| Basic Information | |
|---|---|
| Family ID | F103929 |
| Family Type | Metagenome |
| Number of Sequences | 101 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MPQEVSISYQAVKSKVYKLIDALVEGSKTESEVQESMRRWWQLI |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 25.74 % |
| % of genes from short scaffolds (< 2000 bps) | 23.76 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (75.248 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (16.832 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.713 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.495 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.06% β-sheet: 0.00% Coil/Unstructured: 56.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF00255 | GSHPx | 28.71 |
| PF02517 | Rce1-like | 3.96 |
| PF08241 | Methyltransf_11 | 0.99 |
| PF02646 | RmuC | 0.99 |
| PF00120 | Gln-synt_C | 0.99 |
| PF13437 | HlyD_3 | 0.99 |
| PF14437 | MafB19-deam | 0.99 |
| PF13524 | Glyco_trans_1_2 | 0.99 |
| PF01425 | Amidase | 0.99 |
| PF04542 | Sigma70_r2 | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG0386 | Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxides | Defense mechanisms [V] | 28.71 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 3.96 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 3.96 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.99 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.99 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.99 |
| COG1322 | DNA anti-recombination protein (rearrangement mutator) RmuC | Replication, recombination and repair [L] | 0.99 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.99 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 75.25 % |
| All Organisms | root | All Organisms | 24.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005175|Ga0066673_10224970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1079 | Open in IMG/M |
| 3300005180|Ga0066685_11051840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300005446|Ga0066686_10312485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1069 | Open in IMG/M |
| 3300005566|Ga0066693_10447210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300006800|Ga0066660_10972541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
| 3300009177|Ga0105248_12601068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300010376|Ga0126381_100894845 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300010376|Ga0126381_103667162 | Not Available | 601 | Open in IMG/M |
| 3300012198|Ga0137364_10245177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1323 | Open in IMG/M |
| 3300012285|Ga0137370_10413989 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300017972|Ga0187781_10188870 | All Organisms → cellular organisms → Bacteria | 1452 | Open in IMG/M |
| 3300020579|Ga0210407_10952888 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300021560|Ga0126371_12829795 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300025933|Ga0207706_11094549 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300025940|Ga0207691_10230577 | All Organisms → cellular organisms → Bacteria | 1604 | Open in IMG/M |
