NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F103854

Metagenome / Metatranscriptome Family F103854

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F103854
Family Type Metagenome / Metatranscriptome
Number of Sequences 101
Average Sequence Length 45 residues
Representative Sequence MKKRYWIAGAATLAIAGKLLTRPRDADWQKCRDVVFHSEHS
Number of Associated Samples 85
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 9.90 %
% of genes near scaffold ends (potentially truncated) 97.03 %
% of genes from short scaffolds (< 2000 bps) 90.10 %
Associated GOLD sequencing projects 78
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (75.248 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere
(13.861 % of family members)
Environment Ontology (ENVO) Unclassified
(47.525 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(65.347 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 47.83%    β-sheet: 0.00%    Coil/Unstructured: 52.17%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF06798PrkA 74.26
PF08298AAA_PrkA 14.85
PF02631RecX 1.98
PF00561Abhydrolase_1 1.98
PF12697Abhydrolase_6 0.99
PF13561adh_short_C2 0.99
PF01411tRNA-synt_2c 0.99
PF00578AhpC-TSA 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG2766Predicted Ser/Thr protein kinaseSignal transduction mechanisms [T] 89.11
COG2137SOS response regulatory protein OraA/RecX, interacts with RecAPosttranslational modification, protein turnover, chaperones [O] 1.98
COG0013Alanyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.99

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms76.24 %
UnclassifiedrootN/A23.76 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002886|JGI25612J43240_1077284All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300004016|Ga0058689_10068664All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300004156|Ga0062589_101395793All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300004156|Ga0062589_101416251All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300005289|Ga0065704_10388932All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300005334|Ga0068869_100768657All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300005334|Ga0068869_100975551All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300005341|Ga0070691_11073285Not Available506Open in IMG/M
3300005365|Ga0070688_101266782Not Available594Open in IMG/M
3300005367|Ga0070667_102003257All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300005444|Ga0070694_100605876All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300005539|Ga0068853_100809153All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300005544|Ga0070686_100672892All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300005545|Ga0070695_100386030All Organisms → cellular organisms → Bacteria1058Open in IMG/M
3300005577|Ga0068857_101646049All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300005615|Ga0070702_100918094All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300005841|Ga0068863_100344274All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium1451Open in IMG/M
3300005842|Ga0068858_100039311All Organisms → cellular organisms → Bacteria4388Open in IMG/M
3300005842|Ga0068858_100431845Not Available1267Open in IMG/M
3300005842|Ga0068858_102293501All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300005843|Ga0068860_101712591All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300005843|Ga0068860_102176246Not Available576Open in IMG/M
3300005844|Ga0068862_100353751Not Available1363Open in IMG/M
