| Basic Information | |
|---|---|
| Family ID | F104077 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VVTTRLTEVKGNKLYFEVACHQGEKLLGSGTHKRAIVPADF |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.97 % |
| % of genes near scaffold ends (potentially truncated) | 94.06 % |
| % of genes from short scaffolds (< 2000 bps) | 88.12 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.65 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.020 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (21.782 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.653 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.436 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 43.48% Coil/Unstructured: 56.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.65 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF00291 | PALP | 27.72 |
| PF01037 | AsnC_trans_reg | 13.86 |
| PF01370 | Epimerase | 3.96 |
| PF12697 | Abhydrolase_6 | 1.98 |
| PF00561 | Abhydrolase_1 | 1.98 |
| PF04261 | Dyp_perox | 0.99 |
| PF02720 | DUF222 | 0.99 |
| PF00483 | NTP_transferase | 0.99 |
| PF03176 | MMPL | 0.99 |
| PF00107 | ADH_zinc_N | 0.99 |
| PF01035 | DNA_binding_1 | 0.99 |
| PF00155 | Aminotran_1_2 | 0.99 |
| PF05694 | SBP56 | 0.99 |
| PF02515 | CoA_transf_3 | 0.99 |
| PF02754 | CCG | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG0247 | Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcF | Energy production and conversion [C] | 0.99 |
| COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 0.99 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.99 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.99 |
| COG2048 | Heterodisulfide reductase, subunit B | Energy production and conversion [C] | 0.99 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.99 |
| COG2837 | Periplasmic deferrochelatase/peroxidase EfeB | Inorganic ion transport and metabolism [P] | 0.99 |
| COG3695 | Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain | Transcription [K] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.02 % |
| Unclassified | root | N/A | 1.98 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001405|JGI20186J14852_1001207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1934 | Open in IMG/M |
| 3300001412|JGI20173J14856_1047496 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300001537|A2065W1_10051882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 979 | Open in IMG/M |
| 3300001661|JGI12053J15887_10254002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 873 | Open in IMG/M |
| 3300005176|Ga0066679_10461210 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300005176|Ga0066679_10767675 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300005177|Ga0066690_10504041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 814 | Open in IMG/M |
| 3300005187|Ga0066675_11271028 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300005434|Ga0070709_11468057 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300005447|Ga0066689_10881062 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300005471|Ga0070698_100391019 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
| 3300005518|Ga0070699_101515623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 615 | Open in IMG/M |
| 3300005536|Ga0070697_101408279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 622 | Open in IMG/M |
