NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F103940

Metagenome / Metatranscriptome Family F103940

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F103940
Family Type Metagenome / Metatranscriptome
Number of Sequences 101
Average Sequence Length 47 residues
Representative Sequence MLGKTPLKYIGFAIAVVGAIVWNRAPNDLVLLVGILVTLGGVSVFGVQFD
Number of Associated Samples 86
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 60.40 %
% of genes near scaffold ends (potentially truncated) 51.49 %
% of genes from short scaffolds (< 2000 bps) 92.08 %
Associated GOLD sequencing projects 78
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (54.455 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(19.802 % of family members)
Environment Ontology (ENVO) Unclassified
(48.515 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(63.366 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 60.00%    β-sheet: 8.00%    Coil/Unstructured: 32.00%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF09084NMT1 9.90
PF10073DUF2312 9.90
PF00188CAP 4.95
PF02945Endonuclease_7 4.95
PF03401TctC 0.99
PF02900LigB 0.99
PF04392ABC_sub_bind 0.99
PF02586SRAP 0.99
PF01740STAS 0.99
PF02738MoCoBD_1 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 9.90
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 9.90
COG2340Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domainCell cycle control, cell division, chromosome partitioning [D] 4.95
COG2135ssDNA abasic site-binding protein YedK/HMCES, SRAP familyReplication, recombination and repair [L] 0.99
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.99
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.99


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms55.45 %
UnclassifiedrootN/A44.55 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908045|KansclcFeb2_ConsensusfromContig128295Not Available659Open in IMG/M
2199352025|deepsgr__Contig_115422Not Available678Open in IMG/M
3300004114|Ga0062593_103441162Not Available508Open in IMG/M
3300004463|Ga0063356_103237357Not Available702Open in IMG/M
3300004479|Ga0062595_102149762Not Available545Open in IMG/M
3300005093|Ga0062594_103030768Not Available525Open in IMG/M
3300005328|Ga0070676_10269696All Organisms → Viruses1143Open in IMG/M
3300005333|Ga0070677_10642667Not Available592Open in IMG/M
3300005365|Ga0070688_100784579All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium744Open in IMG/M
3300005440|Ga0070705_100427779All Organisms → cellular organisms → Bacteria987Open in IMG/M
3300005455|Ga0070663_100566184All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → unclassified Pseudorhodoplanes → Pseudorhodoplanes sp.952Open in IMG/M
3300005457|Ga0070662_100973332All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium726Open in IMG/M
3300005539|Ga0068853_100645006All Organisms → cellular organisms → Bacteria1007Open in IMG/M
3300005539|Ga0068853_102154179Not Available541Open in IMG/M
3300005544|Ga0070686_100414318All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1028Open in IMG/M
