| Basic Information | |
|---|---|
| Family ID | F103936 |
| Family Type | Metagenome |
| Number of Sequences | 101 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MLSFDDDITAAPTLPKPAPRTPETIRAQVAGGILSREPVHDLDV |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.03 % |
| % of genes from short scaffolds (< 2000 bps) | 94.06 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.050 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (9.901 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.584 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (44.554 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.50% β-sheet: 0.00% Coil/Unstructured: 87.50% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF10387 | DUF2442 | 93.07 |
| PF02867 | Ribonuc_red_lgC | 1.98 |
| PF07394 | DUF1501 | 0.99 |
| PF00501 | AMP-binding | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 1.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.05 % |
| Unclassified | root | N/A | 4.95 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001431|F14TB_105726620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 587 | Open in IMG/M |
| 3300003858|Ga0031656_10178149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 735 | Open in IMG/M |
| 3300003858|Ga0031656_10222006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 645 | Open in IMG/M |
| 3300003858|Ga0031656_10332655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300004282|Ga0066599_101339995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300005328|Ga0070676_11259114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 564 | Open in IMG/M |
| 3300005330|Ga0070690_101128536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 623 | Open in IMG/M |
| 3300005334|Ga0068869_100270611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1363 | Open in IMG/M |
| 3300005335|Ga0070666_11425731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300005355|Ga0070671_101983440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300005367|Ga0070667_100640898 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 981 | Open in IMG/M |
| 3300005468|Ga0070707_101354852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 678 | Open in IMG/M |
| 3300005507|Ga0074259_11731241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 731 | Open in IMG/M |
| 3300005543|Ga0070672_101347499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 638 | Open in IMG/M |
| 3300005552|Ga0066701_10894625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300005578|Ga0068854_100679978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 886 | Open in IMG/M |
| 3300005587|Ga0066654_10366480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 784 | Open in IMG/M |
| 3300005829|Ga0074479_10619012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 729 | Open in IMG/M |
| 3300005842|Ga0068858_100522296 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1148 | Open in IMG/M |
| 3300005843|Ga0068860_100773922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 972 | Open in IMG/M |
| 3300005844|Ga0068862_100134084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2193 | Open in IMG/M |
| 3300006163|Ga0070715_10869498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300006237|Ga0097621_100502602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1098 | Open in IMG/M |
| 3300006237|Ga0097621_101337177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 677 | Open in IMG/M |