| 3300005542|Ga0070732_10858006 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300005545|Ga0070695_100045844 | All Organisms → cellular organisms → Bacteria | 2788 | Open in IMG/M |
| 3300005549|Ga0070704_100008883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6049 | Open in IMG/M |
| 3300005549|Ga0070704_100443689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1116 | Open in IMG/M |
| 3300005555|Ga0066692_10786696 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300005557|Ga0066704_10276842 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300005558|Ga0066698_10059275 | All Organisms → cellular organisms → Bacteria | 2440 | Open in IMG/M |
| 3300005559|Ga0066700_11124973 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300005569|Ga0066705_10260380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1100 | Open in IMG/M |
| 3300005574|Ga0066694_10238881 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300006028|Ga0070717_11722592 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300006034|Ga0066656_10056302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2283 | Open in IMG/M |
| 3300006755|Ga0079222_12663940 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300006791|Ga0066653_10588773 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300006794|Ga0066658_10855245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 518 | Open in IMG/M |
| 3300006797|Ga0066659_10303995 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300006800|Ga0066660_10131418 | All Organisms → cellular organisms → Bacteria | 1826 | Open in IMG/M |
| 3300006854|Ga0075425_100901756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1011 | Open in IMG/M |
| 3300006893|Ga0073928_11013090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 565 | Open in IMG/M |
| 3300006914|Ga0075436_101087909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 601 | Open in IMG/M |
| 3300007076|Ga0075435_101269947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 645 | Open in IMG/M |
| 3300007258|Ga0099793_10171842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1033 | Open in IMG/M |
| 3300007265|Ga0099794_10581160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 593 | Open in IMG/M |
| 3300009088|Ga0099830_10703011 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300009090|Ga0099827_10267379 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
| 3300009090|Ga0099827_11979028 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300009093|Ga0105240_11777814 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300009137|Ga0066709_100324603 | All Organisms → cellular organisms → Bacteria | 2103 | Open in IMG/M |
| 3300009147|Ga0114129_10143988 | All Organisms → cellular organisms → Bacteria | 3265 | Open in IMG/M |
| 3300010303|Ga0134082_10006813 | All Organisms → cellular organisms → Bacteria | 4080 | Open in IMG/M |
| 3300010303|Ga0134082_10024882 | All Organisms → cellular organisms → Bacteria | 2227 | Open in IMG/M |
| 3300010304|Ga0134088_10106846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1319 | Open in IMG/M |
| 3300010329|Ga0134111_10065920 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
| 3300010335|Ga0134063_10223033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 892 | Open in IMG/M |
