Basic Information | |
---|---|
Family ID | F103852 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 101 |
Average Sequence Length | 42 residues |
Representative Sequence | GAIEVHTFDGLPEHRMVPSPSQPETMRAIDTITDFIRRQTA |
Number of Associated Samples | 96 |
Number of Associated Scaffolds | 101 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 2.97 % |
% of genes from short scaffolds (< 2000 bps) | 1.98 % |
Associated GOLD sequencing projects | 94 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (99.010 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (12.871 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.673 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.614 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.09% β-sheet: 0.00% Coil/Unstructured: 73.91% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 101 Family Scaffolds |
---|---|---|
PF09084 | NMT1 | 21.78 |
PF01594 | AI-2E_transport | 4.95 |
PF03401 | TctC | 3.96 |
PF01568 | Molydop_binding | 2.97 |
PF07883 | Cupin_2 | 1.98 |
PF00211 | Guanylate_cyc | 1.98 |
PF01717 | Meth_synt_2 | 1.98 |
PF05977 | MFS_3 | 1.98 |
PF12695 | Abhydrolase_5 | 1.98 |
PF03358 | FMN_red | 0.99 |
PF01257 | 2Fe-2S_thioredx | 0.99 |
PF01206 | TusA | 0.99 |
PF01972 | SDH_sah | 0.99 |
PF01510 | Amidase_2 | 0.99 |
PF00296 | Bac_luciferase | 0.99 |
PF09242 | FCSD-flav_bind | 0.99 |
PF08299 | Bac_DnaA_C | 0.99 |
PF07969 | Amidohydro_3 | 0.99 |
PF04191 | PEMT | 0.99 |
PF02541 | Ppx-GppA | 0.99 |
PF01738 | DLH | 0.99 |
PF05706 | CDKN3 | 0.99 |
PF02775 | TPP_enzyme_C | 0.99 |
PF02423 | OCD_Mu_crystall | 0.99 |
PF10589 | NADH_4Fe-4S | 0.99 |
PF13432 | TPR_16 | 0.99 |
COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
---|---|---|---|
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 21.78 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 21.78 |
COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 4.95 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 3.96 |
COG0248 | Exopolyphosphatase/pppGpp-phosphohydrolase | Signal transduction mechanisms [T] | 1.98 |
COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.98 |
COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 1.98 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.98 |
COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 1.98 |
COG0425 | Sulfur carrier protein TusA (tRNA thiolation, molybdenum cofactor biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.99 |
COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 0.99 |
COG1905 | NADH:ubiquinone oxidoreductase 24 kD subunit (chain E) | Energy production and conversion [C] | 0.99 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.99 |
COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 0.99 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 99.01 % |
All Organisms | root | All Organisms | 0.99 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300006865|Ga0073934_10279228 | Not Available | 1079 | Open in IMG/M |
3300009156|Ga0111538_11204766 | Not Available | 957 | Open in IMG/M |