| 3300006358|Ga0068871_101028458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 768 | Open in IMG/M |
| 3300006797|Ga0066659_10852368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 758 | Open in IMG/M |
| 3300006881|Ga0068865_100890711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 773 | Open in IMG/M |
| 3300007255|Ga0099791_10687325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 503 | Open in IMG/M |
| 3300009098|Ga0105245_12318027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 590 | Open in IMG/M |
| 3300009101|Ga0105247_10165651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1466 | Open in IMG/M |
| 3300009162|Ga0075423_10996021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 890 | Open in IMG/M |
| 3300009169|Ga0105097_10014602 | All Organisms → cellular organisms → Bacteria | 4094 | Open in IMG/M |
| 3300009551|Ga0105238_12733481 | Not Available | 530 | Open in IMG/M |
| 3300010043|Ga0126380_11106193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 676 | Open in IMG/M |
| 3300012469|Ga0150984_115093489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 941 | Open in IMG/M |
| 3300012502|Ga0157347_1051130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 570 | Open in IMG/M |
| 3300012519|Ga0157352_1034819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 686 | Open in IMG/M |
| 3300012532|Ga0137373_10271748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1359 | Open in IMG/M |
| 3300012960|Ga0164301_11336598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 583 | Open in IMG/M |
| 3300013296|Ga0157374_11406498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 720 | Open in IMG/M |
| 3300013297|Ga0157378_12042878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 623 | Open in IMG/M |
| 3300013307|Ga0157372_10285408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1919 | Open in IMG/M |
| 3300014261|Ga0075360_1015575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1018 | Open in IMG/M |
| 3300014321|Ga0075353_1198744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300014324|Ga0075352_1285404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300014325|Ga0163163_11273742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 797 | Open in IMG/M |
| 3300015372|Ga0132256_103801138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300015373|Ga0132257_101067576 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1018 | Open in IMG/M |
| 3300016319|Ga0182033_10104128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2094 | Open in IMG/M |
| 3300016422|Ga0182039_10999510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 750 | Open in IMG/M |
| 3300017947|Ga0187785_10134159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1025 | Open in IMG/M |
| 3300017974|Ga0187777_10009989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5993 | Open in IMG/M |
| 3300018084|Ga0184629_10629373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300018481|Ga0190271_10321851 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1616 | Open in IMG/M |
| 3300025907|Ga0207645_10779021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 650 | Open in IMG/M |
| 3300025921|Ga0207652_11860144 | Not Available | 507 | Open in IMG/M |
| 3300025930|Ga0207701_11288990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300025934|Ga0207686_10670548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 822 | Open in IMG/M |