| 3300010358|Ga0126370_10181763 | All Organisms → cellular organisms → Bacteria | 1569 | Open in IMG/M |
| 3300010358|Ga0126370_10469347 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300010375|Ga0105239_11918235 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300011271|Ga0137393_11270232 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300012019|Ga0120139_1177419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 562 | Open in IMG/M |
| 3300012203|Ga0137399_10222549 | All Organisms → cellular organisms → Bacteria | 1539 | Open in IMG/M |
| 3300012207|Ga0137381_11180915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 658 | Open in IMG/M |
| 3300012210|Ga0137378_10243829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1673 | Open in IMG/M |
| 3300012210|Ga0137378_11268784 | Not Available | 653 | Open in IMG/M |
| 3300012211|Ga0137377_10772926 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300012362|Ga0137361_11692573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 552 | Open in IMG/M |
| 3300012363|Ga0137390_10032307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4998 | Open in IMG/M |
| 3300012363|Ga0137390_10259961 | All Organisms → cellular organisms → Bacteria | 1721 | Open in IMG/M |
| 3300012363|Ga0137390_10761739 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300012397|Ga0134056_1293704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 521 | Open in IMG/M |
| 3300012398|Ga0134051_1028051 | Not Available | 551 | Open in IMG/M |
| 3300012401|Ga0134055_1117918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 781 | Open in IMG/M |
| 3300012917|Ga0137395_10014265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4448 | Open in IMG/M |
| 3300012918|Ga0137396_11307547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 503 | Open in IMG/M |
| 3300012924|Ga0137413_10192165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1366 | Open in IMG/M |
| 3300012927|Ga0137416_11448304 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300012971|Ga0126369_12254242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 631 | Open in IMG/M |
| 3300013501|Ga0120154_1048857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1013 | Open in IMG/M |
| 3300013766|Ga0120181_1054803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 894 | Open in IMG/M |
| 3300018468|Ga0066662_12044532 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300018482|Ga0066669_10140211 | All Organisms → cellular organisms → Bacteria | 1760 | Open in IMG/M |
| 3300019883|Ga0193725_1116496 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300019886|Ga0193727_1043482 | All Organisms → cellular organisms → Bacteria | 1479 | Open in IMG/M |
| 3300020581|Ga0210399_10552852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 954 | Open in IMG/M |
| 3300021088|Ga0210404_10314747 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300021170|Ga0210400_11441356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 548 | Open in IMG/M |
| 3300021432|Ga0210384_11112568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 693 | Open in IMG/M |
| 3300021479|Ga0210410_10549968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1028 | Open in IMG/M |