3300014311|Ga0075322_1004192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2543 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.91% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 6.93% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.93% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.95% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 4.95% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.96% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.97% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.97% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.97% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.98% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.98% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.98% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.98% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.98% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.99% |
Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.99% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.99% |
Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.99% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.99% |
Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.99% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.99% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.99% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.99% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.99% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.99% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.99% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.99% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.99% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.99% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.99% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.99% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.99% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.99% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.99% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002124 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3 | Environmental | Open in IMG/M |
3300004020 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 | Environmental | Open in IMG/M |
3300004047 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
3300012167 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT333_2 | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Host-Associated | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300014267 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 | Environmental | Open in IMG/M |
3300014306 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D1 | Environmental | Open in IMG/M |
3300014311 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 | Environmental | Open in IMG/M |
3300014314 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2 | Environmental | Open in IMG/M |
3300014879 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_10D | Environmental | Open in IMG/M |
3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
3300020195 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.P2.IB | Environmental | Open in IMG/M |
3300021051 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1 | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026018 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027513 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes) | Environmental | Open in IMG/M |
3300027778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
3300034257 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
C687J26631_102270401 | 3300002124 | Soil | RGGTIEAQTFDGLPEHRMVPSPTQPETMRAIETITAFIRRQTG* |
Ga0055440_100608661 | 3300004020 | Natural And Restored Wetlands | ASYRKRGGVIEVHSFDGLPEHRMVPSPSQPESMRFIETVSAFIRQKAG* |
Ga0055499_100126441 | 3300004047 | Natural And Restored Wetlands | KRGGVIEVHSFDGLPEHRMAPSPSQPESMRFIDTVSAFIRQKTG* |
Ga0066678_109040941 | 3300005181 | Soil | AIEVQTFDGLPEHRMVPSPSQPETMRVIDTITAFIRRHTA* |
Ga0065707_107507651 | 3300005295 | Switchgrass Rhizosphere | RGGQIEVHTFEGLPEHRMVPSRAQPETMRAMDTIAEFIRRQT* |
Ga0070670_1003636362 | 3300005331 | Switchgrass Rhizosphere | KRGGQIEVHTFEGLPEHRMVPSRAQPETMRAMDTIAEFIRRQT* |
Ga0070671_1003995322 | 3300005355 | Switchgrass Rhizosphere | YRKRGGQIEVHTFEGLPEHRMVPSRAQPETMRAIDTIAEFIRRQT* |
Ga0066682_107875552 | 3300005450 | Soil | GAIEVHTFDGLPEHRMVPSPSQPETMRAIDTITDFIRRQTA* |
Ga0070685_106547813 | 3300005466 | Switchgrass Rhizosphere | IASYRKRGGTIEVHTFAGLPEHRMVPALNQPETMRVIDTIIGFIGRQNR* |
Ga0070665_1009803102 | 3300005548 | Switchgrass Rhizosphere | EVHTFEGLPEHRVVPSPAQPETMRAMDTITGFIERQTS* |
Ga0066698_100386601 | 3300005558 | Soil | IEVQTFDGLPEHRMVPSPSQPETMRVIDTITAFIRRHTA* |
Ga0070702_1018510382 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | GAIEVHTFDGLPEHRMVPSPDKPETLRFVDIVTEFVRRHS* |
Ga0066905_1010936811 | 3300005713 | Tropical Forest Soil | RGGAIEVHTFDGLPEHRMVPSPSQPDTMRVIDTTTTFIRRHSK* |
Ga0066905_1013973791 | 3300005713 | Tropical Forest Soil | VHTFDGLPEHRMVPSPSQPDTMRVIDTMTAFIRRHSK* |
Ga0066905_1014468651 | 3300005713 | Tropical Forest Soil | FDGLPEHRMVPSPAQPETMRAIDTIAAFIRRHTG* |
Ga0066903_1038762061 | 3300005764 | Tropical Forest Soil | VQTFEGLPEHRMVPSPAQPETMRAMDTITDFIKRQTA* |
Ga0082029_15771472 | 3300006169 | Termite Nest | EVHTFDALPEHRVVPSPSQPETMRLIDTITEFISRKAR* |
Ga0075427_100950482 | 3300006194 | Populus Rhizosphere | RFIASYRKRGGVLEDHTFEGLPEHRMVPSPDNPETMRFVDIVTAFIRRQS* |
Ga0075430_1000507854 | 3300006846 | Populus Rhizosphere | HTFEGLPEHRMVPSPDNPETMRFVDIVTAFIRRQS* |
Ga0075433_104270341 | 3300006852 | Populus Rhizosphere | KRGGQIEVHTFEGLPEHRMVPSRAQPETMRAMDIIAEFIRRQT* |
Ga0075420_1003741262 | 3300006853 | Populus Rhizosphere | FDALPEHRVVPSPSQPDTMRLIDTIAEFISRKAR* |
Ga0073934_102792282 | 3300006865 | Hot Spring Sediment | RSYRERGGAIEEHTFAGLSEHRIVPSPTMPETMRLIQAVTAFIRRQSGSLLC* |
Ga0075424_1001651251 | 3300006904 | Populus Rhizosphere | RGGQIEVHTFEGLPEHRVVPSPAQPETMRAMDIITGFIERQTA* |
Ga0075424_1014276981 | 3300006904 | Populus Rhizosphere | GTNEVHTFEGLPEHRMVPSPSEPETMRCIDVMTEFIHRQSR* |
Ga0075419_101558782 | 3300006969 | Populus Rhizosphere | GGVLEDHTFEGLPEHRMVPSPDNPETMRFVDIVTAFIRRQS* |
Ga0075435_1000437821 | 3300007076 | Populus Rhizosphere | ASYRKRGGAIEADTFDGLPEHRIVPSPEKPETMRFVDAIAAFIRRHGA* |
Ga0099791_102352141 | 3300007255 | Vadose Zone Soil | TFEGLPEHRMVPSPDNPETMRFIDIVTAFIRRQTA* |
Ga0105107_111447462 | 3300009087 | Freshwater Sediment | GAIEVHAFDGLPDPRMVPSPEQPETMRFIDIVSAFISAKA* |
Ga0111539_123846791 | 3300009094 | Populus Rhizosphere | IEVHTFEGLPEHRMVSSRAQPETMRAMDIIAEFIRRQT* |
Ga0075418_119772541 | 3300009100 | Populus Rhizosphere | FDGLPEHRMVPSPSQPDTMRAIDTITAFIRRQTG* |
Ga0114129_105684553 | 3300009147 | Populus Rhizosphere | IEVHTFDGLPEHRMVPSPSEPETMRVIDTITAFIRRQAG* |
Ga0111538_112047661 | 3300009156 | Populus Rhizosphere | RFIASYRKRGGVLEEHTFEGLPEHRMVPSPDNPETMRFIDIVTAFIRRQTR* |
Ga0105248_107978992 | 3300009177 | Switchgrass Rhizosphere | SYRKRGGQIEVHTFEGLPEHRVVPSPAQPETMREMDIITGFIERQTA* |