3300005548|Ga0070665_101305229All Organisms → cellular organisms → Bacteria → Proteobacteria736Open in IMG/M
3300005564|Ga0070664_100869291All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium845Open in IMG/M
3300005578|Ga0068854_100340654All Organisms → cellular organisms → Bacteria1224Open in IMG/M
3300005614|Ga0068856_100824496Not Available947Open in IMG/M
3300005615|Ga0070702_100395826Not Available987Open in IMG/M
3300005719|Ga0068861_100792456All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici889Open in IMG/M
3300005834|Ga0068851_10778560Not Available593Open in IMG/M
3300005844|Ga0068862_101300899Not Available728Open in IMG/M
3300006038|Ga0075365_10002170All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria9445Open in IMG/M
3300006038|Ga0075365_10507484All Organisms → cellular organisms → Bacteria852Open in IMG/M
3300006051|Ga0075364_10605445All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae749Open in IMG/M
3300006163|Ga0070715_10763088Not Available584Open in IMG/M
3300006178|Ga0075367_10059634All Organisms → cellular organisms → Bacteria2273Open in IMG/M
3300006237|Ga0097621_101319985All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium682Open in IMG/M
3300006574|Ga0074056_11765196Not Available676Open in IMG/M
3300006577|Ga0074050_12014776Not Available682Open in IMG/M
3300006581|Ga0074048_13488913All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium518Open in IMG/M
3300006606|Ga0074062_12191640All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → unclassified Pseudorhodoplanes → Pseudorhodoplanes sp.616Open in IMG/M
3300006845|Ga0075421_101768315Not Available666Open in IMG/M
3300006847|Ga0075431_101077327All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae769Open in IMG/M
3300006854|Ga0075425_100147412All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2695Open in IMG/M
3300006881|Ga0068865_100408578All Organisms → cellular organisms → Bacteria1113Open in IMG/M
3300006881|Ga0068865_100414164Not Available1106Open in IMG/M
3300006881|Ga0068865_101034654Not Available720Open in IMG/M
3300009036|Ga0105244_10160893All Organisms → cellular organisms → Bacteria1072Open in IMG/M
3300009036|Ga0105244_10543708Not Available535Open in IMG/M
3300009098|Ga0105245_11332962All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium767Open in IMG/M
3300009162|Ga0075423_11539783Not Available714Open in IMG/M
3300009174|Ga0105241_10487401Not Available1097Open in IMG/M
3300009176|Ga0105242_10228052All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1668Open in IMG/M
3300009553|Ga0105249_10051403All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3759Open in IMG/M
3300009553|Ga0105249_10635425All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1124Open in IMG/M
3300010371|Ga0134125_12083478Not Available617Open in IMG/M
3300010373|Ga0134128_10328103All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1711Open in IMG/M
3300010399|Ga0134127_11730688Not Available701Open in IMG/M
3300010400|Ga0134122_10508417All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1092Open in IMG/M
