NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F103902

Metagenome / Metatranscriptome Family F103902

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F103902
Family Type Metagenome / Metatranscriptome
Number of Sequences 101
Average Sequence Length 96 residues
Representative Sequence MGKVEDVTGEELKPGDFVTVQGWKGLEIAKVRRFTSSCMLCDYTFVHIDGTLIPSRLQPYLPNHSNTASNEAYPNRMLKVLKITEEQYERFKQNL
Number of Associated Samples 89
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 28.71 %
% of genes from short scaffolds (< 2000 bps) 63.37 %
Associated GOLD sequencing projects 71
AlphaFold2 3D model prediction Yes
3D model pTM-score0.82

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (46.535 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(37.624 % of family members)
Environment Ontology (ENVO) Unclassified
(90.099 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(84.158 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 8.13%    β-sheet: 31.71%    Coil/Unstructured: 60.16%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.82
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
b.34.12.0: automated matchesd4kuia_4kui0.56536
b.42.4.1: Kunitz (STI) inhibitorsd1avwb_1avw0.54429
b.34.12.1: BAH domaind3pt9a13pt90.54331
b.42.4.1: Kunitz (STI) inhibitorsd3bx1c_3bx10.53926
b.172.1.1: YopX-liked2p84a12p840.53752


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF04851ResIII 53.47
PF00476DNA_pol_A 32.67
PF01612DNA_pol_A_exo1 8.91
PF08291Peptidase_M15_3 0.99
PF03796DnaB_C 0.99
PF12684DUF3799 0.99
PF06067DUF932 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG0749DNA polymerase I, 3'-5' exonuclease and polymerase domainsReplication, recombination and repair [L] 32.67
COG0305Replicative DNA helicaseReplication, recombination and repair [L] 0.99
COG1066DNA repair protein RadA/Sms, contains AAA+ ATPase domainReplication, recombination and repair [L] 0.99


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms65.35 %
UnclassifiedrootN/A34.65 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000929|NpDRAFT_10118336All Organisms → cellular organisms → Bacteria1083Open in IMG/M
3300001450|JGI24006J15134_10007813All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes5398Open in IMG/M
3300001450|JGI24006J15134_10078363All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1244Open in IMG/M
3300002760|JGI25136J39404_1021461Not Available1171Open in IMG/M
3300006164|Ga0075441_10065279All Organisms → Viruses → Predicted Viral1424Open in IMG/M
3300006352|Ga0075448_10001004All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium9725Open in IMG/M
3300006738|Ga0098035_1007112All Organisms → cellular organisms → Bacteria4760Open in IMG/M
3300006750|Ga0098058_1024158Not Available1775Open in IMG/M
3300006752|Ga0098048_1108633Not Available837Open in IMG/M
3300006754|Ga0098044_1008468All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4896Open in IMG/M
3300006789|Ga0098054_1114188All Organisms → Viruses → Predicted Viral1007Open in IMG/M
3300006793|Ga0098055_1044602Not Available1803Open in IMG/M
3300006793|Ga0098055_1155686Not Available878Open in IMG/M
3300006810|Ga0070754_10011258All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium5596Open in IMG/M
3300006921|Ga0098060_1009974Not Available3113Open in IMG/M
3300006922|Ga0098045_1023160All Organisms → Viruses → Predicted Viral1642Open in IMG/M
3300006922|Ga0098045_1154197All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes527Open in IMG/M
3300006924|Ga0098051_1031817All Organisms → Viruses → Predicted Viral1492Open in IMG/M
3300006924|Ga0098051_1051693All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium1135Open in IMG/M
3300006926|Ga0098057_1015956Not Available1907Open in IMG/M