Ga0105237_117574601 | 3300009545 | Corn Rhizosphere | GQIEVHTFEGLPEHRVVPSPAQPETMRAMDTITGFIERQTS* |
Ga0126374_114732502 | 3300009792 | Tropical Forest Soil | IEVDTFDGLPEHRIVPSPDKPETMRFVDAITAFIRWHA* |
Ga0126382_123444882 | 3300010047 | Tropical Forest Soil | ASYRKCGGAIEVHTFDGLPEHRMVPSPDQPDTMRCMETITTFIRRYS* |
Ga0126377_123396472 | 3300010362 | Tropical Forest Soil | IASYRKRGGAIEVHTFDGLPEHRMVPSPSQPDTMRVIDTMTAFIRRHNK* |
Ga0137452_10352831 | 3300011441 | Soil | KRGGPIEVHTFNGLPEHRMVPSPIEPETMRFIDIVSTFIWRQTK* |
Ga0137437_11830462 | 3300011442 | Soil | RGGAIEVHTFDGLPEHRMVPSPSEPETMRFIDTVSAFIGRQNK* |
Ga0137319_10976062 | 3300012167 | Soil | EVHTFDGLPEHQMVPSPAQPETMRAMETMTTFIRRQTG* |
Ga0137382_111977971 | 3300012200 | Vadose Zone Soil | QTFDGLPEHRMVPSTSQPETMRAIDTITTFIRCQTE* |
Ga0137362_111213152 | 3300012205 | Vadose Zone Soil | AIEVHTFDGLPEHRMVPSPSQPETMRAIDTITDFIRRQTA* |
Ga0137378_107346741 | 3300012210 | Vadose Zone Soil | SYRKRGGAIEVQTFDGLPEHRMVPSSSQPETMRAIDTITAFIRRQTG* |
Ga0137370_100533254 | 3300012285 | Vadose Zone Soil | FEGLPEHRMVPSPSQPETMRAIDTITGFIRRQGA* |
Ga0157316_10768251 | 3300012510 | Arabidopsis Rhizosphere | IEVQTFDGLPEHRMVPSPDQPQTIRAIETSTGFIRRQTG* |
Ga0137394_100285721 | 3300012922 | Vadose Zone Soil | YRKRGGAIEVQTFNGLPEHRMVPSTSQPETMRAIDTITTFIRRQFE* |
Ga0137407_100552281 | 3300012930 | Vadose Zone Soil | TFDGLPEHRMVPSPSQPETMHAIETITAFIRRQTG* |
Ga0164300_100642512 | 3300012951 | Soil | GGQLEVHKFEGLPEHRMVPSRAQPETMRAIDTIAEFIRRQT* |
Ga0134087_105163182 | 3300012977 | Grasslands Soil | RKRGGAIEVHTFDGLPEHRMVPSPSQPETMRAIDTITDFIRRQTA* |
Ga0164304_111456551 | 3300012986 | Soil | HTFEGLPEHRMVPSPSQPETMHLIDTITTFIRRQTA* |
Ga0075313_11812931 | 3300014267 | Natural And Restored Wetlands | YQKRGGAIEVHTFTGLPEHGMVPSPSKPETMRAIEIIAAFIRQHGG* |
Ga0075346_11294211 | 3300014306 | Natural And Restored Wetlands | IEVHTLDGLPEHRMVPSPSEPETMRFIDIVRGFIAAKG* |
Ga0075322_10041924 | 3300014311 | Natural And Restored Wetlands | FIASYRKRGGAIEAHTFEGLPEHRMVPSPDKPETMRFMDLVTAFIRRHSA* |
Ga0075316_11747991 | 3300014314 | Natural And Restored Wetlands | KRGGAIEVHTFEGLPEHRMVPSPDKPETMRFIDTVTDFIRRQTT* |
Ga0180062_11503612 | 3300014879 | Soil | SYRKRGGAIEVHTFDGLPEHRMVPSPSQPETMRAIGTITAFITAKA* |
Ga0173478_103179182 | 3300015201 | Soil | RKRGGQIEVHTFEGLPEHRVVPSPAQPETMRAMDTITGFIERQTS* |
Ga0132255_1014797291 | 3300015374 | Arabidopsis Rhizosphere | FIASYRKRGGQIEVHTFEGLPEHRIVPSPAQPETMRAMDTITEFVRRQA* |
Ga0134083_102468961 | 3300017659 | Grasslands Soil | RKRGGPIEAQTFDGLPEHRMVPSPSQPETMRAIDTITGFIRRQSA |
Ga0184610_11176471 | 3300017997 | Groundwater Sediment | FIASYRKRGGAIEVHTFEGLPEHRMVPSPAQPETMRAMETITTFIRRQTA |
Ga0184610_12556231 | 3300017997 | Groundwater Sediment | GAIEVHTFDGLPEHRMVPSPSQPETMRVIDTITAFIRRQS |
Ga0184638_10369501 | 3300018052 | Groundwater Sediment | KRGAAIEVHTFDGLPEHRMVPSPAQPETMRVIDTITAFIRRQTA |
Ga0184626_101170841 | 3300018053 | Groundwater Sediment | KRGGTIEVQTFDGLPEHRMVPSPSQPETMRAIDTITAFIRRQTG |
Ga0184640_104306892 | 3300018074 | Groundwater Sediment | GGAIEAQTFDGLPEHRIVQSPTQPATMRLIETITAFIRRQTPAWSAEQLQV |
Ga0184633_105459172 | 3300018077 | Groundwater Sediment | VHTFDGLPEHRMVPSPSQPETMRAIDTISAFIQRQTG |
Ga0184625_104398772 | 3300018081 | Groundwater Sediment | RKRGAAIEVHTFDGLPEHRMVPSPAQPETMRVIDTITAFIRRQTA |
Ga0190265_115328391 | 3300018422 | Soil | IEVHTFDGLPEHRVVPSPSQPDTMRLIDTITAFISNKA |