| 3300021559|Ga0210409_11498152 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300025915|Ga0207693_11228646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 564 | Open in IMG/M |
| 3300025916|Ga0207663_10844568 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300025922|Ga0207646_10349002 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
| 3300026223|Ga0209840_1013504 | All Organisms → cellular organisms → Bacteria | 1865 | Open in IMG/M |
| 3300026301|Ga0209238_1266280 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300026317|Ga0209154_1003496 | All Organisms → cellular organisms → Bacteria | 8516 | Open in IMG/M |
| 3300026320|Ga0209131_1368441 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300026335|Ga0209804_1254609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 648 | Open in IMG/M |
| 3300026529|Ga0209806_1067899 | All Organisms → cellular organisms → Bacteria | 1614 | Open in IMG/M |
| 3300026536|Ga0209058_1113643 | All Organisms → cellular organisms → Bacteria | 1346 | Open in IMG/M |
| 3300026537|Ga0209157_1228376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 760 | Open in IMG/M |
| 3300027748|Ga0209689_1268405 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300027968|Ga0209061_1012163 | All Organisms → cellular organisms → Bacteria | 5417 | Open in IMG/M |
| 3300028784|Ga0307282_10236557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 876 | Open in IMG/M |
| 3300031962|Ga0307479_10294803 | All Organisms → cellular organisms → Bacteria | 1603 | Open in IMG/M |
| 3300031962|Ga0307479_11892746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 547 | Open in IMG/M |
| 3300032089|Ga0318525_10619957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 551 | Open in IMG/M |
| 3300032205|Ga0307472_100469952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1075 | Open in IMG/M |
| 3300032205|Ga0307472_101436873 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300032261|Ga0306920_102934815 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 21.78% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.95% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.97% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.98% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.98% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.99% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.99% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001405 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 | Environmental | Open in IMG/M |
| 3300001412 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300001537 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012397 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012398 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013501 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25M | Environmental | Open in IMG/M |
| 3300013766 | Permafrost microbial communities from Nunavut, Canada - A26_65cm_6M | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026223 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027968 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI20186J14852_10012071 | 3300001405 | Arctic Peat Soil | EVKGNHLYFDVECRQGDKLIGSGIHKRAIVPAAF* |
| JGI20173J14856_10474961 | 3300001412 | Arctic Peat Soil | TVVITTRLTEVKGNKLYFDVECRQAETLIGSGRHKRAIVPANF* |