3300006929|Ga0098036_1051815All Organisms → cellular organisms → Bacteria1275Open in IMG/M
3300007276|Ga0070747_1228270Not Available650Open in IMG/M
3300007345|Ga0070752_1002613All Organisms → cellular organisms → Bacteria → FCB group11503Open in IMG/M
3300007540|Ga0099847_1107328Not Available847Open in IMG/M
3300007555|Ga0102817_1075472Not Available738Open in IMG/M
3300007963|Ga0110931_1116225All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes805Open in IMG/M
3300008050|Ga0098052_1023143All Organisms → Viruses → Predicted Viral2923Open in IMG/M
3300009002|Ga0102810_1001127All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes9963Open in IMG/M
3300009026|Ga0102829_1001255All Organisms → cellular organisms → Bacteria → FCB group7109Open in IMG/M
3300009436|Ga0115008_10050294All Organisms → Viruses → Predicted Viral3230Open in IMG/M
3300009613|Ga0105228_111953All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes870Open in IMG/M
3300009619|Ga0105236_1000185All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes7605Open in IMG/M
3300009622|Ga0105173_1029161All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300010151|Ga0098061_1027574Not Available2298Open in IMG/M
3300010151|Ga0098061_1318935Not Available532Open in IMG/M
3300010153|Ga0098059_1043745Not Available1807Open in IMG/M
3300010153|Ga0098059_1170654All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → unclassified Prolixibacteraceae → Prolixibacteraceae bacterium853Open in IMG/M
3300010155|Ga0098047_10021839Not Available2572Open in IMG/M
3300010883|Ga0133547_10464311All Organisms → Viruses → Predicted Viral2568Open in IMG/M
3300013010|Ga0129327_10186201All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1044Open in IMG/M
3300017703|Ga0181367_1009784Not Available1766Open in IMG/M
3300017718|Ga0181375_1003597All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2838Open in IMG/M
3300017730|Ga0181417_1109968All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes666Open in IMG/M
3300017731|Ga0181416_1138358All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes586Open in IMG/M
3300017739|Ga0181433_1141025All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes570Open in IMG/M
3300017748|Ga0181393_1164057Not Available549Open in IMG/M
3300017749|Ga0181392_1026812Not Available1822Open in IMG/M
3300017750|Ga0181405_1013295All Organisms → Viruses → Predicted Viral2336Open in IMG/M
3300017759|Ga0181414_1127531Not Available667Open in IMG/M
3300017765|Ga0181413_1051963All Organisms → Viruses → Predicted Viral1269Open in IMG/M
3300017767|Ga0181406_1040712All Organisms → Viruses → Predicted Viral1446Open in IMG/M
3300017770|Ga0187217_1008886All Organisms → Viruses → Predicted Viral3719Open in IMG/M
3300017775|Ga0181432_1029442Not Available1465Open in IMG/M
3300017776|Ga0181394_1045418All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1493Open in IMG/M
3300017776|Ga0181394_1109724Not Available876Open in IMG/M
3300017779|Ga0181395_1006508All Organisms → cellular organisms → Bacteria → Proteobacteria4286Open in IMG/M
3300017786|Ga0181424_10349133Not Available608Open in IMG/M
3300017786|Ga0181424_10396179Not Available562Open in IMG/M
3300020438|Ga0211576_10399935All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes703Open in IMG/M
3300021342|Ga0206691_1330988Not Available955Open in IMG/M
3300021443|Ga0206681_10011459All Organisms → Viruses → Predicted Viral3431Open in IMG/M
3300021443|Ga0206681_10194991All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes791Open in IMG/M
3300021957|Ga0222717_10058254All Organisms → Viruses → Predicted Viral2486Open in IMG/M
3300022164|Ga0212022_1017358All Organisms → Viruses → Predicted Viral1060Open in IMG/M