3300012212|Ga0150985_118928450All Organisms → cellular organisms → Bacteria → Proteobacteria1297Open in IMG/M
3300012469|Ga0150984_105182289Not Available514Open in IMG/M
3300012884|Ga0157300_1046441Not Available670Open in IMG/M
3300012905|Ga0157296_10118305All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300012960|Ga0164301_11351338All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium580Open in IMG/M
3300012985|Ga0164308_10821242All Organisms → cellular organisms → Bacteria → Proteobacteria812Open in IMG/M
3300012988|Ga0164306_10876297Not Available729Open in IMG/M
3300012988|Ga0164306_11710804Not Available546Open in IMG/M
3300013297|Ga0157378_11547006Not Available708Open in IMG/M
3300013306|Ga0163162_10355858All Organisms → cellular organisms → Bacteria1597Open in IMG/M
3300013306|Ga0163162_11770529All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300014325|Ga0163163_10656584All Organisms → cellular organisms → Bacteria → Proteobacteria1112Open in IMG/M
3300015077|Ga0173483_10398837All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium705Open in IMG/M
3300015373|Ga0132257_101012817All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1045Open in IMG/M
3300015373|Ga0132257_101076177All Organisms → cellular organisms → Bacteria → Proteobacteria1014Open in IMG/M
3300015373|Ga0132257_101607977Not Available831Open in IMG/M
3300015374|Ga0132255_100151789All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae3230Open in IMG/M
3300017965|Ga0190266_10044959All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1519Open in IMG/M
3300018466|Ga0190268_11930072Not Available539Open in IMG/M
3300018481|Ga0190271_11659967All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium753Open in IMG/M
3300019356|Ga0173481_10166511All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria925Open in IMG/M
3300020016|Ga0193696_1021059All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1752Open in IMG/M
3300020016|Ga0193696_1100561Not Available742Open in IMG/M
3300021082|Ga0210380_10055564All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1713Open in IMG/M
3300021415|Ga0193694_1009958All Organisms → cellular organisms → Bacteria → Proteobacteria1275Open in IMG/M
3300021510|Ga0222621_1053148Not Available850Open in IMG/M
3300025911|Ga0207654_11086608Not Available583Open in IMG/M
3300025911|Ga0207654_11442257Not Available502Open in IMG/M
3300025932|Ga0207690_10131833All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1830Open in IMG/M
3300025945|Ga0207679_10145419All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1922Open in IMG/M
3300025981|Ga0207640_11821432Not Available550Open in IMG/M
3300026118|Ga0207675_102705202Not Available504Open in IMG/M
3300026121|Ga0207683_10378431All Organisms → cellular organisms → Bacteria → Proteobacteria1301Open in IMG/M
3300026121|Ga0207683_11739555All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium573Open in IMG/M
3300026894|Ga0207980_1011429Not Available573Open in IMG/M
3300027388|Ga0208995_1001226All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4054Open in IMG/M