3300005844|Ga0068862_102286987All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300005844|Ga0068862_102623180Not Available516Open in IMG/M
3300005937|Ga0081455_10894234Not Available553Open in IMG/M
3300006169|Ga0082029_1494898Not Available600Open in IMG/M
3300006173|Ga0070716_100670188All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300006358|Ga0068871_102276783Not Available516Open in IMG/M
3300006755|Ga0079222_12381274Not Available530Open in IMG/M
3300006844|Ga0075428_101183601All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300006854|Ga0075425_102301209Not Available599Open in IMG/M
3300006876|Ga0079217_10003301All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia4615Open in IMG/M
3300006918|Ga0079216_10769217All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300007004|Ga0079218_13906177All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300007076|Ga0075435_101835122All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300009036|Ga0105244_10346901All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300009094|Ga0111539_10053276All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes4816Open in IMG/M
3300009098|Ga0105245_11274490All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300009148|Ga0105243_11703775All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300009156|Ga0111538_10082006All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes4104Open in IMG/M
3300009162|Ga0075423_11668143All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300009177|Ga0105248_13048805Not Available533Open in IMG/M
3300009553|Ga0105249_11008037All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300009553|Ga0105249_11497577All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300009789|Ga0126307_10596338All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300009789|Ga0126307_11119654All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300010038|Ga0126315_10547815All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300010042|Ga0126314_10285824All Organisms → cellular organisms → Bacteria1175Open in IMG/M
3300010046|Ga0126384_10092213All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2212Open in IMG/M
3300010166|Ga0126306_10175237Not Available1607Open in IMG/M
3300010364|Ga0134066_10400928Not Available523Open in IMG/M
3300010373|Ga0134128_10203142All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2231Open in IMG/M
3300010373|Ga0134128_11383211All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300010399|Ga0134127_11630391All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300010399|Ga0134127_13073574All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300010399|Ga0134127_13385265All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300010400|Ga0134122_10108808All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2204Open in IMG/M
3300010400|Ga0134122_11941488All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300011332|Ga0126317_10836826All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2178Open in IMG/M
3300012489|Ga0157349_1034220All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300012961|Ga0164302_11409385Not Available569Open in IMG/M
3300012986|Ga0164304_11423074All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300013297|Ga0157378_12350128All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300013307|Ga0157372_11579928All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300013307|Ga0157372_12700563Not Available570Open in IMG/M
3300014326|Ga0157380_12970072All Organisms → cellular organisms → Bacteria → Acidobacteria540Open in IMG/M