3300022178|Ga0196887_1048386All Organisms → Viruses → Predicted Viral1094Open in IMG/M
(restricted) 3300023109|Ga0233432_10421946All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes578Open in IMG/M
3300025066|Ga0208012_1006746All Organisms → Viruses → Predicted Viral2204Open in IMG/M
3300025097|Ga0208010_1009282All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2604Open in IMG/M
3300025099|Ga0208669_1000079All Organisms → cellular organisms → Bacteria39992Open in IMG/M
3300025108|Ga0208793_1022309All Organisms → Viruses → Predicted Viral2208Open in IMG/M
3300025125|Ga0209644_1075322All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes788Open in IMG/M
3300025168|Ga0209337_1023897All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3502Open in IMG/M
3300025168|Ga0209337_1093886All Organisms → Viruses → Predicted Viral1417Open in IMG/M
3300025248|Ga0207904_1030332All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes987Open in IMG/M
3300025543|Ga0208303_1087477Not Available679Open in IMG/M
3300025652|Ga0208134_1000104Not Available48852Open in IMG/M
3300025873|Ga0209757_10014004All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2170Open in IMG/M
3300025873|Ga0209757_10161156Not Available705Open in IMG/M
3300026103|Ga0208451_1011216All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300026115|Ga0208560_1000475All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4191Open in IMG/M
3300026115|Ga0208560_1001296All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2215Open in IMG/M
3300027159|Ga0208020_1046969All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes811Open in IMG/M
3300027320|Ga0208923_1082629Not Available569Open in IMG/M
3300027686|Ga0209071_1002397All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium7024Open in IMG/M
3300027714|Ga0209815_1206967All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes604Open in IMG/M
3300027833|Ga0209092_10059099All Organisms → Viruses → Predicted Viral2350Open in IMG/M
3300031140|Ga0308024_1009543All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2969Open in IMG/M
3300031141|Ga0308021_10345246Not Available549Open in IMG/M
3300031142|Ga0308022_1096722Not Available884Open in IMG/M
3300031143|Ga0308025_1090301Not Available1134Open in IMG/M
3300031167|Ga0308023_1003570All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3749Open in IMG/M
3300031628|Ga0308014_1053019Not Available996Open in IMG/M
3300031630|Ga0308004_10060402Not Available1647Open in IMG/M
3300031647|Ga0308012_10426228Not Available516Open in IMG/M
3300031658|Ga0307984_1014742All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2742Open in IMG/M
3300031688|Ga0308011_10113799Not Available827Open in IMG/M
3300031695|Ga0308016_10086639Not Available1284Open in IMG/M
3300031851|Ga0315320_10017621All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes5706Open in IMG/M
3300032047|Ga0315330_10114667All Organisms → cellular organisms → Bacteria1778Open in IMG/M
3300033742|Ga0314858_114791All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes687Open in IMG/M
3300034375|Ga0348336_011664All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes5203Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine37.62%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater15.84%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine10.89%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous8.91%