3300027907|Ga0207428_10330735All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1124Open in IMG/M
3300027909|Ga0209382_10140985All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2800Open in IMG/M
3300027909|Ga0209382_11549750Not Available658Open in IMG/M
3300028379|Ga0268266_10132577All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2230Open in IMG/M
3300028380|Ga0268265_10265810All Organisms → cellular organisms → Bacteria1527Open in IMG/M
3300028712|Ga0307285_10035629Not Available1206Open in IMG/M
3300028768|Ga0307280_10110449Not Available922Open in IMG/M
3300028811|Ga0307292_10070196All Organisms → cellular organisms → Bacteria → Proteobacteria1340Open in IMG/M
3300028872|Ga0307314_10196745Not Available605Open in IMG/M
3300031152|Ga0307501_10284559Not Available504Open in IMG/M
3300031226|Ga0307497_10404579Not Available653Open in IMG/M
3300031474|Ga0170818_110020990All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300031474|Ga0170818_111332997Not Available548Open in IMG/M
3300031854|Ga0310904_10326135Not Available982Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil19.80%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.94%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere5.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere4.95%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.96%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere3.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.97%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.97%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.97%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.98%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.98%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.99%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.99%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.99%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.99%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.99%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.99%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006051Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006178Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006574Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006577Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009036Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012884Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021415Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1EnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026894Soil and rhizosphere microbial communities from Laval, Canada - mgLPA (SPAdes)EnvironmentalOpen in IMG/M
3300027388Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KansclcFeb2_036937202124908045SoilMPGKTPLKYIGFAIAVVGAIVWNRAPNDLILLVGILLTLAGVSVFGVQFE
deepsgr_018240702199352025SoilMLSKTPLKYIGLAIAVAGAIVWNRAPNDLVLLVGILVTLGGVSVFGVQFD
Ga0062593_10344116223300004114SoilMPGKTPLKYIGFAIAVVGAIVWNRAPNDLILLVGILLTLGGVSVFGVQFE*