3300015371|Ga0132258_12794135All Organisms → cellular organisms → Bacteria1216Open in IMG/M
3300018476|Ga0190274_11552276All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300025903|Ga0207680_10342915All Organisms → cellular organisms → Bacteria1048Open in IMG/M
3300025904|Ga0207647_10808934Not Available503Open in IMG/M
3300025907|Ga0207645_11206765All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300025912|Ga0207707_11526621Not Available528Open in IMG/M
3300025917|Ga0207660_10430405All Organisms → cellular organisms → Bacteria1065Open in IMG/M
3300025924|Ga0207694_10506728All Organisms → cellular organisms → Bacteria1011Open in IMG/M
3300025925|Ga0207650_11898782Not Available503Open in IMG/M
3300025933|Ga0207706_11723671Not Available504Open in IMG/M
3300025934|Ga0207686_10732193All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300025935|Ga0207709_10928025All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300025942|Ga0207689_10314485Not Available1299Open in IMG/M
3300025960|Ga0207651_10877611All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300025981|Ga0207640_10814601All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300025981|Ga0207640_10872558All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300026011|Ga0208532_1016351Not Available537Open in IMG/M
3300026067|Ga0207678_11273619All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300026088|Ga0207641_10506952All Organisms → Viruses → Predicted Viral1172Open in IMG/M
3300026089|Ga0207648_10110847All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2409Open in IMG/M
3300026095|Ga0207676_12218282All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300026142|Ga0207698_11312550All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300027691|Ga0209485_1056743All Organisms → cellular organisms → Bacteria1019Open in IMG/M
3300027907|Ga0207428_10714622All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300028380|Ga0268265_10114946All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2205Open in IMG/M
3300028381|Ga0268264_10200427Not Available1826Open in IMG/M
3300028381|Ga0268264_11170645All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300028802|Ga0307503_10948403All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300031547|Ga0310887_10398332All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300031562|Ga0310886_10166347All Organisms → cellular organisms → Bacteria1175Open in IMG/M
3300031847|Ga0310907_10545539Not Available626Open in IMG/M
3300031858|Ga0310892_10821991All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300032000|Ga0310903_10767437All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300033412|Ga0310810_11374500All Organisms → cellular organisms → Bacteria544Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere13.86%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil6.93%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.93%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere5.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.95%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil4.95%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil4.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.95%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere4.