Marine OceanicEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic5.94%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine4.95%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine4.95%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater3.96%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean0.99%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.99%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.99%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.99%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.99%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.99%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.99%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000929Marine plume microbial communities from the Columbia River - 15 PSUEnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300002760Marine viral communities from the Pacific Ocean - ETNP_6_1000EnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006352Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNAEnvironmentalOpen in IMG/M
3300006738Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaGEnvironmentalOpen in IMG/M
3300006750Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006754Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006926Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaGEnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007555Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555EnvironmentalOpen in IMG/M
3300007963Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2)EnvironmentalOpen in IMG/M
3300008050Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaGEnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009613Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3737_250EnvironmentalOpen in IMG/M
3300009619Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3827_250EnvironmentalOpen in IMG/M
3300009622Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155EnvironmentalOpen in IMG/M
3300010151Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010155Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaGEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300017703Marine viral communities from the Subarctic Pacific Ocean - ?Lowphox_02 viral metaGEnvironmentalOpen in IMG/M
3300017718Marine viral communities from the Subarctic Pacific Ocean - Lowphox_11 viral metaGEnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017775Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021443Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300022164Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300025066Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025097Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025099Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025125Marine viral communities from the Pacific Ocean - ETNP_2_1000 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025248Marine viral communities from the Deep Pacific Ocean - MSP-118 (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025873Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes)EnvironmentalOpen in IMG/M
3300026103Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155 (SPAdes)EnvironmentalOpen in IMG/M
3300026115Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3827_250 (SPAdes)EnvironmentalOpen in IMG/M
3300027159Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 (SPAdes)EnvironmentalOpen in IMG/M
3300027320Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes)EnvironmentalOpen in IMG/M
3300027686Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027714Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300031140Marine microbial communities from water near the shore, Antarctic Ocean - #420EnvironmentalOpen in IMG/M
3300031141Marine microbial communities from water near the shore, Antarctic Ocean - #351EnvironmentalOpen in IMG/M
3300031142Marine microbial communities from water near the shore, Antarctic Ocean - #353EnvironmentalOpen in IMG/M