Ga0063356_10323735713300004463Arabidopsis Thaliana RhizosphereMLGKTPLKYIGLAIAVAGAIVWNRAPNDLVLLVGILVTLGGVAVFGVQFD*
Ga0062595_10214976213300004479SoilMLSKTPLKYIGLAIAVAGAIVWNRAPNDLVLLVGILVTLGGVSVFGVQFD*
Ga0062594_10303076813300005093SoilGKTPLKYIGFAIAVVGAIVWNRAPNDLILLVGILVTLGGVSVFGVQFD*
Ga0070676_1026969623300005328Miscanthus RhizosphereMLSKTPLKYIGLAIAVAGAIVWNRAPNDLVLLVGILVTLGGVSVFG
Ga0070677_1064266733300005333Miscanthus RhizosphereMLGKTPLKYIGFAIAVVGAIVWNRAPNDLILLVGILLTLGGVSVFGVQFE*
Ga0070688_10078457923300005365Switchgrass RhizosphereMPGKTPLKYIGIAIALAGAIVWNRAPNLLVGILVTLGGVSVFGVQFD*
Ga0070705_10042777913300005440Corn, Switchgrass And Miscanthus RhizosphereDMLSKTPLKYIGLAIAVAGAIVWNRAPNDLVLLVGILVTLGGVSVFGVQFD*
Ga0070663_10056618423300005455Corn RhizosphereMPGKTPLKYIGFAIAVVGAIVWNRAPNDLILLVGILVTLGGVSVFGVQFD*
Ga0070662_10097333223300005457Corn RhizosphereDLPGKTPLKYIGIAIALAGAIVWNRAPNDLVLLVGILVTLGGVSVFGVQFD*
Ga0068853_10064500613300005539Corn RhizospherePDMLSKTPLKYIGLAIAVAGAIVWNRAPNDLVLLVGILVTLGGVSVFGVQFD*
Ga0068853_10215417923300005539Corn RhizosphereMLGKTPLKYIGFAIAVVGAIVWNRAPNDLVLLIGILVTLGGVSVFGVQFD*
Ga0070686_10041431833300005544Switchgrass RhizosphereMLGKTPLKYIGVAIAVAGAIVWNRAPNDLVLLAGILVTLGGVAVFGVQFY*
Ga0070665_10130522923300005548Switchgrass RhizosphereVGAIVWNRAPNDLVLLIGILVTLGGVSVFGVQFD*
Ga0070664_10086929133300005564Corn RhizosphereMLGKTPLKYIGVAIAVAGAIVWNRAPNDLVLLAGILVTLGGV
Ga0068854_10034065423300005578Corn RhizosphereMVSKTPLKYIGLAIAVAGAIVWNRAPNDLVLLVGILVTLGGVSVFGVQFD*
Ga0068856_10082449623300005614Corn RhizosphereMLGKTPLKYIGLAIAVAGAIVWNRAPNDLVLLVGILVTLGGVSVFGVQFD*
Ga0070702_10039582623300005615Corn, Switchgrass And Miscanthus RhizosphereMLGKTPLKYIGFAIAVVGAIVWNRAPNDLILLVGILVTLGGVSVFGVQFD*
Ga0068861_10079245623300005719Switchgrass RhizosphereMLGKTPLKYIGFAIAVVGAIVWNRAPNDLVLLVGILVTLGGVSVFGVQFD*
Ga0068851_1077856023300005834Corn RhizosphereMPGKTPLKYIGFAIAVVGAIVWNRAPNDLVLLVGILVTLGGVAVFGVQFD*
Ga0068862_10130089923300005844Switchgrass RhizosphereMLGKTPLKYIGFAIAVVGAIVWNRAPNDLVLLVGILVTLGGVAVFGVQFD*
Ga0075365_10002170103300006038Populus EndosphereMPGKTPLKYIGLAIAVVGAIVWNRAPNDLVLLAGILVTLCGVSVFGVQFD*
Ga0075365_1050748423300006038Populus EndosphereMPGKTPLKYIGFAIAVVGAIVWNRAPNDLILLVGILLTLAGVSVFGVQFE*
Ga0075364_1060544513300006051Populus EndosphereGVAIAVAGAIVWNRAPNDLVLLAGILVTLGGVAVFGVQFD*
Ga0070715_1076308823300006163Corn, Switchgrass And Miscanthus RhizosphereMLSKTPLKYIGLAIAVAGAIVWNRAPNDLVLLVGILVTL
Ga0075367_1005963423300006178Populus EndosphereMPGETPLKYIGFAIAVVGAIVWNRAPNDLILLVGILLTLAGVSVFGVQFE*
Ga0097621_10131998523300006237Miscanthus RhizosphereAGAIVWNRAPNDLVLLVGILVTLGGVSVFGVQFD*
Ga0074056_1176519613300006574SoilGVPDMLSKTPLKYIGLAIAVAGAIVWNRAPNDLVLLVGILVTLGGVSVFGVQFD*
Ga0074050_1201477633300006577SoilKTPLKYIGLAIAVAGAIVWNRAPNDLVLLVGILVTLGGVSVFGVQFD*
Ga0074048_1348891323300006581SoilVGAIVWNRAPNDLVLLVGILVTLGGVSVFGVQFD*
Ga0074062_1219164023300006606SoilKTPLKYIGFAIAVVGAIVWNRAPNDLVLLIGILVTLGGVSVFGVQFD*
Ga0075421_10176831523300006845Populus RhizosphereMPGKTPLKYIGFAIAVVGAIVWNRAPNDLVLLVGILVTLGGVSVFGVQFD*
Ga0075431_10107732723300006847Populus RhizosphereKTPLKYIGLAIAVAGAIVWNRAPNDLVLLVGILVTLGGVAVFGVQFD*
