
Ga0164299_1044956023300012958SoilMDVALGLLGLIFYAACVIVFAAACTWLVVRISPSGKKT*
Ga0134087_1017382023300012977Grasslands SoilMATALGLLGLLGFIVGVIALASGITWLVVKVSPQK
Ga0134087_1056484723300012977Grasslands SoilMMRSTRNVVLGLLGLLVFIVCVIALAAATSWIVVKISPAK*
Ga0157371_1137390713300013102Corn RhizosphereRGYSRAVMDAVLGLLGLIIYGACVIAFAAACTWAVVKISPSGGKKT*
Ga0120181_101051133300013766PermafrostMNAALGLLGLIVYAACVIVFAAVCTWLVVKISPSGKKT*
Ga0132258_1357133013300015371Arabidopsis RhizosphereMGAVLGLLGLVVFAACVIVFAAACTWSVVKISPSGGRKAKA*
Ga0184605_1003143033300018027Groundwater SedimentMDAVLGMLGLIVFGSCVIALAAVTTWLVVKISPSR
Ga0184605_1006708223300018027Groundwater SedimentMYVALGLLGLIFYAACVIVFAAACTWLVVRISPSGKKT
Ga0184605_1046980013300018027Groundwater SedimentMDAVLGMLGLVVFGACVIALAAVTTWLVVKISPSR
Ga0184608_1006906823300018028Groundwater SedimentMYVALGLLGLIFYAACVIVLAAACTWLVVRISPSGKKT
Ga0184634_1056615223300018031Groundwater SedimentMDAVLGLLGLIVYGACVIAFAAACTWAVVKISPAGGKKT
Ga0184620_1007945823300018051Groundwater SedimentVATVLGLLGLIVFGVCVILLAAGTTWLVVKISPSRN
Ga0184612_1035946223300018078Groundwater SedimentMDAVLGMLGLVVFGFCVIVLAAATTWLVVKISPTR
Ga0184625_1005018423300018081Groundwater SedimentMDAVLGLLGLIVYAACVISFAAACTWAVVKISPAGGKKT
Ga0190269_1022618123300018465SoilMDAVLGMLGLIVFGFCVIALAALTTWLVVKISPAR
Ga0173482_1004581023300019361SoilMDAVLGLLGLVVFGACVIALAAGTTWLVVKIFPTK
Ga0173482_1078619723300019361SoilEVMGAVLGLLGLAVYAACVIVFAAACTWAVVKISPAGGRKAKA
Ga0193756_103254713300019866SoilVATALGLLGLIVFIVCVITLASGITLLVVKLSPKRS
Ga0193704_101653423300019867SoilMDAILGLLGLIVYGACVIAFAAACTWAVVKISPAGGKKT
Ga0193730_106435523300020002SoilVDTVLGLLGLIVYGVCVVVLAAACTWLVVKISPSGKKT
Ga0193734_105201323300020015SoilMDAVLGMLGLIVYGACVIAFAAACTWAVVKISPAGGKKT
Ga0210382_1000653333300021080Groundwater SedimentVDVALGLLGLIFYAACVIVLAAVCTWLVVKISPSGKKT
Ga0210382_1039623423300021080Groundwater SedimentMDVALGLLGLIFYAACVIVFAAACTWLVVRISPSGKKT
Ga0193750_101366323300021413SoilMDAALGLLGLIVYAACVIVFAAACTWLVVKISPSGKKT
Ga0247794_1007092923300024055SoilVETVLGLIGLVVFIVCVILLAAATTWLVVKVSPSKR
Ga0207642_1003067923300025899Miscanthus RhizosphereMDAVLGLLGLIIYGACVIAFAAACTWAVVKISPSGGKKT
Ga0207687_1027532723300025927Miscanthus RhizosphereMDAVLGLLGLIVYAACVISFAAACTWAVVKISPSGGKKT
Ga0207702_1042847613300026078Corn RhizosphereGNRPRLLGLIVFIVCVILLAAATTWLVVKVSPSKR
Ga0207428_1000525293300027907Populus RhizosphereMDAVLGLLGLLVFGACVIALAAGTTWLVVKIFPTK
Ga0307321_104412023300028704SoilMDVALGLLGLIFYAACVIVLAAACTWLVVRISPSGKKT
Ga0307321_106540223300028704SoilMDAVLGLLGLIVYAACVIAFAAACTWAVVKISPSGGKKT
Ga0307276_1008493623300028705SoilVDTALGLLGLIVFGACVIVLAAAMTWLVVKISPAK
Ga0307285_1001339123300028712SoilMDAVLGLLGLIVYGACVIAFAAACTWAVVKISPSGGKKT
Ga0307309_1014621623300028714SoilMYVALGLLGLIFYAACVIVFAAVCTWLVVRISPSGKKT
Ga0307313_1018254313300028715SoilAILGLLGLIVYGACVIAFAAACTWAVVKISPAGGKKT
Ga0307301_1004338623300028719SoilMDAVLGILGLVVFGFCVIVLAAAMTWLVVKISPTR
Ga0307306_1021887113300028782SoilARGYSRAVMDAVLGLLGLIVYGACVIAFAAACTWAVVKISPAGGKKT
Ga0307282_1007382533300028784SoilMYVALGLLGLIFYAACVIVFAAACTWLVVRISPSGKK
Ga0307282_1009444223300028784SoilRAVMYVALGLLGLIFYAACVIVFAAACTWLVVRISPSGKKT
Ga0307323_1000416843300028787SoilVETALGLLGLLVFIVCVITLASGITLLVVKLSPKRS
Ga0307284_1021834523300028799SoilMDAVLGLLGLVVFGACVIFLAAATTWLVVKVSPSRSSN
Ga0307300_1004563713300028880SoilYSRAVMYVALGLLGLIFYAACVIVFAAACTWLVVRISPSGKKT
Ga0307277_1013303613300028881SoilMDAVLGLLGLAVFAACVIVFAAAMTWVVVKVSPSR
Ga0307304_1000399523300028885SoilVETALGLLGLLVFIVCVNTLASGITWLVVKLSPKRS
Ga0247827_1022257813300028889SoilGYSRAVMDAVLGLLGLIVYAACVISFAAACTWAVVKISPSGGKKT
Ga0268241_1004508423300030511SoilMDAVLGLLGLMVFIACVILFAAATTWVVVKISPTK
Ga0307499_1008489723300031184SoilMDAVLGMLGLIIYGACVIAFAAACTWAVVKISPAGGKKT
Ga0307468_10147970423300031740Hardwood Forest SoilMGAVLGLLGLAVYAACVIAFAAACTWAVVKISPAGGRKAKV
Ga0307412_1134755923300031911RhizosphereMDAVLGLLGLVVFAACVIALAAGTTWLVVRIFPTK
Ga0308175_10281319823300031938SoilMDAVLGLLGLIVYAACVIAFAAMCTWVVVKISPAGG
Ga0308176_1024165323300031996SoilMDAVLGLLGLIVYAACVIAFAAMCTWVVVKISPAGGKKT
Ga0310895_1030066513300032122SoilSVVTTVLGLLGLIVFIVCVILLAAATTWLVVKVSPSKR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.