3300031143Marine microbial communities from water near the shore, Antarctic Ocean - #422EnvironmentalOpen in IMG/M
3300031167Marine microbial communities from water near the shore, Antarctic Ocean - #418EnvironmentalOpen in IMG/M
3300031628Marine microbial communities from water near the shore, Antarctic Ocean - #229EnvironmentalOpen in IMG/M
3300031630Marine microbial communities from water near the shore, Antarctic Ocean - #38EnvironmentalOpen in IMG/M
3300031647Marine microbial communities from water near the shore, Antarctic Ocean - #179EnvironmentalOpen in IMG/M
3300031658Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78EnvironmentalOpen in IMG/M
3300031688Marine microbial communities from water near the shore, Antarctic Ocean - #177EnvironmentalOpen in IMG/M
3300031695Marine microbial communities from water near the shore, Antarctic Ocean - #233EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300032047Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915EnvironmentalOpen in IMG/M
3300033742Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawaterEnvironmentalOpen in IMG/M
3300034375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
NpDRAFT_1011833623300000929Freshwater And MarineMEKVKDTAGNELNPGDHVVIQGWRGLEVAKIRRFTSSCMLCDYTFIHHNGDRIPSRLQPYLPNHPHTAINEKHPDRMLKVLKITQQQYDNFQQNL*
JGI24006J15134_1000781393300001450MarineMEKVEDVTGEELKPGDFVTVQGWKGLEIAKVRRFTSSCMLCDYTFVHIDGTLIPSRLQPYLPNHDSTATNETYPNRMLKVLKITEEQYERFKQNL*
JGI24006J15134_1007836323300001450MarineMEKVEDVTGEELKVGDFVTVQGWRGLEVAKVRKFTAGCMICDYTFVTHNGTKGPGRLQPYLPNHPNTATNEAYPNRMLKVLKITEEQYERFQQNL*
JGI25136J39404_102146123300002760MarineIQGWKGLEIAXVXKFTEXCMLCDYIYVNHRGDQAPGRLQPYLPGHSNTASNDKYPNRMLKVLKITEEQYDRFKQNL*
Ga0075441_1006527923300006164MarineMEKVEDVTGEELKPGDFVTVQGWRGLEVAKVRTFTGFCMLCDYTFVHNDGSLVPSRLQPYLPNHNQTASNHKYPNRMLKVLKITEEQYERFQQNL*
Ga0075448_10001004133300006352MarineMGKIEDVTGVELHTGDYVAVQGWRGLEIAQVRKFSTSCMICDYTFVHTNGTLVPSRLQPYLPNHSQTSSNENYPNRMLKVLKIEKEQYDRHYKNL*
Ga0098035_100711233300006738MarineMATIEDVTGEELKVGDYVTVQGWKGLEMARVRKFTNSCMLCDYTFVHIDGTLIPSRLQPYLPNHNQTASNAAYPNRMLKVLKITEEQYDRFKQNL*
Ga0098058_102415813300006750MarineRNINSMEKVEDVTGEELKPGDFVTVQGWKGLEVAKVRKFTSSCMLCDYTYVNYNGTKGPARLQPYLPNHHSTASNKAYPNRMLKVLKITEEQYDRFKQNL*
Ga0098048_110863323300006752MarineMEKVEDVTGEELKVGDYVTVQGWKGLEVARVRKFTNSCMLCDYTYISHTGAQVPGRLQPYLPNHHSTATNETYPNRMLKVLKITEEQYDRFKQNL*
Ga0098044_100846823300006754MarineMATIEDVTGEELKVGDYVTVQGWKGLEVARVRKFTNSCMLCDYTYISHTGAQVPGRLQPYLPNHHSTATNETYPNRMLKVLKITEEQYDRFKQNL*
Ga0098054_111418833300006789MarineMATIEDVTGEELKVGDYVTVQGVNGLELARIRKFTNSCMLCDYTFVHIDGTLIPSRLQPYLPNHNQTASNAAYPNRMLKVLKITEEQYDRFKQNL*
Ga0098055_104460233300006793MarineIEDVTGEELKVGDYVTVQGWKGLEVARVRKFTNSCMLCDYTYISHTGAQVPGRLQPYLPNHNSTATNEAYPNRMLKVLKITEEQYDRFKQNL*
Ga0098055_115568613300006793MarineGDHVTIQGWKGLEVAKVRRFTEGCMICDYTFVNYKGAKAPGRLQPYLPNHPNTATNEKYPNRMLKVLKITKEQYERFEQNL*
Ga0070754_1001125823300006810AqueousMEKVKDTAGNELNPGDHVVVQGWRGLEVAKIRRFTSSCMLCDYTFVNDMGDRIPSRLQPYLTNHPHTAINDKYPDRMIKVLKITQQQYDNFQQNL*
Ga0098060_100997423300006921MarineMEKVEDVTGEELKPGDHVTIQGWKGLEVAKVRRFTEGCMICDYTFVNYKGAKAPGRLQPYLPNHPNTATNEKYPNRMLKVLKITKEQYERFEQNL*
Ga0098045_102316023300006922MarineMATIEDVTGEELKPGDHVTIQGWKGLEVAKVRRFTEGCMICDYTFVNYKGAKAPGRLQPYLPNHPNTATNEKYPNRMLKVLKITKEQYERFEQNL*
Ga0098045_115419723300006922MarineMGKVIKDAAGQQLNPGDYVTVQGWKGLELAKVRRFSSSCMICDYIYVTYNGSTGPGRLQPYLPDHPNTASSKKYPDRMLKVLKITKEQYDTFIENL*
Ga0098051_103181713300006924MarineMATIEDVTGEELKVGDYVTVQGVNGLELARIRKFTNSCMLCDYTFVHIDGTLIPSRLQPYLPNHPNTASNEAYPNRMLKVLKITEEQYDRFKQN
Ga0098051_105169323300006924MarineMEKVEDVTGEELKPGDFVTVQGWKGLEVAKVRRFTEGCMICDYTFVNYKGAKAPGRLQPYLPNHPNTATNEKYPNRMLKVLKITKEQYERFEQNL*