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.98%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.98%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.98%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.99%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.99%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.99%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.99%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.99%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.99%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.99%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.99%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.99%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.99%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002886Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cmEnvironmentalOpen in IMG/M
3300004016Agave microbial communities from Guanajuato, Mexico - As.Ma.rzHost-AssociatedOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009036Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011332Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012489Unplanted soil (control) microbial communities from North Carolina - M.Soil.5.yng.040610EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026011Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 (SPAdes)EnvironmentalOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027691Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI25612J43240_107728413300002886Grasslands SoilMKKRYWIAGAATAVVAAKLLTRPRDVDWQKNRAIVFHSEHSRF
Ga0058689_1006866413300004016AgaveMKKRYWIAGAATLAIAGKLLTRPRDTDWHKSRDIVFHSSHSRFADVDGVRVHY
Ga0062589_10139579323300004156SoilMKKRYWIAGAATLAIAGKLLTRPRDADWEKCRDVVFHSEHSSFID
Ga0062589_10141625113300004156SoilMKKRYLIAGAATVAIAGKLLLRPRDADWHKCRDVVFHSEHSCFIDVDGIRVHY
Ga0065704_1038893213300005289Switchgrass RhizosphereMKKRYWIAGTATAAAGLAVAVKLLTRPRDVDWAKNRETVFHSEHSNFTEVG
Ga0068869_10076865713300005334Miscanthus RhizosphereMKKRYWIAGTATTAAAVAVAAKLLLRPRDADWHRNRDIIFHSDYS
Ga0068869_10097555113300005334Miscanthus RhizosphereMKKRYWIAGAATLAVASKLLMRPRDANWDRNRHVVFHSDHSR
Ga0070691_1107328523300005341Corn, Switchgrass And Miscanthus RhizosphereMKKRYWIAGAATLAIAGKLLLRPRDADWQKCRDVVFHSEH
Ga0070688_10126678223300005365Switchgrass RhizosphereMKKRYWIASAIAVGVAAKLLLRPRDADWNRNRHVIFHSEHSR
Ga0070667_10200325733300005367Switchgrass RhizosphereMKKRYWIAGGATITATLAVTAKLLARPRDADWNKNRHVVFHSEHSR
Ga0070694_10060587613300005444Corn, Switchgrass And Miscanthus RhizosphereMRMKKRYWIAGAATVAVAGKLLLRPRDADWDKCREVVFHSEHSSFIDVDG
Ga0068853_10080915323300005539Corn RhizosphereMKKRYWIAGATTLVIAGKLLLRPRDADWHKCRRVIFHSDHSRFADVDG
Ga0070686_10067289223300005544Switchgrass RhizosphereMKKRYWIAGAVTLGFAAKLLLRPRDADWNRNRHIVFHSDHSRFVDVDG
Ga0070695_10038603023300005545Corn, Switchgrass And Miscanthus RhizosphereMKKRYWIAGTATAAATLAVTAKLLARPRDADWQKNRQVVFHSEHSRFVDIDNVRLH
Ga0068857_10164604913300005577Corn RhizosphereMKKRYWIASTATAAATLAVTAKLLARPRDADWSKNRDV
Ga0070702_10091809413300005615Corn, Switchgrass And Miscanthus RhizosphereMKKRYWIAGVATAAIAGKLLLRPRDADWHKYRDVVFHSEHSCFVDVDGVRVH
Ga0068863_10034427423300005841Switchgrass RhizosphereMKKRYWIAGAATLAVAGKLLLRPRDADWNKCRDVVFHSEHSCFVEVDGVRVH*
Ga0068858_10003931153300005842Switchgrass RhizosphereMKKRYWIASTATAAATLAVTAKLLARPRDADWSKNRDVVFHSDHSRFVDIDGVRL
Ga0068858_10043184513300005842Switchgrass RhizosphereMKKRYWIAGGAPLAIAGKLLTRPRDADWGKCRDVV
Ga0068858_10229350123300005842Switchgrass RhizosphereMKTRYWIAGAATVAVAGKLLLRPRDADWHKCRDVVFH
Ga0068860_10171259113300005843Switchgrass RhizosphereMKKRYWIAGGATLAIAGKLLTRPRDADWGKCRDVVFHSEHSCFIDVDGIRVH
Ga0068860_10217624613300005843Switchgrass RhizosphereMKKRYWIAGAATLAVAGKLMLRPRDADWQKCRKVVFHSEHSCFID
Ga0068862_10035375113300005844Switchgrass RhizosphereMEEIHISSVFICGLNMKKRYWIAGAATLAIAGKLLLRPRDADWNKCRDVVFHSEHSCFIDVDGVRVH
Ga0068862_10228698713300005844Switchgrass RhizosphereMKKRYWIAGALTLGVAAKLLSRPRDADWHRNRHVVFHSDHSRF