Ga0075425_10014741233300006854Populus RhizosphereMLGKTPLKYIGVAIAVAGAIVWNRAPNDLVLLVGILVTLGGVAVFGVQFD*
Ga0068865_10040857813300006881Miscanthus RhizosphereVPDMLSKTPLKYIGLAIAVAGAIVWNRAPNDLVLLVGILVTLGGVSVFGVQFD*
Ga0068865_10041416413300006881Miscanthus RhizosphereMLSKTPLKYIGLAIAVAGAIVWNRAPNDLVLLVGI
Ga0068865_10103465413300006881Miscanthus RhizosphereMLSKTPLKYIGLAIAVAGAIVWNRAPNDLVLLVGIL
Ga0105244_1016089313300009036Miscanthus RhizosphereKYIGFAIAVVGAIVWNRAPNDLVLLVGILVTLGGVSVFGVQFD*
Ga0105244_1054370813300009036Miscanthus RhizosphereMLSKTPLKYIGLAIAVAGAIVWNRAPNDLVLLVGSLVTLGGGSVFGV*
Ga0105245_1133296213300009098Miscanthus RhizosphereMLGKTPLKYIGLAIAVAGAIVWNRAPNDLVLLVGILVTLGG
Ga0075423_1153978313300009162Populus RhizosphereMLGKTPLKYIGLAIAVAGAIVWNRAPNDLVLLVGIW*
Ga0105241_1048740113300009174Corn RhizosphereLKYIGSAIALAGASVWNRAPNDLALRVPILGTLGGFSVF
Ga0105242_1022805233300009176Miscanthus RhizosphereTPLKYIGFAIAVVGAIVWNRAPNDLILLVGILLTLGGVSVFGVQFE*
Ga0105249_1005140313300009553Switchgrass RhizosphereGKTPLKYIGFAIAVVGAIVWNRAPNDLVLLVGILVTLGGVSVFGVQFD*
Ga0105249_1063542523300009553Switchgrass RhizosphereMLGKTPLKYIGVAIAVAGAIVWNRAPNDLVLLAGILVTLGGVAVFGVQFD*
Ga0134125_1208347823300010371Terrestrial SoilMPGKTPLKYIGFAIAVVGAIVWNRAPNDLVLLIGILVTLGGVSVFGVQFD*
Ga0134128_1032810333300010373Terrestrial SoilPLKYIGVAIAVAGAIVWNRAPNDLVLLAGILVTLGGVAVFGVQFD*
Ga0134127_1173068823300010399Terrestrial SoilMVSKTPLKYIGLAIALAGGIVWNRAPNDLVLLVGILVT
Ga0134122_1050841723300010400Terrestrial SoilMLGKTPLKYIGFAIAVVGAIVWNRAPNDLILLVGILVTLGGVSLFGVQFD*
Ga0150985_11892845023300012212Avena Fatua RhizosphereSDDVGDPNMLGKTPLKYIGFAIALVGAIIWNRAPNDLVLLIGILVTLGGVSVFGVQFD*
Ga0150984_10518228923300012469Avena Fatua RhizosphereMPGKTPLKYIGFAIAVVGAIVWNRAPNDLILLVGILVTLGGVSIFGVQFD*
Ga0157300_104644113300012884SoilMLSKTPLKYIGLAIAVAGAIVWNRAPNDLVLLVGILVTLGGVAVFGVQFD*
Ga0157296_1011830523300012905SoilVEFSGMLGKTPLKYIGLAIAVAGAIVWNRAPNDLVLLAGILVTLGGVAVFGVQFD*
Ga0164301_1135133813300012960SoilIGFAIAVVGAIVWNRAPNDLILLVGILLTLGGVSVFGVQFE*
Ga0164308_1082124223300012985SoilVVGAIVWNRAPNDLILLVGILLTLGGVSVFGVQFE*
Ga0164306_1087629713300012988SoilPLKYIGFAIAVVGAIVWNRAPNDLILLVGILVTLGGVSVFGVQFD*
Ga0164306_1171080413300012988SoilMLGKTPLKYIGFAIALVGAIVWNRAPNDLVLLIGILVTLGGVSVFGVQFD*
Ga0157378_1154700613300013297Miscanthus RhizosphereLKYIGIAIALAGAIVWNRAPNDLVLLVGILVTLGGVSVFGVQFD*
Ga0163162_1035585813300013306Switchgrass RhizosphereMLSKTPLKYIGLAIAVAGAIVWNRAPNDLVLLVGILVTLGG
Ga0163162_1177052923300013306Switchgrass RhizosphereLSKTPLKYIGLAIAVAGAIVWNRAPNDLVLLVGILVTLGGVSVFGVQFD*
Ga0163163_1065658423300014325Switchgrass RhizosphereMLGKTPLKYIGFAIELVGAIVWNRAPNDLVLLIGILVTLGGVSVFGVQFD*
Ga0173483_1039883723300015077SoilMLGKTPLKYIGFAIALVGAIVWNRAPNDLILLVGILLTLAGVSVFGVQFE*
Ga0132257_10101281713300015373Arabidopsis RhizosphereMLGKTPLKYIGLAIAVAGAIVWNRAPNDLVLLVGILVTLGGAAVFGVQFD*
Ga0132257_10107617713300015373Arabidopsis RhizospherePGKTPLKYIGFAIAVVGAIVWNRAPNDLILLVGILVTLGGVSVFGVQFD*
Ga0132257_10160797723300015373Arabidopsis RhizosphereMPGKTPLKYIGFAIAVVGAIVWNRAPNDLILLVGILVTL
