 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F104054 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 38 residues |
| Representative Sequence | VDDLQIAWLIIGWLLAFWAGKDLQTRFVQWRSLRRGE |
| Number of Associated Samples | 63 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 75.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.99 % |
| % of genes from short scaffolds (< 2000 bps) | 2.97 % |
| Associated GOLD sequencing projects | 59 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (97.030 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (21.782 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.673 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (47.525 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.31% β-sheet: 0.00% Coil/Unstructured: 47.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF04226 | Transgly_assoc | 31.68 |
| PF00011 | HSP20 | 4.95 |
| PF13439 | Glyco_transf_4 | 2.97 |
| PF00939 | Na_sulph_symp | 2.97 |
| PF03483 | B3_4 | 1.98 |
| PF02518 | HATPase_c | 1.98 |
| PF12172 | DUF35_N | 1.98 |
| PF14361 | RsbRD_N | 1.98 |
| PF13365 | Trypsin_2 | 0.99 |
| PF08241 | Methyltransf_11 | 0.99 |
| PF13441 | Gly-zipper_YMGG | 0.99 |
| PF04012 | PspA_IM30 | 0.99 |
| PF06745 | ATPase | 0.99 |
| PF00296 | Bac_luciferase | 0.99 |
| PF03328 | HpcH_HpaI | 0.99 |
| PF00290 | Trp_syntA | 0.99 |
| PF12706 | Lactamase_B_2 | 0.99 |
| PF00589 | Phage_integrase | 0.99 |
| PF09335 | SNARE_assoc | 0.99 |
| PF07705 | CARDB | 0.99 |
| PF00534 | Glycos_transf_1 | 0.99 |
| PF00196 | GerE | 0.99 |
| PF05532 | CsbD | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 31.68 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 4.95 |
| COG0471 | Di- and tricarboxylate antiporter | Carbohydrate transport and metabolism [G] | 2.97 |
| COG1055 | Na+/H+ antiporter NhaD or related arsenite permease | Inorganic ion transport and metabolism [P] | 2.97 |
| COG1842 | Phage shock protein A | Transcription [K] | 1.98 |
| COG0159 | Tryptophan synthase alpha chain | Amino acid transport and metabolism [E] | 0.99 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.99 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.99 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.99 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.99 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.99 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 0.99 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.99 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 97.03 % |
| All Organisms | root | All Organisms | 2.97 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300006844|Ga0075428_100221908 | All Organisms → cellular organisms → Bacteria | 2041 | Open in IMG/M |
| 3300006954|Ga0079219_11212094 | Not Available | 655 | Open in IMG/M |
| 3300012212|Ga0150985_104342711 | All Organisms → cellular organisms → Bacteria | 1996 | Open in IMG/M |