| 3300025941|Ga0207711_11954481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300025986|Ga0207658_11941584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300026309|Ga0209055_1114141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1045 | Open in IMG/M |
| 3300027660|Ga0209736_1014038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2532 | Open in IMG/M |
| 3300027829|Ga0209773_10137371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1016 | Open in IMG/M |
| 3300027869|Ga0209579_10170930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1161 | Open in IMG/M |
| 3300031720|Ga0307469_10036988 | All Organisms → cellular organisms → Bacteria | 2916 | Open in IMG/M |
| 3300031720|Ga0307469_10930610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 807 | Open in IMG/M |
| 3300031720|Ga0307469_11091299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
| 3300033158|Ga0335077_12098514 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300033808|Ga0314867_094626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 16.83% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.94% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.97% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.98% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.98% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.98% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.99% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.99% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.99% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.99% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.99% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.99% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.99% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.99% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.99% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.99% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.99% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.99% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300020012 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300023072 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6 | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deepsgr_00306060 | 2199352025 | Soil | MPQEVSISYQAVKSKVYKLVDAMVEGDKNTVEVQESIRRWWKLIHPSD |
| Ga0062594_1013294491 | 3300005093 | Soil | MPQEVSISYQAVKSKVYKLIDAMVEGEKSPAEIQESMHRWWALVHPAD |
| Ga0066677_107812902 | 3300005171 | Soil | MNQEISISYRAVKSKIYKLIDALVEGEKDEVEVQESIQRW |
| Ga0066680_109100021 | 3300005174 | Soil | MGQEVSISLQAVKTKVYKLIDALIEGAKTETEVQESIRRWWKLIHPA |
| Ga0066673_102249701 | 3300005175 | Soil | MPQEISISYQAVKSKVYRLIDAMVEGSKTESEVRESMRRWWMLIHPADRPVAEKYL |
| Ga0066679_102219283 | 3300005176 | Soil | MNCGKGRRMNQEISISYRAVKSKIYKLIDALVEGEKDEAEV |
| Ga0066685_110518401 | 3300005180 | Soil | MPQEISISYQAVKSKVYRLIDAMVEGSKTESEVRESMRRWWMLIHPADRPVAEK |
| Ga0070690_1006507231 | 3300005330 | Switchgrass Rhizosphere | MPQEVSISYQAVKSKVYKLVDAMAEGDKNSVEVQESIRRWWKLIHPSDRAV |
| Ga0070674_1011502831 | 3300005356 | Miscanthus Rhizosphere | MPQEVSISYQAVKSKVYKLVDAMVEGDKNSLEVQESIRRWWKLIHPSDRAVAQ |