Ga0132255_10015178933300015374Arabidopsis RhizosphereMRGKTPLKYIGFAIAVVGAIVWNRAPNDLILLVGILVTLGGVSVFGVQFD*
Ga0190266_1004495933300017965SoilTPLKYIGFAIAVVGAIVWNRAPNDLVLLVGILVTLGGVSVFGVQFD
Ga0190268_1193007213300018466SoilMLGKTPLKYIGFAIAVVGAIVWNRAPNDLVLLVGILLTLGGVSVFGVQF
Ga0190271_1165996723300018481SoilGFAIAVVGAIVWNRAPNDLGLLVGILVTLGGVSVFGVQFD
Ga0173481_1016651113300019356SoilMLGKTPLKYIGVAIAVAGAIVWNRAPNDLVLLVGILVTLGGVAVFGVQFD
Ga0193696_102105913300020016SoilVVGAIVWNRAPNDLVLLVGILVTLGGVSVFGVQFD
Ga0193696_110056113300020016SoilMPGKTPLKYIGFAIAVVGAIVWNRAPNDLVLLVGILVT
Ga0210380_1005556433300021082Groundwater SedimentVPDMLGKTPLKYIGFAIAVVGAIVWNRAPNDLVLLVGILVTLGGVSVFGVQFD
Ga0193694_100995813300021415SoilMLGKTPLKYIGFAIAVVGAIVWNRAPNDLVLLVGILVTLGGVSVFGVQFD
Ga0222621_105314823300021510Groundwater SedimentMLGKTPLKYIGFAIAVVGAIVWNRAPNDLVLLVGILVTLGGVSVFGVQ
Ga0207654_1108660813300025911Corn RhizosphereLKYIGLAIAVAGAIVWNRAPNDLVLLVGILVTLGGVSVFGVQFD
Ga0207654_1144225723300025911Corn RhizosphereMPGKTPLKYIGFAIAVVGAIVWNRAPNDLILLVGILVTLGGVSVFGVQFD
Ga0207690_1013183313300025932Corn RhizosphereSKTPLKYICLAIAVAGAIVWNRAPNDLVLLVGILVTLGGVSVFGVQFD
Ga0207679_1014541923300025945Corn RhizosphereMLGKTPLKYIGVAIAVAGAIVWNRAPNDLVLLAGILVTLGGVAVFGVQFD
Ga0207640_1182143223300025981Corn RhizosphereMLSKAPLKYIGLAIAVAGAIVWNRAPNDLVLLVGILVTLGGVSVFGVQFD
Ga0207675_10270520223300026118Switchgrass RhizosphereTPLKYIGLAIAVAGAIVWNRAPNDLVLLVGILVTLGGVAVFGVQFD
Ga0207683_1037843123300026121Miscanthus RhizosphereLKYIGIAIALAGAIVWNRAPNDLVLLVGILVTLGGVSVFGVQFD
Ga0207683_1173955513300026121Miscanthus RhizosphereNMLGKTPLKYIGFAIALVGAIVWNRAPNDLVLLIGILVTLGGVSVFGVQFD
Ga0207980_101142913300026894SoilMLGKTPLKYIGFAIALVGAIVWNRAPNDLVLLVGILVTLGGVSVFGVQFD
Ga0208995_100122633300027388Forest SoilMLGKTPLKYIGFAIAVVGAIVWNRAPNDLVLLVGILVTLGGVAVFGVQFD
Ga0207428_1033073513300027907Populus RhizosphereIGLAIAVAGAIVWNRAPNDLVLLVGILVTLGGVAVFGVQFD
Ga0209382_1014098523300027909Populus RhizosphereMLGKTPLKYIGLAIAVAGAIVWNRAPNDLVLLVGILVTLGGVAVFGVQFD
Ga0209382_1154975023300027909Populus RhizosphereMPGKTPLKYIGFAIAVVGAIVWNRAPNDLVLLVGILVTLGGVSVFGVQFD
Ga0268266_1013257733300028379Switchgrass RhizosphereMPGKTPLKYIGFAIAVVGAIVWNRAPNDLILLVGILLTLGGVSVFGVQFE
Ga0268265_1026581033300028380Switchgrass RhizosphereMLGKTPLKYIGLAIAVAGAIVWNRAPNDLVLLVGILVTLGGVSVFGVQFD
Ga0307285_1003562923300028712SoilMLGKTPLKYIGFAIAVVGAIVWNRAPNDLVLLVGILVTLGGVS
Ga0307280_1011044923300028768SoilMPGKTPLKYIGFAIAVVGAIVWNRAPNDLVLLVGILVTLGGVS
Ga0307292_1007019613300028811SoilYAIREDVPDMLGKTPLKYIGFAIAVVGAIVWNRAPNDLVLLVGILVTLGGVSVFGVQFD
Ga0307314_1019674523300028872SoilRGDPDMPGKTPLKYIGFAIAVVGAIVWNRAPNDLVLLVGILVTLGGVSVFGVQFD
Ga0307501_1028455923300031152SoilMLGKTPLKYIGFAIAVVGAIVWNRAPNDLVLLVGILVTLGG
Ga0307497_1040457913300031226SoilMLGKTPLKYIGFAIAVVGAIVWNRAPNVLVLLVGILVTLGGVSVFGVQFD
Ga0170818_11002099033300031474Forest SoilSKTPLKYIGLAIAVAGAIVWNRAPNDLVLLVGILVTLGGVSVFGVQFD
Ga0170818_11133299713300031474Forest SoilMLGKTPLKYIGFAIAVVGAIVWNRAPNDLVLLVGIL
Ga0310904_1032613523300031854SoilMLGKTPLKYIGFAIAVVGAIVWNRAPNDLILLVGILVTLGGVSVFGVQFD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.