| 3300027909|Ga0209382_10302021 | All Organisms → cellular organisms → Bacteria | 1805 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 21.78% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 13.86% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 10.89% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 8.91% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 5.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.95% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.97% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.97% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 1.98% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.98% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.99% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.99% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.99% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.99% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.99% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.99% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.99% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.99% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007790 | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009690 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC034_MetaG | Engineered | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010870 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012682 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ223 (23.06) | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028554 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (v9) | Environmental | Open in IMG/M |
| 3300030785 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 5C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030905 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030988 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031039 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 6C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_23268632 | 3300000033 | Soil | VDDLQIAWLLIGWLVAFWAGKDLQARFVQRRGLRRDQ* |
| JGI10216J12902_1018613261 | 3300000956 | Soil | VEDLQIAWLMLGWVLAFWAGKDLQSRFVQWWSSRRSELAE* |
| JGI10216J12902_1096544462 | 3300000956 | Soil | VDDLQVAWLIIGWLLAFWAGKDLQSRFAQRRGLRRGQ* |
| JGI10216J12902_1123185964 | 3300000956 | Soil | MDDLQIALLIIGWLVAFWAGKDLQTRFAQRRVLRRGE* |
| F14TB_1054218832 | 3300001431 | Soil | VDDLQIAWLIIGWLLAFWAGKDLQTRFAQWREAHRRA* |
| C688J35102_1189669531 | 3300002568 | Soil | VDDLQIAWLMLGWVLAFWAGKDLQSRFMQWRESRRATSPSQTF* |
| Ga0062593_1015740412 | 3300004114 | Soil | VGDGVDDLQVAWLIIGWLLAFWAGIDLQQRFVRWRSDRQDD* |
| Ga0070741_102770814 | 3300005529 | Surface Soil | VDDLQIAWLMLGWLVAFWAGKDLQARFTQWRELRRGE* |
| Ga0070741_113426832 | 3300005529 | Surface Soil | VNDLHVAWLMIGWMLAFWAGRDLQSRFMQWWQLRRDR* |
| Ga0068864_1022543241 | 3300005618 | Switchgrass Rhizosphere | MDELQIAWLLIGWMLAVFAGKDLQMRVARWWETRRQER* |