| Ga0066686_103124852 | 3300005446 | Soil | MGQEVSVSLQAVKTKVYKLIDALIEGAKTEAEVQESIRRWW |
| Ga0070706_1004410451 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MPQEISISYQAVKSKVYRLIDAMVEGSKTESEVRESMRRWWMLIHPADR |
| Ga0070699_1012837841 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MGQEVSVSLQAVKTKVYKLIDALIEGAKTEAEVQESIRRWWKL |
| Ga0070731_108803012 | 3300005538 | Surface Soil | MPQEISVSYQAVKSKVYKLIDAAVEGEKTDQQIRESLARWWKL |
| Ga0070665_1017204612 | 3300005548 | Switchgrass Rhizosphere | MGQEVSISYQAVKSRVYRLIDALVEGAKTEEDVQESVR |
| Ga0066699_108843242 | 3300005561 | Soil | MGQEVSISLQAVKTKVYKLIDALIEGAKTETEVQESIR |
| Ga0066693_104472101 | 3300005566 | Soil | MPQEISISYQAVKSKVYRLIDAVVEGSKTESEVRESMRRWWMLIHPADRPVAEK |
| Ga0066702_103440301 | 3300005575 | Soil | MNQEISISYRAVKSKIYKLIDALEEGEKDEAEVQESIRRWWK |
| Ga0066651_101491733 | 3300006031 | Soil | MPQEISISYQAVKSKVYRLIDAMVEGSKTESEVRESMRRWW |
| Ga0066696_108576711 | 3300006032 | Soil | MPQEISISYQAVKSKVYRLIDAMVEGSKTESEVRESMRRWWML |
| Ga0066656_102532894 | 3300006034 | Soil | MNQEISISYRAVKSKIYKLIDALVEGEKNEAEVQESIQRW |
| Ga0066656_105533221 | 3300006034 | Soil | MPQEISISYQAVKSKVYRLIDAMVEGSKTESEVRESMRRWWMLIHPAD |
| Ga0070715_109836301 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MPQEVSISYQAVKSKVYKLVDAMVEGDKNPVEVQESIRRWWKLIHP |
| Ga0070716_1001920913 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MGQEISVSYQAVKSKVYKLIDALVEGSKTPAEVQLSIQRWW* |
| Ga0070765_1021212592 | 3300006176 | Soil | MPQEVSISYQAVKSKVYKLIDALVEGSKTESEVQESMRRWWQLI |
| Ga0066665_108680902 | 3300006796 | Soil | MPQEISISYQAVKSKVYRLIDAMVEGSKTESEVRESMRRWWMLI |
| Ga0066660_109725411 | 3300006800 | Soil | MNQEISISYRAVKSKIYKLIDALVEGEKNEAEVQESIQRWWKMVRPDDRAVAEKYL |
| Ga0066660_112104342 | 3300006800 | Soil | MNQEISISYRAVKSKIYKLIDALVEGEKDEAEVQESIQRWWKMVRPD |
| Ga0079221_100978421 | 3300006804 | Agricultural Soil | MNQEISISYRAVKSKIYKLIDALVEGEKNEAEVQESIRRWWKMVR |
| Ga0073928_101099751 | 3300006893 | Iron-Sulfur Acid Spring | MNQEISISYRAVKSKIYKLIDALVEGEKDEAEVRESIQRWWKMV |
| Ga0075424_1005812181 | 3300006904 | Populus Rhizosphere | MPQEVSISYQAVKSKVYKLIDAMVEGEKSPVEVQESMQRWW |
| Ga0099829_101619661 | 3300009038 | Vadose Zone Soil | MPQEISISYQAVKSKVYRLIDAMVEGSKTESEVRE |
| Ga0099828_105185461 | 3300009089 | Vadose Zone Soil | MPQEVSISYQAVKSKVYKLVDAMVEGDKTTIEVQESIRRWWNLIHPS |
| Ga0099827_104554081 | 3300009090 | Vadose Zone Soil | MPQEISISYQAVKSKVYRLIDAMVEGSKTETEVRESMRRWWM |
| Ga0099792_110229402 | 3300009143 | Vadose Zone Soil | MPQEVSISYQAVKSKVYKLVDAMVEGDKNPVEVQESIRRWWKLIH |
| Ga0105248_126010682 | 3300009177 | Switchgrass Rhizosphere | MGQEVSVSYQAVKSRVYRLIDSLVEGAKTEQEIQESMQRWWKLVHP |
| Ga0105237_125137222 | 3300009545 | Corn Rhizosphere | MGQEVSISYQAVKSRVYRLIDALVEGAKTEEDVQESVRRWWKL |
| Ga0105249_110172422 | 3300009553 | Switchgrass Rhizosphere | MPQEVSISYQAVKSKVYKLVDAMVEGDKNTVEVQESIRRWWKLIHPS |
| Ga0116217_106988132 | 3300009700 | Peatlands Soil | MGQEVSISYQAVKSKVYKLIDALVEDMKTEGDVQESMKR |
| Ga0126380_115674101 | 3300010043 | Tropical Forest Soil | MPQEVSISYQAVKSKVYKLIDAMVEGEKSPLEVQESMQRWW |