| 3300025942|Ga0207689_10181285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1737 | Open in IMG/M |
| 3300025942|Ga0207689_10425229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1109 | Open in IMG/M |
| 3300025972|Ga0207668_10040220 | Not Available | 3153 | Open in IMG/M |
| 3300025985|Ga0210117_1088313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 551 | Open in IMG/M |
| 3300026116|Ga0207674_10989816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 810 | Open in IMG/M |
| 3300027842|Ga0209580_10125312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1254 | Open in IMG/M |
| 3300027871|Ga0209397_10266127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 811 | Open in IMG/M |
| 3300027890|Ga0209496_10824123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300027897|Ga0209254_10214304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1529 | Open in IMG/M |
| 3300028379|Ga0268266_10593636 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1063 | Open in IMG/M |
| 3300028379|Ga0268266_11798447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 587 | Open in IMG/M |
| 3300028739|Ga0302205_10186080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 532 | Open in IMG/M |
| 3300028800|Ga0265338_10817962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 638 | Open in IMG/M |
| 3300028804|Ga0268298_10108870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1636 | Open in IMG/M |
| 3300028861|Ga0302259_1159153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 562 | Open in IMG/M |
| 3300029923|Ga0311347_11025972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300029990|Ga0311336_11982195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300030838|Ga0311335_10778241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 676 | Open in IMG/M |
| 3300031231|Ga0170824_128833163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 573 | Open in IMG/M |
| 3300031232|Ga0302323_100900082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 978 | Open in IMG/M |
| 3300031232|Ga0302323_101799662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 693 | Open in IMG/M |
| 3300031521|Ga0311364_11332555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 711 | Open in IMG/M |
| 3300031521|Ga0311364_11648309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 632 | Open in IMG/M |
| 3300031562|Ga0310886_10839792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300031573|Ga0310915_11158825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300031726|Ga0302321_103439365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300031768|Ga0318509_10783565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300031835|Ga0318517_10226236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 844 | Open in IMG/M |
| 3300031997|Ga0315278_12211536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300032035|Ga0310911_10760731 | Not Available | 560 | Open in IMG/M |
| 3300032067|Ga0318524_10299210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 832 | Open in IMG/M |
| 3300032163|Ga0315281_11387754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 693 | Open in IMG/M |
| 3300032256|Ga0315271_10345941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1234 | Open in IMG/M |
| 3300032397|Ga0315287_12341152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 578 | Open in IMG/M |