Ga0068862_10262318013300005844Switchgrass RhizosphereMKKRYWIAGAATLAVAAKLMLRPRDADWQKCREVVFHSEHSC
Ga0081455_1089423423300005937Tabebuia Heterophylla RhizosphereMKKRYWIAGAATLAIAGKLLLRPRDADWEKCRDTVFHSEHSCFID
Ga0082029_149489813300006169Termite NestMKKRYWIAGAATLAVAGKLWLRPREADWDKCREVVFHSEHSCFIEVDGV
Ga0070716_10067018823300006173Corn, Switchgrass And Miscanthus RhizosphereMKKRYWIAGTATAAATVAVAAKLLTRPRDADWHRHRDAVFHS
Ga0068871_10227678313300006358Miscanthus RhizosphereMKKRYWIAGAATVAIAGKLLLRPRDADWDKCRNAVFHSEHSCFI
Ga0079222_1238127413300006755Agricultural SoilMKKRYWIAGAATLAIAGKLWLRPRDADWDKCRDVVFHSDH
Ga0075428_10118360123300006844Populus RhizosphereMGMKKRYWVAGAATAAVAAKLLLRPRDVDWRTNRELVFHSEY*
Ga0075425_10230120923300006854Populus RhizosphereMKKRYWIAGTATAAATLAVAGKLLARPRDADWQKNREVVFHSDH
Ga0079217_1000330153300006876Agricultural SoilMKKRYWIAGTIAVGIAAKWLMRPRDADWNSNRHVIFHSDHS
Ga0079216_1076921723300006918Agricultural SoilMKKRYWIAGTAAVGTGLAIVAKLLSRPRDVDWEQNR
Ga0079218_1390617713300007004Agricultural SoilMKKRYWIAGTATAAATLAVAGKLLARPRDADWNKYRDVIFHSEHSCFAEVDGIR
Ga0075435_10183512223300007076Populus RhizosphereMKKRYWIAGTATAAATLAVAAKLLARPRDADWNKYRHIVFHSEHSRFVDID
Ga0105244_1034690123300009036Miscanthus RhizosphereMMKKRYWIAGAATLAIAGKLLTRPRDADWQKCRDVVFHS
Ga0111539_1005327613300009094Populus RhizosphereMKKRYWIAGAATLAIAGKLFLRPRDADWQKCRDVVFHSEH
Ga0105245_1127449023300009098Miscanthus RhizosphereMKKRYWIAGAATLAVAGKLLTRPRDADWEKCRDVVFHSEHSSF
Ga0105243_1170377513300009148Miscanthus RhizosphereMKKRYWIAGATTLAIAGKLLLRPRDADWHKCRRVIFHSDHS
Ga0111538_1008200613300009156Populus RhizosphereMKKRYWIAGAATLAIAGKLFLRPRDADWQKCRDVVFHSEHS
Ga0075423_1166814313300009162Populus RhizosphereMKKRYWIMGSATAAATLAVTAKLLMRPRDADWHKCRNVIFHSEHSRFLDVD
Ga0105248_1304880523300009177Switchgrass RhizosphereMEMKKRYWIAGTATAAATIAVTAKLLARPRDADWRLY
Ga0105249_1100803723300009553Switchgrass RhizosphereMRMKKRYWIAGAATLAIAGKLLTRPRDADWNKCRDVVFHSEHSSFI
Ga0105249_1149757723300009553Switchgrass RhizosphereMKKRYWIASAIAVGVAAKLLLRPRDADWNRNRHVIFHSEHSRFADVD
Ga0126307_1059633813300009789Serpentine SoilMKKRYWIAGSATAAATLAVAGKLLTRPRDADWHKNRNVVFHSEHSRF
Ga0126307_1111965423300009789Serpentine SoilMRKGYWIAGAASLAIAGKLLLRPRDADWQKCREVVFHSEHSCFIDLDGVRVHYQ
Ga0126315_1054781513300010038Serpentine SoilMKKRYWIAGGATLAIASKLLLRPRDADWDKCRDVVFHCEYSHFIDVDGVRV
Ga0126314_1028582423300010042Serpentine SoilMGMKKRYWIASAATLAIAGKLLTRPRDADWQKCRDVVFHSEHSCF
Ga0126384_1009221313300010046Tropical Forest SoilMKKRYWIAGAATVAIAGKLLLRPRDADWAKCRDVVFHSEHSSFIDVDGVR
Ga0126306_1017523713300010166Serpentine SoilMRKRYWIAGSATAAATLAVAAKLLTRPRDADWGKNRDIVFHSEHSRFVDLDGV
Ga0134066_1040092823300010364Grasslands SoilMKKRYWIAGAATLAIAGKLLARPHDADWQKNREIVFHSDHSRFID
Ga0134128_1020314213300010373Terrestrial SoilMKKRYWIAGAATLAIAGKLLLRPRDADWQKCRDVVFHSE
Ga0134128_1138321113300010373Terrestrial SoilMKKRYWIAGAATLAIAGKLLTRPRDADWQKCRDVVFH
Ga0134127_1163039123300010399Terrestrial SoilMKKRYWIAGAATLAVAGKLLLRPRDADWNKCRDVVFHSECSRFIDVDGVRVHY
Ga0134127_1307357413300010399Terrestrial SoilMKKRYWIAGTANAAATVAIAAKLLSRPRDADWHKY
Ga0134127_1338526523300010399Terrestrial SoilMKKRYWIAGALTLGVAAKLLSRPRDADWNHNRHVVFHS
Ga0134122_1010880823300010400Terrestrial SoilMRMKKRYWIAGAATVVVAGKLLLRPRDADWDKCREVVFHSEHSSFID
Ga0134122_1194148823300010400Terrestrial SoilMQPMKKRYWIAGTATAAATLAVTAKLLLRPRDADWSRNRHVVFHSDH
Ga0126317_1083682623300011332SoilMMKKRYWIAGATTLAIVGKLLTRPRDADWDKCRDVVFHSEHSSF
Ga0157349_103422013300012489Unplanted SoilMKKRYWIASTATAAATLAVTAKLLARPRDADWNKNRHVVFHSDHSRFV
Ga0164302_1140938513300012961SoilMKKRYWIASTATAAATLAVTAKLLARPRDADWNKNRDVVFHSDHSRF