Ga0098057_101595633300006926MarineGEELKVGDYVTVQGVNGLELARIRKFTNSCMLCDYTFVHIDGTLIPSRLQPYLPNHNQTASNAAYPNRMLKVLKITEEQYDRFKQNL*
Ga0098036_105181523300006929MarineMEKVEDVTGEELKPGDYVTIQGWKGLEVAKVRRFTEGCMICDYTYVNYKGAKGPARLQPYLPNHPNTATNEKYPNRMLKVLKITKEQYERFEQNL*
Ga0070747_122827023300007276AqueousMEKVKDTAGNELNPGDHVVVQGWKGLEVAKIRRFTSSCMLCDYTFVNHIGDRIPSRLQPYLPDHPHTAINDKYPDRMIKVLKITQQQYDNFQQNL*
Ga0070752_100261323300007345AqueousMEKVKDTAGNELNPGDHVVVQGWKGLEVAKIRRFTSSCMLCDYTFVNHIGDRIPSRLQPYLPNHPNTAINDKYPDRMIKVLKITQQQYDNFQQNL*
Ga0099847_110732813300007540AqueousTINTRYYTIRATKSRDRNINSMEKVKDTAGNELNPGDHVVVQGWRGLEVAKIRRFTSSCMLCDYTFVNHMGDRIPSRLQPYLPDHPHTTINDKYPDRMIKVLKITQQQYDNFQQNL*
Ga0102817_107547213300007555EstuarineTKSRNRNINSIEKVKDTARNELNPGNHVVVQGWKRLEVAKIRRFTSSCMLCDYTFVNHNGDRVPSRLQPYLPNHPHTAINDKHPDRMLKVLKITQQQYDNFQQNL*
Ga0110931_111622523300007963MarineMEKVEDVTGEELKAGDYVTVQGWKGLEVARVRKFTNSCMLCDYTFVSHSGAKVPGRLQPYLPNHHSTATNETYPNRMLKVLKITEEQYDRFKQNL*
Ga0098052_102314333300008050MarineMATIEDVTGEELKVGDYVTVQGVNGLELARIRKFTNSCMLCDYTFVHIDGTLIPSRLQPYLPNHNQTASNEKYPNRMLKVLKITEEQYDRFKQNL*
Ga0102810_1001127123300009002EstuarineMEKVKDRAGNELNPGDHVVIQGWRGLEVAKIRRFTSSCMLCDYTFVNHNGDRVPSRLQPYLPNHPHTAINDKHPDRMLKVLKITQQQYDNFQQNL*
Ga0102829_100125523300009026EstuarineMEKVKDTAGNELNPGDHVVIQGWKGLEVAKIRRFTSSCMLCDYTFVNHNGDRVPSRLQPYLPNHPHTAINDKHPDRMLKVLKITQQQYDNFQQNL*
Ga0115008_1005029423300009436MarineMEKVKDTAGNELNPGDHVVVQGWRGLEVAKIRRFTSSCMLCDYTFVNHMGDRIPNRLQPYLPDHPHTAINDKYPDRMIKVLKITQQQYDNFQQNL*
Ga0105228_11195323300009613Marine OceanicMEKVEDVTGEQLRPGDYVTVQGWRGLEIAQVRKFSSSCMICDYIYVNHRGDQIPGRLQPYLPGHSNTASNDKYPNRMLKVLKITEDQYDRFKQNL*
Ga0105236_100018543300009619Marine OceanicMEKVEDVTGEELRPGDHVTIQGWKGLEVAKVRSFTGSCMLCDYTYVNYHGDIIPGRLQPYLPNHNSTASNKAYPNRMLKVLKITEEQYDRFKQNL*
Ga0105173_102916123300009622Marine OceanicMGKIVEDAAGQQLNPGDYVAVQGWRGLELAKVRRFTGSCMLCDYTYVSSGGKRIPSRLQPYLPDHSNTSSNPKYPNRMIKVLRITQEQYDTYHANL*
Ga0098061_102757423300010151MarineMEKVKDVTGEELKVGDFVTVQGWRGLEVAKVRRFTDSCMLCDYTYISHTGAQVPGRLQPYLPNHHSTASNKAYPNRMLKVLKITEEQYDRFKQNL*
Ga0098061_131893523300010151MarineMEKVEDVTGEELKVGDYVTVQGVNGLELARIRKFTNSCMLCDYTFVHIDGTLIPSRLQPYLPNHNQTASNEKYPNRMLKVLKITEKQYDRFKQNL*
Ga0098059_104374523300010153MarineMEKVEDVTGEELKVGDYVTVQGWKGLEVARVRKFTNSCMLCDYTYISHTGAQVPGRLQPYLPNHNSTATNEAYPNRMLKVLKITEEQYDRFKQNL*
Ga0098059_117065413300010153MarineMEKVEDVTGEELKPGDFVTVQGWKGLEVAKVRRFTNSCMLCDYTYVSHSGTRVPGRLQPYLPNNPNTASNEAYPNRMLKVLKITEEQYERFQQNL*
Ga0098047_1002183923300010155MarineMEEVEDVTGEQLRPGDYVTVQGWRGLEVAKVRKFTGSCMLCDYTYVSHTGAQVPGRLQPYLPGHPNTASNDKYPNRMLKVLKITEEQYDRFKQNL*
Ga0133547_1046431123300010883MarineMGKVEDVTGEEINPGDFVTVQGWRGLEVAKVRAFTSSCMLCDYTYVHSDGQLIKSRLQPYLPDHNMTASNHKYPNRMLKVLKITKEQYERFHENL*
Ga0129327_1018620123300013010Freshwater To Marine Saline GradientMEKVKDTAGNELTAGDYVVVQGWKGLEVAKIRRFTSSCMLCDYTFVNHMGDRIPSRLQPYLPDHPHTTINDKYPDRMIKVLKITQQQYDNFQQNL*
Ga0181367_100978423300017703MarineMEKVEDVTGEELKAGDYVTVQGWKGLEVARVRKFTNSCMLCDYTYISHTGAQVPGRLQPYLPNHHSTATNETYPNRMLKVLKITEEQYDRFKQNL
Ga0181375_100359723300017718MarineMATIEDVTGEELKVGDYVTVQGWKGLEMARVRKFTNSCMLCDYTFVHIDGTLIPSRLQPYLPNHHSTATNETYPNRMLKVLKITEEQYDRFKQNL
Ga0181417_110996823300017730SeawaterMEKVEDVTGEELNPGDYVTIQGWRGLEVAKVRRFTEGCMICDYTFVTHNGTKGPARLQPYLPNHPNTATNEKYPNRMLKVLKITEEQYERFQQNL
Ga0181416_113835823300017731SeawaterMGKVVEDVTGEELKPGDFVTVQGWKGLEVAKVRKFTAGCMICDYTFVTHNGTKGPARLQPYLPNHPNTATNEKYPNRMLKVLKITKEQYERFEQNL
Ga0181433_114102523300017739SeawaterMEKVEDVTGEELNPGDYVTIQGWRGLEVAKVRRFTEGCMICDYTFVTHNGTKGPARLQPYLPNHPNTATNEKYPNRMLKVLKITKEQYERFEQ
Ga0181393_116405723300017748SeawaterYYTIRATKSRNRNINSMEKVKDTAGNELNPGDHVVVQGWKGLEVAKIRRFTSSCMLCDYTFVHHNGTRVPSRLQPYLPNHPHTAINDKYPDRMIKVLKITQQQYDNFEQNL