| Ga0066903_1008154362 | 3300005764 | Tropical Forest Soil | VNDLQIAWLIVGWMLAFWAGRDLQARFSQWWSARRVE* |
| Ga0066696_104810712 | 3300006032 | Soil | VNDLHIAWLLIGWLLAFWAGRDLQTRFMQWWQLRRGQ* |
| Ga0075428_1000579055 | 3300006844 | Populus Rhizosphere | DDLQIAWLMIGWLVAFWAGKDLQSRFTQWRSLRRGQ* |
| Ga0075428_1001367464 | 3300006844 | Populus Rhizosphere | MDELHVAWLMIGWIIAFWAGKDLQTRFARWRDARRQTD* |
| Ga0075428_1002219082 | 3300006844 | Populus Rhizosphere | VDDLQIAWLIIGWLVAFWAGKDLQTRFVQWRSLRRGE* |
| Ga0075428_1004345254 | 3300006844 | Populus Rhizosphere | VDDLQIAWLMIGWLVAFWAGKDLQTRFMRWREARRGE* |
| Ga0075428_1024070092 | 3300006844 | Populus Rhizosphere | VDDLQLAWLIIGWLVAFWAGKDLQTRFTQRRGPRRGE* |
| Ga0075421_1001375771 | 3300006845 | Populus Rhizosphere | SVDDLQIAWLIVGWLLAFWAGKDLQTRFAQWQKARQRVTAETER* |
| Ga0075421_1006343742 | 3300006845 | Populus Rhizosphere | VDDLQIAWLIIGWLLAFWAGKDLQSRFVQRQRDRRGE* |
| Ga0075421_1027751392 | 3300006845 | Populus Rhizosphere | VDDLQIAWLMIGWLVAFWAGKDLQSRFTQWRSLRRGA* |
| Ga0075430_1000244515 | 3300006846 | Populus Rhizosphere | VDDLQIAWLIVGWLLAFWAGKDLQTRFAQWQKARQRVTAETER* |
| Ga0079216_110159382 | 3300006918 | Agricultural Soil | VDDLQIAWLIIGWLLAFWAGKDLQTRFVQWRSLRRGE* |
| Ga0079219_112120942 | 3300006954 | Agricultural Soil | VDDLQIAWLMIGWLVAFWAGKDLQARFTQWRSLRRGE* |
| Ga0079218_126845521 | 3300007004 | Agricultural Soil | VDDLQIAWLMIGWLVAFWAGKDLQTRFVQWRSLRRSA* |
| Ga0105679_103302552 | 3300007790 | Soil | VDDLQMAWLMIGWLLAFWAGKDLQARFVRRRAPRRGE* |
| Ga0105679_106728473 | 3300007790 | Soil | VDDLQIAWLMLGWLVAFWAGKDLQERVVRWRGLRRGQ* |
| Ga0111539_127876572 | 3300009094 | Populus Rhizosphere | VDDLQIAWLMIGWLVAFWAGKDLQTRFTQRRGLRRG |
| Ga0116143_102687501 | 3300009690 | Anaerobic Digestor Sludge | VDDLQIAWLMIGWLLAFWAGKDLQARFAQRRAANRSK* |
| Ga0126307_101516902 | 3300009789 | Serpentine Soil | MDDLQIAWLIIGWLVAFWAGKDLQARFTQRRGLRRGE* |
| Ga0126307_113946792 | 3300009789 | Serpentine Soil | VDDLQIAWLMLGWLVAFWAGKDLQTRFAQRRSPRRGA* |
| Ga0126313_108685982 | 3300009840 | Serpentine Soil | VDDLQIAWLIIGWLVAFWAGKDLQTRFVQWREARRSQ* |
| Ga0126313_118269192 | 3300009840 | Serpentine Soil | VDDLQIAWLMLGWVLAFWAGKDLQSRFVQWWSSRRGE* |
| Ga0126304_106332831 | 3300010037 | Serpentine Soil | VDDLQIAWLIIGWLVAFWAGKDLQARFTQWRGLRRGQ* |
| Ga0126304_111786002 | 3300010037 | Serpentine Soil | VDDLQVAWLIIGWLLAFWAGKDLQSRFAQWRALRRSQ* |
| Ga0126315_108335682 | 3300010038 | Serpentine Soil | VDDLQIAWLIVGWLLAFWAGMDLQTRVTKWLAQRRVVAE* |
| Ga0126309_101292802 | 3300010039 | Serpentine Soil | VDDLQIAWLIIGWLLAFWAGKDLQTRFVQWRETHRRA* |
| Ga0126314_101887701 | 3300010042 | Serpentine Soil | VDDLQVAWLIVGWLLAFWAGMDLQTRVTKWLAQRRVVAE* |
| Ga0126310_107189192 | 3300010044 | Serpentine Soil | VDDLQIAWLIIGWLLAFWAGKDLQTRFAQRRGLRRGE* |
| Ga0126306_111896711 | 3300010166 | Serpentine Soil | VDDLQIAWLLIGWLVAFWAGKDLRARFVQRRAPRRGA* |
| Ga0102750_103593571 | 3300010870 | Soil | VDDLQIAWLRIGWLVAFWAGKDLQGRFAQWRSLRRSQQPI* |