| 3300033004|Ga0335084_10746040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 996 | Open in IMG/M |
| 3300033408|Ga0316605_10317080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1375 | Open in IMG/M |
| 3300033416|Ga0316622_100628280 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1237 | Open in IMG/M |
| 3300033418|Ga0316625_100684572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 856 | Open in IMG/M |
| 3300033418|Ga0316625_101797481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 594 | Open in IMG/M |
| 3300033480|Ga0316620_11158558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 757 | Open in IMG/M |
| 3300033521|Ga0316616_100719195 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1199 | Open in IMG/M |
| 3300034170|Ga0370487_0286138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 557 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 9.90% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.95% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 3.96% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.97% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 2.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.97% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.98% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.98% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.98% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.99% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.99% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.99% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.99% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.99% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.99% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.99% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.99% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.99% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.99% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.99% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.99% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.99% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.99% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Arabidopsis Rhizosphere | 0.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.99% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.99% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.99% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.99% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.99% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300003858 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI | Environmental | Open in IMG/M |
| 3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014261 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014321 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025985 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028804 | Activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt | Engineered | Open in IMG/M |
| 3300028861 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300034170 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TB_1057266201 | 3300001431 | Soil | MLTFEDDVVPAPKPRAARPTPETIRAQTEGSIASGILSREPVHDLDVERQ* |
| Ga0031656_101781491 | 3300003858 | Freshwater Lake Sediment | MLTFEDDLSPAPALPTHAATPDTIRAQGAGGILSREPVHDLDADRQQPS |