Ga0181392_102681233300017749SeawaterMGKVVEDVTGEELKPGDFVTIQGWKGLEVAKVRRFTEGCMICDYTYVNYKRDKAPGRLQPYLPNHPNTASNEKYPNRMLKVLKITKEQYERFEQNL
Ga0181405_101329523300017750SeawaterMEKVKDTAGNELNPGDHVVVQGWKGLEVAKIRRFTSSCMLCDYTFVHHNGTRVPSRLQPYLPNHPHTAINDKYPDRMIKVLKITQQQYDNFEQNL
Ga0181414_112753113300017759SeawaterNSMEKVKDTAGNELNPGDHVVVQGWKGLEVAKIRRFTSSCMLCDYTFVHHNGTRVPSRLQPYLPNHPHTAINDKYPDRMIKVLKITQQQYDDFEQNL
Ga0181413_105196313300017765SeawaterSRNRNINSMEKVKDTAGNELNPGDHVVVQGWKGLEVAKIRRFTSSCMLCDYTFVHHNGTRVPSRLQPYLPNHPHTAINDKYPDRMIKVLKITQQQYDNFEQNL
Ga0181406_104071223300017767SeawaterMEKVKDTAGNELNPGDHVVVQGWKGLEVAKIRRFTSSCMLCDYTFVHYNGDQVPSRLQPYLPNHPHTAINDKYPDRMIKVLKITQQQYDNFQQNL
Ga0187217_100888633300017770SeawaterMEKVEDVTGEELKPGDFVTIQGWKGLEVAKVRRFTEGCMICDYTYVNYKGDKAPGRLQPYLPNHPNTASNEKYPNRMLKVLKITKEQYERFEQNL
Ga0181432_102944223300017775SeawaterTVQGWKGLEIARVRKFTSSCMLCDYTFVHIDGTLIPSRLQPYLPNHNQTSSNAAYPNRMLKVLKITEEQYERFQQNL
Ga0181394_104541823300017776SeawaterMEKVEDVTGEELKVGDFVTVQGWRGLEVAKVRKFTAGCMICDYTFVTHNGTKGPGRLQPYLPNHPNTATNEKYPNRMLKVLKITKEQYERFEQN
Ga0181394_110972423300017776SeawaterYYTIRAIKSRDRNINSMEKVEDVTGEELKPGDFVTIQGWKGLEVAKVRRFTEGCMICDYTYVNYKGDKAPGRLQPYLPNHPNTASNEKYPNRMLKVLKITKEQYERFEQNL
Ga0181395_100650823300017779SeawaterMEKVKDTAGNELNPGDHVVVQGWKGLEVAKIRRFTSSCMLCDYTFVHYNGDQVPSRLQPYLPNHPHTAINDKYPDRMIKVLKITQQQYDNFEQNL
Ga0181424_1034913323300017786SeawaterMEKVEDVTGEELNPGDYVTIQGWRGLEVAKVRRFTEGCMICDYTFVTHNGTKGPGRLQPYLPNHPNTATNEAYPNRMLKVLKITKEQYERFEQNL
Ga0181424_1039617923300017786SeawaterRYYTIRATKSRNRNINSMEKVKDTAGNELNPGDHVVVQGWKGLEVAKIRRFTSSCMLCDYTFVHHNGDQVPSRLQPYLPNHPHTAINDKYPDRMIKVLKITQQQYDNFEQNL
Ga0211576_1039993513300020438MarineMEKVKDTAGNELNPGDHVVVQGWKGLEVAKIRRFTSSCMLCDYTFVHHNGTRVPSRLQPYLPNHPHTAINGKYPDRMIKVLKI
Ga0206691_133098823300021342SeawaterMGKVEDVTGEELKPGDFVTVQGWKGLEIARVRKFTSSCMLCDYTFVHIDGTLIPSRLQPYLPNHNQTASNAAYPNRMLKVLKITEEQYERFKQNL
Ga0206681_1001145953300021443SeawaterMGKVEDVTGEELKPGDFVTVQGWKGLEIAKVRRFTSSCMLCDYTFVHIDGTLIPSRLQPYLPNHSNTASNEAYPNRMLKVLKITEEQYERFKQNL
Ga0206681_1019499123300021443SeawaterMEKVEDVTGEELKVGDYVTVQGWKGLEIARVRKFTSSCMLCDYTFVHIDGTLIPSRLQPYLPNHNQTASNAAYPNRMLKVLKITEEQYERFKQNL
Ga0222717_1005825423300021957Estuarine WaterMEKVKDTAGNELNPGDHVVIQGWRGLEVAKIRRFTSSCMLCDYTFVHHNGTRVPSRLQPYLPNHPHTAINGKYPDRMIKVLKITQQQYDNFQQNL
Ga0212022_101735823300022164AqueousMEKVKDTAGNELNPGDHVVVQGWKGLEVAKIRRFTSSCMLCDYTFVNHMGDRIPSRLQPYLPDHPHTTINDKYPDRMIKVLKITQQQYDNFQQNL
Ga0196887_104838613300022178AqueousMEKVKDTAGNELTAGDYVVVQGWKGLEVAKIRRFTSSCMLCDYTFVNHIGDRIPSRLQPYLPNHPNTAINDKYPDRMIKVLKITQQQYDNFQQNL
(restricted) Ga0233432_1042194613300023109SeawaterMEKVKDTAGNELNPGDHVVVQGWRGLEVAKIRRFTSSCMLCDYTFIHWNGDRIPSRLQPYLPNHPHTAINEKHPDRMLKVLKITQQQYDNFQQNL
Ga0208012_100674623300025066MarineMATIEDVTGEELKVGDYVTVQGVNGLELARIRKFTNSCMLCDYTFVHIDGTLIPSRLQPYLPNHNQTASNAAYPNRMLKVLKITEEQYDRFKQNL
Ga0208010_100928233300025097MarineMATIEDVTGEELKVGDYVTVQGWKGLEVARVRKFTNSCMLCDYTYISHTGAQVPGRLQPYLPNHHSTATNETYPNRMLKVLKITEEQYDRFKQNL
Ga0208669_1000079233300025099MarineMEKVEDVTGEELKPGDHVTIQGWKGLEVAKVRRFTEGCMICDYTFVNYKGAKAPGRLQPYLPNHPNTATNEKYPNRMLKVLKITKEQYERFEQNL
Ga0208793_102230933300025108MarineMATIEDVTGEELKVGDYVTVQGWKGLEMARVRKFTNSCMLCDYTFVHIDGTLIPSRLQPYLPNHPNTASNEAYPNRMLKVLKITEEQYDRFKQNL
Ga0209644_107532223300025125MarineMEEVEDVTGEQLRPGDYVTIQGWKGLEIAQVRKFTESCMLCDYIYVNHRGDQAPGRLQPYLPGHSNTASNDKYPNRMLKVLKITEEQYDRFKQNL
Ga0209337_102389733300025168MarineMEKVEDVTGEELKPGDFVTVQGWKGLEIAKVRRFTSSCMLCDYTFVHIDGTLIPSRLQPYLPNHDSTATNETYPNRMLKVLKITEEQYERFQQNL
Ga0209337_109388623300025168MarineMEKVEDVTGEELKVGDFVTVQGWRGLEVAKVRKFTAGCMICDYTFVTHNGTKGPGRLQPYLPNHPNTATNEAYPNRMLKVLKITEEQYERFQQNL
Ga0207904_103033223300025248Deep OceanMEKVEDVTGEKLYPGDFVTVQGWRGLEIAKVRRFSSSCMICDYTYLNHSGDQAPGKLQPYLPDHHMTASSEKYPNRMLKVLKITEEQYDRFKQNL