| A2065W1_100518821 | 3300001537 | Permafrost | TEVKGNKLYFEVECRQGDKVLGSGTHKRAIVPASF* |
| JGI12053J15887_102540021 | 3300001661 | Forest Soil | GSTIVVTTRLNEVKGNKLYFEVECRQGDTVLGTGVHKRAIVPANY* |
| Ga0066679_104612101 | 3300005176 | Soil | LAPTAPGRTVVVTSRVAEVRGNKLQFDVECRDGDMILGSGIHKRAVVPATF* |
| Ga0066679_107676752 | 3300005176 | Soil | VVVTSRVAEVKGNKLQFEVECREGDTVLGTGIHKRAVVPATF* |
| Ga0066690_105040414 | 3300005177 | Soil | TSRLQEVRDNKLVFEVECRLGDRVIGSGIHKRAIVPANF* |
| Ga0066675_112710281 | 3300005187 | Soil | GRTIVVTTRLIEVKGNKLHFEVECREGEKLLGSGIHKRAIVPATF* |
| Ga0070709_114680571 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | GHTIVVTSRVAEVRGNKLVFEVECREGEQLLGSGTHKRAIVPALS* |
| Ga0066689_108810621 | 3300005447 | Soil | APAPPGSTVVVTARLTEVKDNKLYFDVQCELDGKVIGTGTHKRAIVPANF* |
| Ga0070698_1003910192 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | PTAPGTTIVVTTKLTEVKGNKLYFEVACHQGETLLGSGTHKRAIVPADF* |
| Ga0070699_1015156232 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | GSTIVVTTRLTEVKGNKLHFEVECREGDKLLGSGIHKRAIVPATF* |
| Ga0070697_1014082793 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | GRTIVVTSRLTEVKGNKLYFEVECREGDKLLGSGIHKRAIVAATF* |
| Ga0070732_108580062 | 3300005542 | Surface Soil | GTTIVVTSHLTEVNGNKLMFEVECHEGDRLLGSGMHKRAVVPANF* |
| Ga0070695_1000458441 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | TSRLTEVKGNKLYFEVECREGDKLLGSGIHKRAIVAATF* |
| Ga0070704_1000088831 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | TIVVTSRLTEVKGNKLYFDVECHEGDRLLGSGTHKRAIVPAEF* |
| Ga0070704_1004436893 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VVTTRLTEVKGNKLYFEVACHQGEKLLGSGTHKRAIVPADF* |
| Ga0066692_107866961 | 3300005555 | Soil | TVVVTARLTEVKDNKLYFDVQCELDGKVIGTGTHKRAIVPANF* |
| Ga0066704_102768421 | 3300005557 | Soil | TEVKGNKLLFEVDCYEGETLLGSGIHKRAVVPATF* |
| Ga0066698_100592756 | 3300005558 | Soil | PTAPGHTIVVTSRVTEVKGNKLHFEVECREGDKLLGSGIHKRAIVPATF* |
| Ga0066700_111249731 | 3300005559 | Soil | PGSTIVVTTRVTEVKGNKLLFEVDCYEGETLLGSGIHKRAVVPATF* |
| Ga0066705_102603801 | 3300005569 | Soil | SRLQEVRDNKLVFEVECRLGDQVIGSGTHKRAIVPANF* |
| Ga0066694_102388811 | 3300005574 | Soil | VTTRLTEVKGNKLHFEVECHDGDTLLGSGMHKRAIVAATF* |
| Ga0070717_117225921 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | PTAPGTTIVVTTRLTEVKGNKLYFEVACHQGEKLLGSGTHKRAIVPADF* |
| Ga0066656_100563021 | 3300006034 | Soil | VTTRVAEVKGNKLKFQVECHEGDTLLGDGIHKRAVVPAMF* |
| Ga0079222_126639402 | 3300006755 | Agricultural Soil | GRTIVVTTKLADVKGNKLYFDVACHEAETLLGSGTHKRAIVPATF* |
| Ga0066653_105887732 | 3300006791 | Soil | TVVVSSTLTEVKGNKLYFDVECHQGDKLLGSGTHKRAIVPADF* |
| Ga0066658_108552451 | 3300006794 | Soil | RLADVKGNKLYFDVECREGDTLLGSGTHKRAVVPATF* |
| Ga0066659_103039951 | 3300006797 | Soil | TRLTEVKGNKLHFEVECREGEKLLGSGIHKRAIVPATF* |
| Ga0066660_101314184 | 3300006800 | Soil | RTVVVTTRVAEVKGNKLKFEVECHEGDPLLGDGIHKRAVVPAMF* |
| Ga0075425_1009017561 | 3300006854 | Populus Rhizosphere | TLKEVNGNKLYFDVLCEMDGKVIGSGTHKRAIVPANF* |
| Ga0073928_110130902 | 3300006893 | Iron-Sulfur Acid Spring | TEVKGNKLYFDVECRQGEKLIGSGIHKRAIVPASF* |
| Ga0075436_1010879091 | 3300006914 | Populus Rhizosphere | TAPGHTIVVTSHLNEVKGNKLYFEVECREGDTLLGTGVHKRAVVPANF* |
| Ga0075435_1012699471 | 3300007076 | Populus Rhizosphere | PTAPGSTIVVTTRLTEVKGNKLHFEVECREGDKLLGSGIHKRAIVPATF* |