| Ga0031656_102220061 | 3300003858 | Freshwater Lake Sediment | MLNFDDDIAPAPQPRLHPGTPATLRAQASGSIGGGILAREPVHDMDADRQAMDTDL |
| Ga0031656_103326552 | 3300003858 | Freshwater Lake Sediment | MLTFEDDLSPAPALPAHAATPDTIRAQGAGGILSREPVHDLDV |
| Ga0066599_1013399952 | 3300004282 | Freshwater | MLNFDDDVVPAAQPRLMPSTPETLRAQAMGTIGGGILTREPVHDLDADRQ |
| Ga0070676_112591141 | 3300005328 | Miscanthus Rhizosphere | LQEMEKMLTFDDEPAPALPAKAPRTPETIRAQVLGGILSREPVH |
| Ga0070690_1011285361 | 3300005330 | Switchgrass Rhizosphere | MLSFDDDAPAPALAGRAPRTPETIRAQVLGGILSREPVHD |
| Ga0068869_1002706114 | 3300005334 | Miscanthus Rhizosphere | MLSFDDDIVPAPQPRAARSTPETIRAQAAGSIASGILSREPVHDLDVEKQ |
| Ga0070666_114257311 | 3300005335 | Switchgrass Rhizosphere | MSSRRTDNMLTFEDDLIAPAARPMMESVTPETIRAQGSGGILSREP |
| Ga0070671_1019834402 | 3300005355 | Switchgrass Rhizosphere | MLSFDDDIVPAPQPRAARSTPETIRAQAAGSIASGILSREPVHDL |
| Ga0070667_1006408981 | 3300005367 | Switchgrass Rhizosphere | MLSFDDDITAAPTLPKPAPRTPETIRAQVAGGILSREPVHDLDVENQ |
| Ga0070707_1013548521 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSFDDDFTAAAPKPIPPAPETIRAHVAGGILSRPLSNEPAHDPDAERQAMQNGF |
| Ga0074259_117312411 | 3300005507 | Arabidopsis Rhizosphere | MLNFDDDPVPAPQPRLALVTPETIRAQAAGGILSREPVHDL |
| Ga0070672_1013474992 | 3300005543 | Miscanthus Rhizosphere | MLSFDDDAPVPALAGRAPRTPETIRAQVLGGILSREPVHDIDVEQEAMPEN |
| Ga0066701_108946251 | 3300005552 | Soil | MLTFDDDFMTPAPQPRLQPVTPETIRAQAAGGILSREPVHDLD |
| Ga0068854_1006799783 | 3300005578 | Corn Rhizosphere | MLTFEDDFVTPAPQPRVLAATPETIRAQTTGGILSREPVHDLDVESQAMANG |
| Ga0066654_103664801 | 3300005587 | Soil | MLTFDDDFMTPAPQPRSQPLTAEAIRAQAAGGILSRE |
| Ga0074479_106190121 | 3300005829 | Sediment (Intertidal) | MLSFDDDVAPAPQLRIAPATPETIRAQAVGNIASGILSREPVHDL |
| Ga0068858_1005222961 | 3300005842 | Switchgrass Rhizosphere | MLSFDDDLAPAPAVPMAPPATPETIRAQVAGGILSREPVHDLDVEAQAMQNG |
| Ga0068860_1007739221 | 3300005843 | Switchgrass Rhizosphere | MLSFDDDLAPAPAVPMAPPATPETIRAQVAGGILSREPVHDLDVEAQ |
| Ga0068862_1001340841 | 3300005844 | Switchgrass Rhizosphere | MLTFDDEPAPALPPKGQRTPETIRAQVLGGILSREPVHDIDVEKE |
| Ga0070715_108694981 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSFDDDFPATPAQPRLAPRTPDTIRAQSMGSIGGGLLSQEPVHDIDVEKEAMP |
| Ga0097621_1005026021 | 3300006237 | Miscanthus Rhizosphere | MLTFEDDFHAPAAMPSLQPATPETILAQTSGGILSREPVHDLDV |
| Ga0097621_1013371772 | 3300006237 | Miscanthus Rhizosphere | MLSFDDDLAPAPAVPMAPPATPETIRAQVAGGILSREPVHDLDVEAQAMQNGFRRV |
| Ga0068871_1010284581 | 3300006358 | Miscanthus Rhizosphere | MLSFDDDIVPTAQPRAARSKPETIRAQAGAGIGSGILSPQLSR |
| Ga0066659_108523683 | 3300006797 | Soil | MLTFDDDFMTPAPQPRSQPLTAEAIRAQAAGGILSREPM |
| Ga0068865_1008907113 | 3300006881 | Miscanthus Rhizosphere | MLSFDDDIVPAAQPRAARSKPETIRAQAGAGIGSGILSPQLS |
| Ga0099791_106873251 | 3300007255 | Vadose Zone Soil | MLSFDDDFPATPAQPHLAPRTPETIRAQAMGSIGG |
| Ga0105245_123180272 | 3300009098 | Miscanthus Rhizosphere | MLSFDDDITAAPTLPKPAPRTPETIRAQVAGGILSREPVHDLDVENQAMANGFS |
| Ga0105247_101656513 | 3300009101 | Switchgrass Rhizosphere | MLSFDDDAPVPALAGRAPRTPETIRAQVLGGILSREPVHDIDVEQEAM |
| Ga0075423_109960213 | 3300009162 | Populus Rhizosphere | MLSFDDDFTAASAFPKAAPRTPETIRAQVAGQIAGGILSREP |
| Ga0113563_114014441 | 3300009167 | Freshwater Wetlands | MLTFEDDLSPAPALPAHAATPDTIRAQGAGGILSREPVHDLDADRQQPSTPTG |
| Ga0105097_100146024 | 3300009169 | Freshwater Sediment | MLTFEDDLSPAPGLPAHAATPDTIRAQGAGGILSREPVHDLDV |
| Ga0105238_127334812 | 3300009551 | Corn Rhizosphere | MLTFDDELPAAAVPKIAPMSPETIRAQVAGGIISREPVHDLDA |