Ga0208303_108747723300025543AqueousTINTRYYTIRATKSRDRNINSMEKVKDTAGNELNPGDHVVVQGWRGLEVAKIRRFTSSCMLCDYTFVNHMGDRIPSRLQPYLPDHPHTTINDKYPDRMIKVLKITQQQYDNFQQNL
Ga0208134_1000104533300025652AqueousMEKVKDTAGNELNPGDHVVVQGWKGLEVAKIRRFTSSCMLCDYTFVNHIGDRIPSRLQPYLPNHPNTAINDKYPDRMIKVLKITQQQYDNFQQNL
Ga0209757_1001400423300025873MarineMEEVEDVTGEQLRPGDYVTVQGWRGLEIAQVRKFSSSCMICDYIYVNHRGDQAPGRLQPYLPGHSNTASNDKYPNRMLKVLKITEEQYDRFKQNL
Ga0209757_1016115613300025873MarineMATIEDVAGQELHPGDFVTIQGWRGLEMAKVRRFSSSCMICDYTYLNHNGDQAPGKLQPYLPDHHMTASNTKHPNRMLKVLKITQEQYDTYHENL
Ga0208451_101121623300026103Marine OceanicMGKIVEDAAGQQLNPGDYVAVQGWRGLELAKVRRFTGSCMLCDYTYVSSGGKRIPSRLQPYLPDHSNTSSNPKYPNRMIKVLRITQEQYDTYHANL
Ga0208560_100047523300026115Marine OceanicMEKVEDVTGEQLRPGDYVTVQGWRGLEIAQVRKFSSSCMICDYIYVNHRGDQIPGRLQPYLPGHSNTASNDKYPNRMLKVLKITEDQYDRFKQNL
Ga0208560_100129623300026115Marine OceanicMEKVEDVTGEELRPGDHVTIQGWKGLEVAKVRSFTGSCMLCDYTYVNYHGDIIPGRLQPYLPNHNSTASNKAYPNRMLKVLKITEEQYDRFKQNL
Ga0208020_104696923300027159EstuarineMEKVKDTAGNELNPGDHVVIQGWKGLEVAKIRRFTSSCMLCDYTFVNHNGDRVPSRLQPYLPNHPHTAINDKHPDRMLKVLKITQQQYDNFQQNL
Ga0208923_108262923300027320EstuarineAGNELNPGDHVVIQGWKGLEVAKIRRFTSSCMLCDYTFVNHNGDRVPSRLQPYLPNHPHTAINDKHPDRMLKVLKITQQQYDNFQQNL
Ga0209071_1002397123300027686MarineMGKIEDVTGVELHTGDYVAVQGWRGLEIAQVRKFSTSCMICDYTFVHTNGTLVPSRLQPYLPNHSQTSSNENYPNRMLKVLKIEKEQYDRHYKNL
Ga0209815_120696723300027714MarineMEKVEDVTGEELKPGDFVTVQGWRGLEVAKVRTFTGFCMLCDYTFVHNDGSLVPSRLQPYLPNHNQTASNHKYPNRMLKVLKITEEQYERFQQNL
Ga0209092_1005909923300027833MarineMEKVKDTAGNELNPGDHVVVQGWRGLEVAKIRRFTSSCMLCDYTFVNHMGDRIPNRLQPYLPDHPHTAINDKYPDRMIKVLKITQQQYDNFQQNL
Ga0308024_100954323300031140MarineMGKIEDVTGAELRPGDYVAVQGWQGLEIAKVRRFSSSCMLCDYTHVRIDGTKWDGRLQPYLPNHPHTASNEKYPNRMLKVLKVEKEQYDRYYQNL
Ga0308021_1034524623300031141MarineSRHKHKPDMGKVEDVTGEELSVGNYVAIQGWRGLEVAKVRRFTGSCMLCDYTYIHSDGRQIPSRLQPYLPNHNHTASNHKYPNRMLKVLKITEEQYERFQQNL
Ga0308022_109672223300031142MarineGTVYSRDNTFGFIESRHKHKPDMGKIEDVTGAELHPGDYVAVQGWRGLEIAKVRGFSGSCMICDYTFVHTNGTLVPSRLQPYLPNHSQTSSNENYPDRMLKVLKIEKEQYDRYYENV
Ga0308025_109030113300031143MarineRDNTFGFIESRHKHKPDMGKIEDVTGAELHPGDYVAVQGWRGLEIAKVRGFSGSCMICDYTFVHTNGTLVPSRLQPYLPNHSQTSSNENYPDRMLKVLKIEKEQYDRYYENV
Ga0308023_100357033300031167MarineMGKIEDVTGAELHPGDYVAVQGWRGLEIAKVRGFSGSCMICDYTFVHTNGTLVPSRLQPYLPNHSQTSSNENYPDRMLKVLKIEKEQYDRYYENV
Ga0308014_105301923300031628MarineVYSRDNTFGFIESRHKHKPDMGKIEDVTGAELHPGDYVAVQGWRGLEIAKVRGFSGSCMICDYTFVHTNGTLVPSRLQPYLPNHSQTSSNENYPDRMLKVLKIEKEQYDRYYENV
Ga0308004_1006040233300031630MarineTGAELRPGDYVAVQGWQGLEIAKVRRFSSSCMLCDYTHVRIDGTKWDGRLQPYLPNHPHTASNEKYPNRMLKVLKVEKEQYDRYYQNL
Ga0308012_1042622813300031647MarineELSVGNYVAIQGWRGLEVAKVRRFTGSCMLCDYTYIHSDGRQIPSRLQPYLPNHNHTASNHKYPNRMLKVLKITEEQYERFQQNL
Ga0307984_101474223300031658MarineMGKIEDATGLEINPGDYVAVQGWQGLEIAKVRRFSSSCMLCDYTHVRIDGTKWDGRLQPYLPNHPHTASNEKYPNRMLKVLKVEKEQYDRYYQNL
Ga0308011_1011379923300031688MarineRINGTVYSRDNTFGFIESRHKHKPDMGKIEDVTGAELHPGDYVAVQGWRGLEIAKVRGFSGSCMICDYTFVHTNGTLVPSRLQPYLPNHSQTSSNENYPDRMLKVLKIEKEQYDRYYENV
Ga0308016_1008663913300031695MarineDMGKIEDVTGAELHPGDYVAVQGWRGLEIAKVRGFSGSCMICDYTFVHTNGTLVPSRLQPYLPNHSQTSSNENYPDRMLKVLKIEKEQYDRYYENV
Ga0315320_1001762123300031851SeawaterMEKVKDTAGNELNPGDHVVVQGWRGLEVAKIRRFTSSCMLCDYTFVHHNGDQVPSRLQPYLPNHPHTAINDKHPDRMLKVLKITQQQYDNFQQNL
Ga0315330_1011466723300032047SeawaterMEKVEDVTGEELNPGDYVTIQGWRGLEVAKVRRFTEGCMICDYTFVTHNGTKGPARLQPYLPNHPNTATNEKYPNRMLKVLKITKEQYERFEQNL
Ga0314858_114791_454_6873300033742Sea-Ice BrineMEKVKDTAGNELNPGDHVVVQGWRGLEVAKIRRFTSSCMLCDYTYVNHMGDRIPSRLQPYLPNHPHTAINDKYPDRMI
Ga0348336_011664_1605_18923300034375AqueousMEKVKDTAGNELNPGDHVVVQGWRGLEVAKIRRFTSSCMLCDYTFVNHMGDRIPSRLQPYLPDHPHTAINDKYPDRMIKVLKITQQQYDNFQQNL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.