Ga0190275_100158111 | 3300018432 | Soil | RGGAIEVDTFDGLPEHRMVPSPSEPETMRFIEVVSAFIRQQSK |
Ga0190270_113366412 | 3300018469 | Soil | AIEVHTFDGLPEHRMVPSPSEPETMRFIDIVSAFIGRQT |
Ga0184646_15886922 | 3300019259 | Groundwater Sediment | ASYRKRGGAIEAQTFDGLPEHRMVPSPSQPETMRAMDTINGFIRRHSG |
Ga0193707_11827102 | 3300019881 | Soil | KRGGVLEDHTFEGLPEHRMVPSADQPETMRFIDIVTAFIRRQAA |
Ga0163150_101404612 | 3300020195 | Freshwater Microbial Mat | ITSYRKRGGAIEVDTFDGLPEHRMVPSPDQPETMRFIDAVSAFIAAKT |
Ga0206224_10019241 | 3300021051 | Deep Subsurface Sediment | ASYRKRGGAIEVHTFDNLPEHRMVPSASQPETMRVIDTITAFVRRQTG |
Ga0210378_100182861 | 3300021073 | Groundwater Sediment | RGGAIEVHTFDGLPEHRMVPSPAQPETMRCMETITTFIRRQTA |
Ga0126371_115797102 | 3300021560 | Tropical Forest Soil | EVQTFEGLPEHRMVPSPAQPETMRAMDTITDFIKRQTA |
Ga0207657_112103042 | 3300025919 | Corn Rhizosphere | RKRGGAVEVHTFDGLPEHRMVPSPDKPETVRFIDIVTEFIRRHS |
Ga0207690_118689261 | 3300025932 | Corn Rhizosphere | GQIEVHTFEGLPEHRVVPSPAQPETMRAMDTITGFIERQTS |
Ga0207640_115763012 | 3300025981 | Corn Rhizosphere | FIASYRKRGGQIEVHTFEGLPEHRVVPSPAQPETMRAMDTITGFIERQTS |
Ga0208418_10094912 | 3300026018 | Natural And Restored Wetlands | VHSFAGLPEHRMVPSPSQPESMRFIETVSVFIRQKTG |
Ga0208685_10562392 | 3300027513 | Soil | VHTFDGLPEHRMVPSPDQPETMRFIDIVSAFIQQQTK |
Ga0209464_100785413 | 3300027778 | Wetland Sediment | AIEVHSFDGLPEHRMVPSPSEPETMRFIDIVSAFIRRQAR |
Ga0209726_103711302 | 3300027815 | Groundwater | HSFDGLPEHRMVPSPSQPETMRFIEIVSAFIQQQAN |
Ga0209683_101110891 | 3300027840 | Wetland Sediment | VHTFDGLPEHRMVPSPSQPESMRFIDIVRTFIGQQPG |
Ga0209974_104436311 | 3300027876 | Arabidopsis Thaliana Rhizosphere | IEVHSFDGLPEHGMVPSPSEPETMRVIDTIAAFIRRQS |
Ga0209481_102866711 | 3300027880 | Populus Rhizosphere | GGVLEDHTFEGLPEHRMVPSPDNPETMRFVDIVTAFIRRQS |
Ga0268265_105422651 | 3300028380 | Switchgrass Rhizosphere | GVLEDHTFEGLPEHRMVPSPDMPETMRFIDIVTGFIRRHAV |
Ga0268265_114689991 | 3300028380 | Switchgrass Rhizosphere | RGGQIEVHTFEGLPEHRVVPSPAQPETMRAMDTITGFIERQTS |
Ga0307305_104271471 | 3300028807 | Soil | ASYRKRGGAIEVHTFDGLPEHRMVPSPSQPETMRAIDTITDFIRRQTA |
Ga0302046_108954272 | 3300030620 | Soil | HTFNGLPEHRMTPSPGQPETMRVIDTIMTFIRRQTGWRLGTEVR |
Ga0299913_102309051 | 3300031229 | Soil | EVHTFAGLPEHRMVPSPNQPDTMRVIDTITAFIQRQTA |
Ga0247727_110176322 | 3300031576 | Biofilm | AETFDGLPENRMVPSPSQPETTRFIETVTAFIRRQTG |
Ga0306918_104699232 | 3300031744 | Soil | RKRGGQIEVHTFEGLPEHRMVPSPAQPETMRAMDTITDFIKRQTA |
Ga0307473_105813421 | 3300031820 | Hardwood Forest Soil | RGGAIEVETFDGLPEHRMVPSPSQPETMRAIDTITAFVRRQTT |
Ga0310897_100872611 | 3300032003 | Soil | GQIEVHTFEGLPEHRMVPSCAQPETMRAMDTIAEFIRRQT |
Ga0306924_104512671 | 3300032076 | Soil | FIASYRKRGGRIEVQTFEGLPEHRMVPSPAQPETMRAMDTITDFIKRQTA |
Ga0335085_114887612 | 3300032770 | Soil | SYRKRGGANDVHTFEGLPEHRMVPSPDQPETMRCIDTITAFIRRHTV |
Ga0214471_111662422 | 3300033417 | Soil | ASYRKRGGAIEVHTFEGLPEHRMVPSPSQPETMRVIETITTFIRRQTG |
Ga0316613_102760161 | 3300033434 | Soil | IASYRKRGGAIEVHTFDGLPEHRMVPSPDQPETMRFIDIVSAFISAKA |
Ga0316627_1004865102 | 3300033482 | Soil | RKRGGAIEVHTFDGLPEHRMVPSPDQPETMRFIDIVSAFISAKA |
Ga0364942_0136308_658_798 | 3300034165 | Sediment | YRKRGGAIEVHSFDGLPEHRMVPSPSQPETMRAIETITEFVRRQTG |
Ga0364934_0240413_2_109 | 3300034178 | Sediment | HTFDSLPEHRMVPSPSQPETMRFIDIVSTFITAKT |
Ga0370495_0339493_382_495 | 3300034257 | Untreated Peat Soil | VHTFDGLPEHRMVPSPSQPETMRFIDIVSAFVRQRTG |
⦗Top⦘ |