| Ga0126380_111061932 | 3300010043 | Tropical Forest Soil | MLSFDDDIPTPQPRMPRATPETMRAQALGTIASGMLSREPVHDLDVEKQAME |
| Ga0150984_1150934891 | 3300012469 | Avena Fatua Rhizosphere | MLTFEDDFHAPSAKPSLQPATPETILAQTSGGILSREP |
| Ga0157347_10511302 | 3300012502 | Arabidopsis Rhizosphere | MLTFDDDVAPAPAPRLAPATPEALRAQGAGILASPEPVHDMDVERQALEN |
| Ga0157352_10348193 | 3300012519 | Unplanted Soil | MLNFDDDPVPAPQPRLALVTPETIRAQAAGGILSREPVHDLDVEQ |
| Ga0137373_102717481 | 3300012532 | Vadose Zone Soil | MLNFDDDLAPAAQPRLQPATPETIRAQAAGGILSREPVHDLDVER |
| Ga0164301_113365981 | 3300012960 | Soil | MLIFDDDIVPAPQPRAARSTPETIRAQAGGSIGSGILSRE |
| Ga0157374_114064982 | 3300013296 | Miscanthus Rhizosphere | MLTFEDDFVTPAPQPRVLPATPETIRAQTTGGILSREPVHDLDVESQAM |
| Ga0157378_120428782 | 3300013297 | Miscanthus Rhizosphere | MLSFDDDIVPTAQPRAARSKPETIRAQAGAGIGSGILSPQLSREPVHDLDV |
| Ga0157372_102854085 | 3300013307 | Corn Rhizosphere | MLTFDDELPAAALPKIAPMSPETIRAQVAGGIISREPVHDLDADRHASTPT |
| Ga0075360_10155753 | 3300014261 | Natural And Restored Wetlands | MLSFDDDFAAAPTAPAPAPRTPETIRAQVTGGILSCEPVHDIDTE |
| Ga0075353_11987442 | 3300014321 | Natural And Restored Wetlands | MLSFDDDIAPVPQPRMAPATPGTIRAQAVGNIASGTLSREPVHDL |
| Ga0075352_12854043 | 3300014324 | Natural And Restored Wetlands | MLTFDDDLAPAPQPRVAPVTPETIRAQTTGGILSREPVHD |
| Ga0163163_112737422 | 3300014325 | Switchgrass Rhizosphere | MLSFDDDVPAPALPGRAPRTPETIRAQVLGGILSREPV |
| Ga0132256_1038011381 | 3300015372 | Arabidopsis Rhizosphere | MLTFEDDFVTPPVQPRVAPRSPETILAQTTGGILSREPVHDLD |
| Ga0132257_1010675763 | 3300015373 | Arabidopsis Rhizosphere | MLSFDDDITAAPTLRKPAPRTPETIRAQVAGGILSREPVHDLDVE |
| Ga0182033_101041284 | 3300016319 | Soil | MQTLSFDDDIPTAKAPALAPRTPDTIRAQSVGTIGGGILWREPVHDLDV |
| Ga0182039_109995101 | 3300016422 | Soil | MLSFDDDIAPIPQPRVPRATPETIRAQAAGNIASGILSREPVHDLDVERQ |
| Ga0187785_101341591 | 3300017947 | Tropical Peatland | MLSFDDDIAPAPQPRVAKATPETIRAQAVGNIASGILSPHFSQEPVHDLG |
| Ga0187777_100099891 | 3300017974 | Tropical Peatland | MLTFEDDFVTPPTQPRVTPPSPETILAQTTGGILSREPVHDLDVEA |
| Ga0184629_106293732 | 3300018084 | Groundwater Sediment | MLSFDDDAPAPALPGRAPRTPETVRAQILGNIGGGILSREPVHDIDVE |
| Ga0190271_103218513 | 3300018481 | Soil | MLSFDDDFTAAPVLPKAAPRTPETIRAHVSGQIAGGILSREPVHDLDVE |
| Ga0207645_107790212 | 3300025907 | Miscanthus Rhizosphere | MLSFDDDITAAPTLPKPAPRTPETIRAQVAGGILSREPVHDLDV |
| Ga0207652_118601442 | 3300025921 | Corn Rhizosphere | MLTFDDELPAAAVPKIAPMSPETIRAQVAGGIISREP |
| Ga0207701_112889901 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MLNFDDDIAPAPPKHAPRTPETIRAQVTGGILSREPVHDLDVE |
| Ga0207686_106705481 | 3300025934 | Miscanthus Rhizosphere | MLSFDDDITAAPTLPKPAPRTPETIRAQVAGGILSREPVHDLDVEN |
| Ga0207689_101812854 | 3300025942 | Miscanthus Rhizosphere | MLSFDDDFAAAPTAPAPAPRTAETIRAQVLGSIGGGAMS |
| Ga0207689_104252291 | 3300025942 | Miscanthus Rhizosphere | MLSFDDDIVPAPQPRAARSTPESIRAQAAGNIASGILSREPVHDL |
| Ga0207668_100402205 | 3300025972 | Switchgrass Rhizosphere | MLSFDDDAPAPALAGRAPRTPETIRAQVLGGILSREPVHDIDV |
| Ga0210117_10883132 | 3300025985 | Natural And Restored Wetlands | MLTFDDDLAPAPQPRVAPVTPETIRAQTTGGILSREPVHDLDV |
| Ga0207674_109898161 | 3300026116 | Corn Rhizosphere | MLTFDDELPAAALPKIAPMSPETIRAQVAGGIISREPVHDLDA |
| Ga0209580_101253121 | 3300027842 | Surface Soil | MLSFDDDFTAAAPKPIPPAPETIRAHVAGGILSRPLSNEPAHDPDAERQA |