| Ga0102750_104548162 | 3300010870 | Soil | DDLQVAWLIIGWLLAFWAGKDLQGRYAQRRGARGAE* |
| Ga0137365_109407731 | 3300012201 | Vadose Zone Soil | VDDLQIAWLLLGWVLAFWAGKDLQSRLARWWSSRRGE* |
| Ga0150985_1002092641 | 3300012212 | Avena Fatua Rhizosphere | VDDLQIAWLIIGWLVAFWAGKDLQARFMQWRGLRRGE* |
| Ga0150985_1027646351 | 3300012212 | Avena Fatua Rhizosphere | MDDILVAWLIIGWLLAFWAGKDLQTRFVQWRSLRRSA* |
| Ga0150985_1043236982 | 3300012212 | Avena Fatua Rhizosphere | SGHPGDGVDDLQIAWLMIGWLVAFWAGKDLQSRFTQWRSLRRAR* |
| Ga0150985_1043427111 | 3300012212 | Avena Fatua Rhizosphere | SGHPGDGVDDLQIAWLIIGWLVAFWAGKDLQTRFTQRRGLRRGE* |
| Ga0150985_1055369521 | 3300012212 | Avena Fatua Rhizosphere | MDDLQIAWLIVGWLLAFWAGKDLQSRFVQWRAARLEQ* |
| Ga0150985_1075061621 | 3300012212 | Avena Fatua Rhizosphere | VDDLQIAWLLIGWLVAFWAGKDLQARFVQRRAPRRGA* |
| Ga0150985_1090262342 | 3300012212 | Avena Fatua Rhizosphere | RLGDGVDDLQIAWLMIGWLVAFWAGKDLQSRFTQWRALRRGE* |
| Ga0150985_1136379382 | 3300012212 | Avena Fatua Rhizosphere | PRRGHLGDGVDDLQIAWLIIGWLLAFWAGKDLQTRFVQWREGRRRA* |
| Ga0150985_1151425721 | 3300012212 | Avena Fatua Rhizosphere | VNDLQIAWLIGGWLLAFWAGKDLQARYAQWRSVRQRA* |
| Ga0150984_1022130772 | 3300012469 | Avena Fatua Rhizosphere | VDDLQIAWLIIGWLLAFWAGKDLQARFAQWRALRRTG* |
| Ga0150984_1076030791 | 3300012469 | Avena Fatua Rhizosphere | VNDLQIAWLIVGWLLAFWAGKDLQTRYAQWRSVRQGQ* |
| Ga0150984_1142890741 | 3300012469 | Avena Fatua Rhizosphere | LGDGVDDLQIAWLMIGWLVAFWAGKDLQSRFTQWRALRRGE* |
| Ga0150984_1174239782 | 3300012469 | Avena Fatua Rhizosphere | DDLQIAWLIIGWLLAFWAGKDLQTRFVQWRSLRRGA* |
| Ga0150984_1207252252 | 3300012469 | Avena Fatua Rhizosphere | VDDLQIAWLLIGWLVAFWAGKDLQSRFAQWRGLRRGQ* |
| Ga0150984_1229647002 | 3300012469 | Avena Fatua Rhizosphere | VDDLQIAWLIIGWLLAFWAGKDLQTRFVQWREGRRRA* |
| Ga0136611_100788576 | 3300012682 | Polar Desert Sand | VEDLHIAWLIIGWLAAFWAGKDLQARFDQWRGLRHDE* |
| Ga0157285_103589632 | 3300012897 | Soil | VDDLQIAWLILGWVLAFWAGKDLQARFAQWRAGRRSA* |
| Ga0182001_100774731 | 3300014488 | Soil | VDDLQIAWLMIGWLVTFWAGKDLQARFTQWRGLRRSE* |
| Ga0173480_103332041 | 3300015200 | Soil | VRGTFGENVDDVQIAWLIIGWLLAFWAGKDLQSRFVQRQRARRGE* |
| Ga0132258_110228181 | 3300015371 | Arabidopsis Rhizosphere | SGHPGDGVDDLQIAWLMIGWLVAFWAGRDLQARFTQWRNLRRGQ* |
| Ga0132256_1015660921 | 3300015372 | Arabidopsis Rhizosphere | VDDLQIAWLMIGWLVAFWAGKDLQTRFVRRRAPRRG |
| Ga0132255_1040066031 | 3300015374 | Arabidopsis Rhizosphere | VDDLQIAWLMIGWLVAFWAGKDLQARFVRWRELRRSE* |
| Ga0132255_1042866871 | 3300015374 | Arabidopsis Rhizosphere | MDDLQIAWLILGWVLAFWAGKDLQARFARWRDRRRSDL* |
| Ga0190265_102921204 | 3300018422 | Soil | VDDLQVAWLIIGWLVAFWAGKDLQARFNQWRGGPRRAE |
| Ga0190265_131065022 | 3300018422 | Soil | VDDLQIAWLIIGWLVAFWAGKDLQTRFVQWRGLRRGK |
| Ga0190275_133322921 | 3300018432 | Soil | VDDLQIAWLIIGWLVAFWAGKDLQTRFVQWRSLRRGA |
| Ga0190269_108948572 | 3300018465 | Soil | VDDLQVAYLIIGWLLAFWAGKDLQARFNQWRGGPRRAE |