| Ga0126381_1008948452 | 3300010376 | Tropical Forest Soil | MGQDVSVSYQAVKSRVYRLIDSLAEDGKTTNDVKDSLK |
| Ga0126381_1036671622 | 3300010376 | Tropical Forest Soil | MAQSVSVSYQAVKSRVYRLIDSLAEDKKTTNDVKDS |
| Ga0134126_118301241 | 3300010396 | Terrestrial Soil | MNQEISISYRAVKSKIYKLIDALVEGEKSEAEVQESIRRWWKMVR |
| Ga0134121_109332611 | 3300010401 | Terrestrial Soil | MPQEVSISYQAVKSKVYKLVDAMVEGDKNSAEVQESIRR |
| Ga0137388_113245741 | 3300012189 | Vadose Zone Soil | MPQEVSISYQAVKSKVYKLIDAMVEGEKTEAEVQESMRRWWALIHPSDRPV |
| Ga0137364_102451772 | 3300012198 | Vadose Zone Soil | MPQEISISYQAVKSKVYRLIDAMVEGSKTESEVRESMRRWWMLIHPADRPVA |
| Ga0137383_112285402 | 3300012199 | Vadose Zone Soil | MGQEVSISLQAVKTKVYKLIDALIEGAKTEAEVQESIRRWWKLI |
| Ga0137381_113511481 | 3300012207 | Vadose Zone Soil | MPQEISISYQAVKSKVYRLIDAMVEGSKTESEVRESMRRWWMLIHPA |
| Ga0137376_107887882 | 3300012208 | Vadose Zone Soil | MPQEISISYQAVKSKVYKLVDAMVEGEKTPMEVQESMRRWWS |
| Ga0150985_1156926151 | 3300012212 | Avena Fatua Rhizosphere | MAQEISISQQAVKGRIYKLIDAMVEGTKTEFEIQESIIRWWGL |
| Ga0137370_104139891 | 3300012285 | Vadose Zone Soil | MGQEISVSLQAVKTKVYKLIDALIEGAKTEAEVQESIRRWW |
| Ga0137407_104918022 | 3300012930 | Vadose Zone Soil | MPQEVSISYQAVKSKVYKLVDAMVEGDKNPVEVQE |
| Ga0137407_112422801 | 3300012930 | Vadose Zone Soil | MPQEISISYQAVKSKVYRLIDAMVEGSKTESEVRESMRRWWMLIH |
| Ga0164309_101093713 | 3300012984 | Soil | MPQEVSISYQAVKSKVYKLVDAMVEGDKNSVEVQESI |
| Ga0164305_116185921 | 3300012989 | Soil | MPQEVSISYQAVKSKVYKLVDAMVEGDKNSVEVQESIRRWWKLIHPSDRAVA |
| Ga0137412_109738891 | 3300015242 | Vadose Zone Soil | MPQEVSISYQAVKSKVYKLVDAMVEGDKNPVEVQESIRHWWKL |
| Ga0134083_103786311 | 3300017659 | Grasslands Soil | MPQEISISYQAVKSKVYRLIDAMVEGSKTESEVRESMRRWWMLIHPADRP |
| Ga0187779_106987681 | 3300017959 | Tropical Peatland | MSQEISVSYQAIKSKVYKLIDAAVEGEKTDAQIQESMQRWWKLVHPADRI |
| Ga0187783_102519171 | 3300017970 | Tropical Peatland | MPQEISVSYQAIKSKVYKLIDAAVEGEKSEQQIRESMQR |
| Ga0187781_101888703 | 3300017972 | Tropical Peatland | MSQEISVSYQAIKSKVYKLIDAAVEGEKTEAQVQESLERWWKLVHPSD |
| Ga0187777_101595851 | 3300017974 | Tropical Peatland | MPQEISVSYQAVKSKVYKLIDAAVEGEKSEQQIRESMQRWWKLIHPADRVV |
| Ga0184605_101966272 | 3300018027 | Groundwater Sediment | MPQEVSISYQAVKSKVYKLVDAMVEGDKNTAEVQESIRRWWSLIH |
| Ga0187788_104383052 | 3300018032 | Tropical Peatland | MPQEVSISYQAVKSKVYKLVDAMVEGDKNTLEVQE |
| Ga0187859_106278652 | 3300018047 | Peatland | MGQEVSVSYQAVKSKVYKLIDAMVEDMKNQGDVQESM |
| Ga0187766_113366991 | 3300018058 | Tropical Peatland | MGQEISISYQAVKSKVYRLIDALVEGSKTEIEVQES |
| Ga0193747_10682502 | 3300019885 | Soil | MPQEVSISYQAVKSKVYKLVDAMVEGDKNSAEVQESIRRWWSLI |
| Ga0193732_10293252 | 3300020012 | Soil | MPQEVSISYQAVKSKVYKLVDAMVEGDKNTIEVQESIRR |
| Ga0210407_109528883 | 3300020579 | Soil | VPQEISVSYRAIKSRIYRLIDAMVVGEKTGAEVQESIRRWWILVHPADRPIA |
| Ga0210406_109148852 | 3300021168 | Soil | MPQEVSISYQAVKSKVYKLVDAMVEGDKNPVEVQESIRRWW |
| Ga0210410_103677553 | 3300021479 | Soil | MPQEVSISYQAVKSKVYKLIDALVEGSKTESEVQESM |
| Ga0126371_128297952 | 3300021560 | Tropical Forest Soil | MGQEVSVSYQAVKSRVYRLIDSLVEGAKTEQEIQESMQRWW |
| Ga0247799_10549712 | 3300023072 | Soil | MPQEVSISYQAVKSKVYKLVDAMVEGDKNSLEVQE |