| Ga0209397_102661272 | 3300027871 | Wetland | MLTFEDDLSPAPALPAHAATPDTIRAQGAGGILSREPVHDLD |
| Ga0209496_108241232 | 3300027890 | Wetland | MLTFDDDIATPAPQPRLQPATPETIRAQGAGGILSREPVHDLDAEKQA |
| Ga0209254_102143041 | 3300027897 | Freshwater Lake Sediment | MLTFEDDLSPAPALPTHAATPDTIRAQGAGGILSREPVHDLDADRQQP |
| Ga0268266_105936363 | 3300028379 | Switchgrass Rhizosphere | MLSFDDDLAPAPAVPMAPPATPETIRAQVAGGILS |
| Ga0268266_117984471 | 3300028379 | Switchgrass Rhizosphere | MLNFDDDIAPAPPKLAPRTPETIRAQVTGGILSREPVHDLDVEAQAMQNNLS |
| Ga0302205_101860801 | 3300028739 | Fen | MLSFDDDFAATPNAPGLSPRTPETIRAQVTGGILSREPVHD |
| Ga0265338_108179622 | 3300028800 | Rhizosphere | MLNFDDDIAPAPQLRVAPATPETIRAQTTGGILSR |
| Ga0268298_101088704 | 3300028804 | Activated Sludge | MLNFDDDIAPAPQPRLMPATPETLRAQAAGGILSREPVHDLDADR |
| Ga0302259_11591531 | 3300028861 | Fen | MLSFDDDFAATPNAPGLSPRTPETIRAQVTGGILSREPVHDIDTEKEVNAE |
| Ga0311347_110259721 | 3300029923 | Fen | MLSFDDDFAATPTAPALAPRTPETIRAQVTGGILSREPVHDIDTEKEDTPEN |
| Ga0311336_119821951 | 3300029990 | Fen | MLNFDDDLAPAPQPRLALVTPETMLAQSMGGILSREPV |
| Ga0311335_107782411 | 3300030838 | Fen | MLSFDDDTPAPALPGRAPRTAETIRAQVLGGILSREPVHDIDVEK |
| Ga0170824_1288331631 | 3300031231 | Forest Soil | MLTFEDDFVTPAPQPRVLPATPETIRAQTTGGILSREPVHDLD |
| Ga0302323_1009000821 | 3300031232 | Fen | MLSFDDDFAATPTAPRAAPRTAETIRAQVMGTIGGGVMSHEPVHDLDVEKQAMPE |
| Ga0302323_1017996621 | 3300031232 | Fen | MLSFDDDFAATPNAPSLAPRTPETIRAQVTGGILS |
| Ga0311364_113325552 | 3300031521 | Fen | MLSFDDDTPAPALPGRAPRTAETIRAQVLGGILSREPVHDIDVEKEAMPEN |
| Ga0311364_116483091 | 3300031521 | Fen | MLNFDDDLAPAPQPRLALVTPETMLAQSMGGILSREPVHDLDVEQQAMAN |
| Ga0310886_108397921 | 3300031562 | Soil | MLNFDDDIAPAPPKHAPRTPETIRAQVTGGILSREPVHDLDVEAQAMQNNLSRV |
| Ga0310915_111588251 | 3300031573 | Soil | MLSFDDDIAPIPQPRVPRATPETMRAQALGQIASGILSREPVHDLDVEKQ |
| Ga0302321_1034393652 | 3300031726 | Fen | MLSFDDDFAPATQPRHAPPTPETIRAQTAGTIASGILSREPVHDLD |
| Ga0318509_107835651 | 3300031768 | Soil | MLTFEDDFVTPPVQPRAAPQSPETILAQTTGGILSREP |
| Ga0318517_102262361 | 3300031835 | Soil | MLSFDDDIPAPQPRVPRATPETIRAQAAGNIASGILSREPVHDLDVERQAM |
| Ga0315278_122115361 | 3300031997 | Sediment | MLSFDDDIIAPAPRPRIAPPTPETIRAQGAGSIASGILSREPVHDLEV |
| Ga0310911_107607312 | 3300032035 | Soil | MQTLSFDDDIPTAKAPALAPRTPDTIRAQSVGTIGGGILWREPVHDLDVERQ |
| Ga0318524_102992101 | 3300032067 | Soil | MLSFDDDIAPIPQPRVPRATPETIRAQAAGNIASGILSREPVHDLD |
| Ga0315281_113877542 | 3300032163 | Sediment | MLSFDDDIIAPAPQPRIAPPTPATIRAQGAGSIASGLLSREPVHDLDV |
| Ga0315271_103459411 | 3300032256 | Sediment | MLTFEDDFVAPATKPMLQPATPETIRAQTAGGILSREPVH |
| Ga0315287_123411521 | 3300032397 | Sediment | MLSFDDDFAATPTAPGLSPRTPETIRAQVAGGILSR |
| Ga0335084_107460402 | 3300033004 | Soil | MLTFEDDIPAPTVPPLAPRTAETIRAQVTGGILSREPVHD |
| Ga0316605_103170804 | 3300033408 | Soil | MLTFEDDFAAPAAQPLLQPATPETIRAQATGGILSREPVHDLDV |
| Ga0316622_1006282803 | 3300033416 | Soil | MLSFDDDIATPAPQPRLQPATPETLRAQTAGGILSR |
| Ga0316625_1006845721 | 3300033418 | Soil | MLTFEDDLSPAPALPAHAATPDTIRAQGAGGILSREP |
| Ga0316625_1017974812 | 3300033418 | Soil | MLTFEDDLSPAPALPAHAITPDTIRAQGAGGILSREPVHDLDADRQQPS |
| Ga0316620_111585581 | 3300033480 | Soil | MLTFDDDIAPAPQPRVAPATPETILAQTAGGILSREPVHDLDVERQA |
| Ga0316616_1007191951 | 3300033521 | Soil | MLNFDDDIVTPAAQPQLQPVTPDTIRAQASGSIGGGILSREPVHDLEVE |
| Ga0370487_0286138_2_145 | 3300034170 | Untreated Peat Soil | MLSFDDDFAATPTAPALAPRTPETIRAQVTGGILSREPVHDIDTEKEV |
| ⦗Top⦘ |