| Ga0099793_101718422 | 3300007258 | Vadose Zone Soil | IVVTTRLNEVKGNKLYFEVECRQGDKVIGSGMHKRAIVPANY* |
| Ga0099794_105811603 | 3300007265 | Vadose Zone Soil | PAPPGSTVVVTATLTEVKDNKLYFDVSCELDGKVIGTGTHKRAIVPANF* |
| Ga0099830_107030113 | 3300009088 | Vadose Zone Soil | PGTTIVVTTRLTEVNGNKLYFEVACHEGEKLLGSGTHKRAIVPADF* |
| Ga0099827_102673794 | 3300009090 | Vadose Zone Soil | VTARLTEVKGNKLYFDVACHQGDVLLGSGTHKRAIVPASF* |
| Ga0099827_119790282 | 3300009090 | Vadose Zone Soil | VVVTARLTEVKGNKLYFDVACHQGEVLLGSGTHKRAIVPAEF* |
| Ga0105240_117778141 | 3300009093 | Corn Rhizosphere | VSSRLVEVNGNKLVFEVECHLGDMLIGTGTHKRAVVPANF* |
| Ga0066709_1003246031 | 3300009137 | Grasslands Soil | TSSLKEVNGNKLLFDVACELDGKVIGTGTHKRAVVPANF* |
| Ga0114129_101439881 | 3300009147 | Populus Rhizosphere | EVTGNKLRFEVECHEGDKLLGSGYHKRAVVPASF* |
| Ga0134082_100068136 | 3300010303 | Grasslands Soil | VTTRGAEVKGNKLKFQVECHEGDTLLGDGIHKRAVVPAMF* |
| Ga0134082_100248821 | 3300010303 | Grasslands Soil | RVAEVKGNKLQFEVECREGDTVLGTGIHKRAVVPATF* |
| Ga0134088_101068463 | 3300010304 | Grasslands Soil | TAPGHTIVVTSHLSEVKGNKLYFEVECREGDTLLGTGVHKRAVVPANF* |
| Ga0134111_100659203 | 3300010329 | Grasslands Soil | VTARLTEVKDNKLYFDVQCELDGKVIGTGTHKRAIVPANF* |
| Ga0134063_102230331 | 3300010335 | Grasslands Soil | HATGRSEVHVRPLGRTAPGRAIVVSSRLPEVKGNKLYFEVECREGDTLLGSGIHKRAIVPATF* |
| Ga0126370_101817631 | 3300010358 | Tropical Forest Soil | TSRVTEVKGNKLYFDVECREGETLLGTGIHKRAVVPATF* |
| Ga0126370_104693474 | 3300010358 | Tropical Forest Soil | TLKDVNGNKLYFDVQCELDGKVIGSGTHKRAIVPANF* |
| Ga0105239_119182353 | 3300010375 | Corn Rhizosphere | PGSKVVVVSRLAEVKGNKLYFDVSCHEGQRLLGTGTHKRAIVAANF* |
| Ga0137393_112702323 | 3300011271 | Vadose Zone Soil | VVSTMLTEVKSNKLYFDVACHEGGVLLGSGKHKRAIVRADF* |
| Ga0120139_11774191 | 3300012019 | Permafrost | TGKLTEVKGNKLYFDVECHQGDKLLGTGTHKRAIVPADF* |
| Ga0137399_102225494 | 3300012203 | Vadose Zone Soil | VTTRLTEVKGNKLYFDVACHQGETLLGSGTHKRAIVPADF* |
| Ga0137381_111809151 | 3300012207 | Vadose Zone Soil | TIVVSTRLTEVKGNKLYFEVECREGDTLLGSGIHKRAVVPATF* |
| Ga0137378_102438291 | 3300012210 | Vadose Zone Soil | STIVVTTRLNEVKGNKLYFEVECRQGDKVIGSGMHKRAIVPAKY* |
| Ga0137378_112687842 | 3300012210 | Vadose Zone Soil | VVTSLLKEVNGNKLLFDVQCRDGDRLVGTGTHKRAVVPARR* |
| Ga0137377_107729261 | 3300012211 | Vadose Zone Soil | VVTSKLTEVKGNKLYFDVACHQGDKLLGAGTHKRAIVPKEF* |
| Ga0137361_116925732 | 3300012362 | Vadose Zone Soil | EVKGNKLQFEVACHEGDKLLGSGIHKRAIVPATF* |
| Ga0137390_100323071 | 3300012363 | Vadose Zone Soil | LTEVKDNKLYFDVSCELDGKVIGTGTHKRAIVPANF* |
| Ga0137390_102599611 | 3300012363 | Vadose Zone Soil | LTEVKGNKLYFDVACHQGEKLLGSGTHKRAIVPADF* |
| Ga0137390_107617391 | 3300012363 | Vadose Zone Soil | MAPAPPGSTVVVTSTLTQVKGNKLYFDVECRQGETLVGSGIHKRAIVPATF* |
| Ga0134056_12937043 | 3300012397 | Grasslands Soil | PTAPGRTIVVSSRLTEVKGNKLYFEVECREGDTLLGSGIHKRAIVPATF* |
| Ga0134051_10280512 | 3300012398 | Grasslands Soil | VDGRKVAFEVACHEGEKVVGSGIHKRAIVPATAD* |
| Ga0134055_11179181 | 3300012401 | Grasslands Soil | LAPTAPGRTIVVSSRLTEVKGNKLYFEVECREGDTLLGSGIHKRAIVPATF* |
| Ga0137395_100142651 | 3300012917 | Vadose Zone Soil | LAPAPPGSTVVVTATVTDVKDNKLYFDVSCELDGKVIGTGTHKRAIVPANF* |
| Ga0137396_113075471 | 3300012918 | Vadose Zone Soil | TEVKGNKLYFEVECHEGEKLLGSGTHKRAIVPATF* |
| Ga0137413_101921653 | 3300012924 | Vadose Zone Soil | TTRLNEVKGNKLYFEVECRQGDKVIGSGMHKRAIVPANY* |