Ga0164304_1142307413300012986SoilMKKRFWIAGTATAAATVAITAKLMARPHDADWQKNREVVFHSEHSRF
Ga0157378_1235012823300013297Miscanthus RhizosphereMKKRYWITGAATLAVAGKLLLRPRDADWNKCRDVVFHSECS
Ga0157372_1157992813300013307Corn RhizosphereMNMKKRYWIAGTATAVATVAVAARLLARPRDADWHKYRDAVFH
Ga0157372_1270056323300013307Corn RhizosphereMKKRYWIAGAGALTLGIAAKLLLRSRDADWNRNRHAIFHSDH
Ga0157380_1297007213300014326Switchgrass RhizosphereMKKRYWIAGATTLVIAGKLLLRPRDADWHKCRDVVFHS*
Ga0132258_1279413513300015371Arabidopsis RhizosphereMKKRYWIAGGATAAATLAVTAKLLTRPRDADWNKNRHVVFHSEHSRFIQCDGTRLH
Ga0190274_1155227613300018476SoilMKKRYLIAGAATLAIAGKLLLRPRDANWNKYRSVVFHSDHSQFVDVD
Ga0207680_1034291513300025903Switchgrass RhizosphereMKKRYWIASTATAAATLAVTAKLLARPRDADWSKNRDVVFH
Ga0207647_1080893413300025904Corn RhizosphereVFIRVNLWLKRMKKRYWIAGAATLAVAGKLLLRPRDADWQKCREVVFHSE
Ga0207645_1120676523300025907Miscanthus RhizosphereMKKRYWIAGAATLAVASKLLMRPRDANWDRNRHVVFHSDHSRF
Ga0207707_1152662123300025912Corn RhizosphereMKKRYLIAGAATVAIAGKLLLRPRDADWQKCRDAVFHSEHSCFV
Ga0207660_1043040513300025917Corn RhizosphereMKKRYWIAGAVTLGFAAKLLLRPRDADWNRNRHIVFHSDHSRF
Ga0207694_1050672823300025924Corn RhizosphereMKKRYWIAGAATLAIAGKLLLRPRDADWQKCRDVVFHSEHSCFIDIDGV
Ga0207650_1189878223300025925Switchgrass RhizosphereMKKRYWIAGAATLAVAGKLLLRPREADWNKCRDVVFHSEHSYFID
Ga0207706_1172367113300025933Corn RhizosphereMKKRYLIAGTATTAAAVAVAAKLLLRPRDADWHQNRNIIFHSDY
Ga0207686_1073219313300025934Miscanthus RhizosphereMKKRYWIAGAATLAIAGKLLTRPRDADWHKCRDVVFHSE
Ga0207709_1092802513300025935Miscanthus RhizosphereMKKRYWIAGAATLAIAGKLLTRPRDADWQKCRDVVFHSEHS
Ga0207689_1031448513300025942Miscanthus RhizosphereMMKKRYWIAGAATLAVAGKLLLRPREADWNKCREV
Ga0207651_1087761113300025960Switchgrass RhizosphereMKKRYWIAGGATAAAGLAVAVKLITRPREVDWNKNRASIFYSEHSRF
Ga0207640_1081460123300025981Corn RhizosphereMKKRYWIAGALTLGVAAKLLSRPRDADWNRNRHVVFHSDHSR
Ga0207640_1087255813300025981Corn RhizosphereMKKRYWIAGAATLAIAGKLLTRPRDADWQKCRDVVFHSEHSC
Ga0208532_101635113300026011Rice Paddy SoilMKKRFWIAGAATVAIAGKLLLRPRDADWDKCREVVFHSEHSSFIDV
Ga0207678_1127361913300026067Corn RhizosphereMKKRYWIAGTATTAAAVAVAAKLLLRPRDADWHRNRDIIFHSDYSRF
Ga0207641_1050695223300026088Switchgrass RhizosphereMKKRYWIAGAATLAVAGKLLLRPRDADWNKCRDVVFHSEHSCFVEVDGVRVH
Ga0207648_1011084723300026089Miscanthus RhizosphereMKKRYWIAGGATAAAGLAVAVKLLTRPRDVDWNKNRASIFHSEH
Ga0207676_1221828223300026095Switchgrass RhizosphereMMKKRYWIAGAATLAIAGKLLTRPRDADWQKCRDV
Ga0207698_1131255023300026142Corn RhizosphereMKKRYWIAGAATLAIAGKLLTRPRDADWQKCRDVVFHSEHSCF
Ga0209485_105674313300027691Agricultural SoilMKKRYWIAGSATAAATLAVAAKLLTRPRDADWSKNRDV
Ga0207428_1071462223300027907Populus RhizosphereMKKRYLIAGATTLAIAGKLLLRPRDADWHKCRNVIFHSDHSRFIDVDG
Ga0268265_1011494623300028380Switchgrass RhizosphereMKKRYWIAGATTLAIAGKLLLRPRDADWHKSRKVIFHSDHS
Ga0268264_1020042723300028381Switchgrass RhizosphereMKKRYWIAGAATLAVAGKLMLRPRDADWQKCRKVVFHSEHSCFIDVD
Ga0268264_1117064513300028381Switchgrass RhizosphereMKKRYWIAGAATLAVAGKLLLRPRDADWNKCRDVV
Ga0307503_1094840313300028802SoilMKKRYWIAGTATAAATLAVTAKLLARPRDADWQKNRQVVFHSEHSRFV
Ga0310887_1039833213300031547SoilMMKKRYWIAGAATLAIAGKLLTRPRDADWQKCRDVVFHSEHSCFID
Ga0310886_1016634713300031562SoilMKKRYWIAGGATAAAGLAVAVKLLTRPRDVDWNKNRASIFHSEHSRFVD
Ga0310907_1054553913300031847SoilMKKRYWIAGTATAAATLAVTAKLLARPRDADWQKNRQVVFHSEHSRFVDIDNVR
Ga0310892_1082199123300031858SoilMKKRYWIAGAVTLGFAAKLLLRPRDADWNRNRHIVFHSDHSRFV
Ga0310903_1076743713300032000SoilMKKRYWIAGGASAAAGLAVAVKLLTRPRDVDWNKNRASIFH
Ga0310810_1137450023300033412SoilMKKRYWIASTATAAATLAVTAKLLARPRDADWNKNRDVVFHSDHSRFVD

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.