| Ga0207680_109128112 | 3300025903 | Switchgrass Rhizosphere | MPQEVSISYQAVKSKVYKLVDAMVEGDKNSLEVQES |
| Ga0207664_118993222 | 3300025929 | Agricultural Soil | MNQEISISYRAVKSKIYKLIDALVEGEKNEAEVQESIRRWWKMVRPDDRAVAE |
| Ga0207706_110945491 | 3300025933 | Corn Rhizosphere | MGQEVSVSYQAVKSRVYRLIDSLVEGAKTEQEVQESMQRWWKLVHP |
| Ga0207691_102305772 | 3300025940 | Miscanthus Rhizosphere | MGQEVSVSYQAVKSRVYRLIDSLVEGAKTEQEVQESMQRWWKLV |
| Ga0207711_119544812 | 3300025941 | Switchgrass Rhizosphere | MGQEVSVSYQAVKSRVYRLIDSLVEGAKTEQEIKESMQRW |
| Ga0207658_119415841 | 3300025986 | Switchgrass Rhizosphere | MPQEVSISYQAVKSKVYKLVDAMVEGDKNPVEVQESIRRWWKLIHPSDRAVAQKYLLMV |
| Ga0209055_11141411 | 3300026309 | Soil | MGQEVSISLQAVKTKVYKLIDALIEGAKTETEVQESIRRWWKLIHPADRAVAQ |
| Ga0209470_12616532 | 3300026324 | Soil | MPQEISISYQAVKSKVYRLIDAMVEGSKTESEVRES |
| Ga0257180_10315682 | 3300026354 | Soil | MPQEVSISYQAVKSKVYKLVDAVVEGDKNTIEVQESIRRWWKLIHPSD |
| Ga0209806_10941632 | 3300026529 | Soil | MPQEISISYQAVKSKVYRLIDAMVEGSKTESEVRESMRRWWMLIHPADRPV |
| Ga0209331_11331131 | 3300027603 | Forest Soil | MPQEVSISYQAVKSKVYKLVDAMVEGEKSPTEVQESIRRWWSLIHPC |
| Ga0209736_10140381 | 3300027660 | Forest Soil | MPQEVSISYQAVKSKVYKLVDAMVEGDKNPVEVQESIRRWWKLIHPSDRAVAQ |
| Ga0209073_104317682 | 3300027765 | Agricultural Soil | MNQEISISYRAVKSKIYKLIDALVEGEKNEAEVQESIRRWWKMVRPDDRA |
| Ga0209773_101373711 | 3300027829 | Bog Forest Soil | MSQEISVSYQAVKSKVHKLIDAAVEGEKTDAQIRNS |
| Ga0209701_104142761 | 3300027862 | Vadose Zone Soil | MPQEVSISYQAVKSKVYKLVDAMVEGDKNQVEVQESIRRWWKLIHPSD |
| Ga0209579_101709301 | 3300027869 | Surface Soil | MPQEVSISYQAVKSKVYKLVDAMVEGDKSPLEVQESIRRWWKLIHPSDRAVAQKY |
| Ga0209488_101332633 | 3300027903 | Vadose Zone Soil | MPQEVSISYQAVKSKVYKLVDAMVEGDKNPVEVQESIRRW |
| Ga0209583_102796242 | 3300027910 | Watersheds | MPQEVSISYQAVKSKVYKLVDAMVEGDKNTIEVQESIRRWWKLIHPSDRAV |
| Ga0209526_101672631 | 3300028047 | Forest Soil | MPQEVSISYQAVKSKVYKLVDAMVEGDKNTIEVQE |
| Ga0170818_1066217932 | 3300031474 | Forest Soil | MGQEISVSYQAVKSKVYKLIDALVEDAKTEGDVQESVK |
| Ga0307469_100369884 | 3300031720 | Hardwood Forest Soil | MPQEVSISYQAVKSKVYKLVDAMVEGDKNPVEVQESIRRWWKLIHPSDRAV |
| Ga0307469_109306101 | 3300031720 | Hardwood Forest Soil | MPQEVSISYQAVKSKVYKLVDAMVEGDKNPVEVQESIRRWWNLIHPSDRAVAQKYL |
| Ga0307469_110912992 | 3300031720 | Hardwood Forest Soil | MGQEISVSLQAVKTKVYKLIDALIEGAKTEAEVQESVRRWWKL |
| Ga0307475_106347762 | 3300031754 | Hardwood Forest Soil | MGQEVSISYQAVKSKVYKLIDALVEDAKTRGDVQDSVKRWWKLVHPADR |
| Ga0318533_114311931 | 3300032059 | Soil | MPQEVSVSYQAVKSKVYKLIDAAVEGEKSEQQIRESMQRWWK |
| Ga0307471_1011454593 | 3300032180 | Hardwood Forest Soil | MPQEISISYQAVKSKVYRLIDAMVEGSKTESEVRESMRRWWM |
| Ga0307471_1043141281 | 3300032180 | Hardwood Forest Soil | MGQEVSISLQAVKTKVFKLIDALIEGAKTEAEVQESIRRWWKLIHPADRAV |
| Ga0335077_120985142 | 3300033158 | Soil | MGQEVSVSYQAVKSRVYRLIDSLVEGAKTEQDIQDSMK |
| Ga0316624_115498391 | 3300033486 | Soil | MPQEVSISYQAVKSKVYKLVDAMVEGDKNSLEVQESIRRWWKLIHPSDR |
| Ga0314867_094626_3_125 | 3300033808 | Peatland | MSQEISVSYQAIKSKVYRLIDAAVEGEKTEAQIQQSMQRWW |
| ⦗Top⦘ |