| Ga0137416_114483041 | 3300012927 | Vadose Zone Soil | ITVTTKLTEVKGNKLYFDVACHLGDVLVGSGTHKRAIVPADF* |
| Ga0126369_122542422 | 3300012971 | Tropical Forest Soil | VVTSRLTEVKGNKLLFEVECFEGDKLLGSGIHKRAVVPASF* |
| Ga0120154_10488572 | 3300013501 | Permafrost | PGSTVVVTTHLTEVKGNKLYFEVECRQGDKVLGSGTHKRAILPASF* |
| Ga0120181_10548031 | 3300013766 | Permafrost | TRLTEVKGNKLYFEVECRQGDKVLGTGLHKRAIVPANY* |
| Ga0066662_120445323 | 3300018468 | Grasslands Soil | RNVAPTAPGSTIVVTTRLTEVKGTKLYFDVQFHEGDKLLGAGIHKRAIVPANF |
| Ga0066669_101402111 | 3300018482 | Grasslands Soil | TRLIEVKGNKLHFEVECREGEKLLGSGIHKRAIVPATF |
| Ga0193725_11164961 | 3300019883 | Soil | VVVTARLNEVKGNKLYFDVSCHQGDKLLGSGTHKRAIVPADF |
| Ga0193727_10434824 | 3300019886 | Soil | LNEVKGNKLYFDVSCHQGEKLLGSGTHKRAIVPADF |
| Ga0210399_105528521 | 3300020581 | Soil | TSRLTEVKGNKLYFNVECRDGDKLLGSGTHKRAIVPADF |
| Ga0210404_103147472 | 3300021088 | Soil | KTIVVTSRLTEVKGNKLYFDVECHEGETLLGSGTHKRAVVPANF |
| Ga0210400_114413562 | 3300021170 | Soil | IVVATRLTEVNGNKLYFEVECHQGDKLLGSGIHKRAIVPAIF |
| Ga0210384_111125681 | 3300021432 | Soil | RLTEVNGNKLYFEVECRDGERLLGSGIHKRAVVPATF |
| Ga0210410_105499681 | 3300021479 | Soil | TILVTTKVTEVKGNKLYFDVECRQGEKLIGSGIHKRAIVPAEF |
| Ga0210409_114981522 | 3300021559 | Soil | TRLTEVKGNKLYFDVFCHEGETLLGSGIHKRAIVEATF |
| Ga0207693_112286462 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VVVTTKLTEVKGNKLYFDVECRQGDKLIGSGLHKRAIVPADF |
| Ga0207663_108445682 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VTTKLTEVKGNKLYFDVECHDGETLLDSGIHKRAIVPATF |
| Ga0207646_103490021 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | APAPPGSTVVVTAMLTEVKDNKLYFDVSCELDGKVIGTGTHKRAIVAANF |
| Ga0209840_10135041 | 3300026223 | Soil | STVIITTRLTEVKGNKLYFDVECRQGEKLIGSGLHKRAIVPTDF |
| Ga0209238_12662801 | 3300026301 | Grasslands Soil | VVVTTRVAEVKGNKLKFEVECHEGDTLLGDGIHKRAVVPAVF |
| Ga0209154_10034961 | 3300026317 | Soil | RLTEVKGTKLYFDVQCHEGDKLLGAGIHKRAIVPANF |
| Ga0209131_13684412 | 3300026320 | Grasslands Soil | KLTEVKGNKLYFDVACHQGDKLLGSGTHKRAIVPADF |
| Ga0209804_12546093 | 3300026335 | Soil | ARLTDVKDNKLYFDVQCELAGKVIGTGTHKRAIVPANF |
| Ga0209806_10678991 | 3300026529 | Soil | RHVAPTAPGSTIVVTTKLTEVKGNKLYFDVACHQGDVRVGSGIHKRAIVPADF |
| Ga0209058_11136433 | 3300026536 | Soil | TSTLKEVNGNKLLFDVACELEGKVIGTGTHKRAIVPANF |
| Ga0209157_12283761 | 3300026537 | Soil | GRTITVTTRLTEVKGNKLHFEVECHEGDTLLGSGMHKRAIVPATF |
| Ga0209689_12684053 | 3300027748 | Soil | VTARLTEVKDNKLYFDVQCELDGKVIGTGTHKRAIVPANF |
| Ga0209061_10121637 | 3300027968 | Surface Soil | SSRLTEVNGNRLTFEVQCRRGEVLIGTGTHRRAIVPSL |
| Ga0307282_102365571 | 3300028784 | Soil | LNEVKGNKLYFEVECRQGDKLIGSGIHKRAIVSANY |
| Ga0307479_102948031 | 3300031962 | Hardwood Forest Soil | LTEVKGNKLHFEVECREGDTLLGSGIHKRAIVPANF |
| Ga0307479_118927461 | 3300031962 | Hardwood Forest Soil | STIVVTSRLTEVNGNKLLFEVSCSLGDKLVGTGTHKRAIVPANF |
| Ga0318525_106199572 | 3300032089 | Soil | SAPGSTIVVTSRLTEVKGNKLYFEVECRDGDTLLGAGTHKRAIVPAEF |
| Ga0307472_1004699522 | 3300032205 | Hardwood Forest Soil | HMAPTAPGSMVTVTTHLSEVRGNKLHFEVECRQGEQLLGSGIHKRAIVPADF |
| Ga0307472_1014368731 | 3300032205 | Hardwood Forest Soil | VVTSRLTEVKGNKLYFDVECHEGQTLLGSGTHKRAVVPANF |
| Ga0306920_1029348152 | 3300032261 | Soil | LAPAKAGDTVVVTARLAEVKGNRLQFDVACSSLDGDTLIGTGTHKRAVIPALG |
| ⦗Top⦘ |