| Ga0190269_110731222 | 3300018465 | Soil | VDDLQVAWLIIGWLVAFWAGKDLQARFNQWRGSRRAE |
| Ga0190268_107425941 | 3300018466 | Soil | VDDLQIAWLMIGWLAAFWAGKDLQTRFVRWREMRRSA |
| Ga0190268_114558351 | 3300018466 | Soil | VGDGVDDLQVAWLIIGWLLAFWAGKDLQSRFAQWRAPRRGQ |
| Ga0190267_101057533 | 3300019767 | Soil | VDDLQIAWLIIGWLLAFWAGKDLQTRFVQWREACRRA |
| Ga0207662_107001422 | 3300025918 | Switchgrass Rhizosphere | MDDLQIAWLMIGWLVAFWAGKDLQARFAQWRNLRRGV |
| Ga0207701_114461402 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | VDDLQIAWLMIGWLVAFWAGKDLQSRFAQWRNLRRG |
| Ga0207661_115907702 | 3300025944 | Corn Rhizosphere | VDDLQIAWLMLGWVLAFWAGKDLQSRFVQWWSSRRAE |
| Ga0207676_115688112 | 3300026095 | Switchgrass Rhizosphere | MDELQIAWLLIGWMLAVFAGKDLQMRVARWWETRRQER |
| Ga0209481_100658993 | 3300027880 | Populus Rhizosphere | VDDLQIAWLMIGWLVAFWAGKDLQTRFMRWREARRGE |
| Ga0209481_101637192 | 3300027880 | Populus Rhizosphere | MDELHVAWLMIGWIIAFWAGKDLQTRFARWRDARRQTD |
| Ga0209382_103020213 | 3300027909 | Populus Rhizosphere | VDDLQIAWLIIGWLVAFWAGKDLQTRFVQWRSLRRGE |
| Ga0209382_106475131 | 3300027909 | Populus Rhizosphere | VDDLQIAWLIIGWLLAFWAGKDLQSRFVQRQRDRRGE |
| Ga0268265_120018751 | 3300028380 | Switchgrass Rhizosphere | VDDLQIAWLMIGWLVAFWAGKDLQARFVRWRSVRVRVR |
| Ga0302047_110634182 | 3300028554 | Soil | DDLQVAWLIIGWLLAFWAGKDLQGRYAQRRGARGAE |
| Ga0102757_100688852 | 3300030785 | Soil | STALSGHPGDGVDDLQIAWLLIGWLVAFWAGKDLQTRFVQWRSPRRGA |
| Ga0308202_10310251 | 3300030902 | Soil | VDDLQIAWLLIGWLVAFWAGKDLQTRFVQWRSPRRGA |
| Ga0308202_10852382 | 3300030902 | Soil | VDDLQIAWLIIGWLLAFWAGKDLQTRFVQWREARRRA |
| Ga0308200_11101812 | 3300030905 | Soil | VDDLQIAWLLIGWLAAFWAGKDLQSRFTERRGLRRGQ |
| Ga0308200_11463942 | 3300030905 | Soil | VDDLHIAWLLIGWLVAFWAGKDLQTRFVQWRGPRRSQ |
| Ga0308183_11158393 | 3300030988 | Soil | GDRVDDLQIAWLMLGWLLAFWAGKDLQTRFVRRQDSR |
| Ga0102760_109735752 | 3300031039 | Soil | VDDLQIAWLMIGWLVAFWAGKDLQTRFVQWRSPRRGA |
| Ga0308189_104130581 | 3300031058 | Soil | VDDLQVAWLIIGWLLAFWAGKDLQTRFMQWRDLRRAEQATA |
| Ga0308189_104676411 | 3300031058 | Soil | VDDLQIAWLIVGWLLAFWAGKDLQSRFVQWRATRQ |
| Ga0308201_100786382 | 3300031091 | Soil | VDDLQIAWLIVGWLLAFWAGKDLQSRFVQWRATRQEQ |
| Ga0308201_101112471 | 3300031091 | Soil | PSSTALSGHPGDGVDDLQIAWLLIGWLVAFWAGKDLQTRFVQWRSPRRGA |
| Ga0308204_100905581 | 3300031092 | Soil | VDDLQIAWLLIGWLVAFWAGKDLQARATQWRGLRRGR |
| Ga0308204_101960122 | 3300031092 | Soil | VDDLQIAWLIIGWLLAFWAGKDLQTRFMQWWNLRRTA |
| Ga0308181_10603193 | 3300031099 | Soil | HLGDRVDDLQIAWLMLGWLLAFWAGKDLQTRFVRRQDSR |
| Ga0170819_160701932 | 3300031469 | Forest Soil | VNDLQIAWLIVGWLLAFWAGKDLQARYAQRRSVRQSQ |
| Ga0307408_1011125692 | 3300031548 | Rhizosphere | MDDLHIAWLLIGWIVAFWAGKDLHTRVTRWLEARQEVR |
| Ga0308175_1008172603 | 3300031938 | Soil | VDDLQTAWLIIGWLLAFWAGKDLQSRFMQWRALRRGA |
| Ga0307416_1017059652 | 3300032002 | Rhizosphere | VDDLQIAWLMIGWLVALWAGKDLQSRFAHWRGLRRGE |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |