| Basic Information | |
|---|---|
| Family ID | F103806 |
| Family Type | Metagenome |
| Number of Sequences | 101 |
| Average Sequence Length | 48 residues |
| Representative Sequence | AKEMMEARVDAVFDSIRTDREFVALTRGADGRLPIPMKGMPATQATPNR |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 4.95 % |
| % of genes from short scaffolds (< 2000 bps) | 4.95 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (96.040 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (29.703 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.594 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (61.386 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.47% β-sheet: 0.00% Coil/Unstructured: 67.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF00009 | GTP_EFTU | 13.86 |
| PF02604 | PhdYeFM_antitox | 9.90 |
| PF14384 | BrnA_antitoxin | 8.91 |
| PF03551 | PadR | 5.94 |
| PF03144 | GTP_EFTU_D2 | 4.95 |
| PF00903 | Glyoxalase | 2.97 |
| PF12681 | Glyoxalase_2 | 2.97 |
| PF06769 | YoeB_toxin | 2.97 |
| PF13620 | CarboxypepD_reg | 2.97 |
| PF16277 | DUF4926 | 1.98 |
| PF12441 | CopG_antitoxin | 1.98 |
| PF04365 | BrnT_toxin | 0.99 |
| PF00730 | HhH-GPD | 0.99 |
| PF00078 | RVT_1 | 0.99 |
| PF03483 | B3_4 | 0.99 |
| PF10576 | EndIII_4Fe-2S | 0.99 |
| PF00515 | TPR_1 | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 9.90 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 9.90 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 5.94 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 5.94 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 5.94 |
| COG4115 | Toxin component of the Txe-Axe toxin-antitoxin module, Txe/YoeB family | Defense mechanisms [V] | 2.97 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.99 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.99 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.99 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.99 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.99 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 96.04 % |
| All Organisms | root | All Organisms | 3.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005167|Ga0066672_10171989 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300005544|Ga0070686_100964810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
| 3300006797|Ga0066659_10681594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 839 | Open in IMG/M |
| 3300015374|Ga0132255_102552458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 781 | Open in IMG/M |
| 3300025941|Ga0207711_10668079 | Not Available | 969 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 29.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.96% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.97% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.97% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.98% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.99% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.99% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.99% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.99% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.99% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011433 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4A_09014860 | 2170459003 | Grass Soil | MEARVDAVFESIRTDREFVALTKDADGRLPIPMKGMPATQASPNR |
| Ga0062590_1015078311 | 3300004157 | Soil | VDAVFESIRTDRDFIALTRGADGKLPIPMKGMPATMASPNR* |
| Ga0066672_101719894 | 3300005167 | Soil | HFFQYERYQSVRAKEMMEARVDAVFDSIRTDREFVALTRGADGRLPIPMKGMPATQATPNR* |
| Ga0066680_107382782 | 3300005174 | Soil | YERYQSVRAKEMMEARVDAVFDSIRTDREFVALTRNADGRLPIPMKGMPATQATPNR* |
| Ga0066679_107359362 | 3300005176 | Soil | MMEARVDAVFDSIRTDREFVALTRGADGRLPIPMKGMPATQATPNR* |
| Ga0066684_109726811 | 3300005179 | Soil | RVDAVFESIRTDGDFVALTHNADGRLPIPMKGMPATQATPNR* |
| Ga0066678_107700013 | 3300005181 | Soil | SVRAKEMMEARVDAVFDSIRADQSFIALTKGADGRLPMPMKGMPASATPNR* |
| Ga0066671_104645512 | 3300005184 | Soil | EARVDAVFNSIRTDREFVALTKGADGRLPIPMKGMPATQATPNR* |
| Ga0066671_105501532 | 3300005184 | Soil | KEMMEARVDAVFDSIRTDREFVALTSGADGKLPIPVKGMPATQAGPKR* |
| Ga0070690_1001032574 | 3300005330 | Switchgrass Rhizosphere | VREKEMMEARVDAVFESIRTDKEFVALTKDADGRLPIPMKGMPATQAQPNR* |
| Ga0070689_1003360121 | 3300005340 | Switchgrass Rhizosphere | EMMEARVDAVFESIRTDRDFIALTRGADGKLPIPMKGMPATMASPNR* |
| Ga0070669_1014230352 | 3300005353 | Switchgrass Rhizosphere | VREKEMMEARVDAVFDSIRFDQEFVALTRGADGKLPVPMKGMPATQAMPRQ* |
| Ga0070709_105490331 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | RAKEMMEARVDAVFESIRFDREFVALTNGADGRLPIPMKGMPATQATPNR* |
| Ga0070710_106253021 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VDAVFESIRTDKEFVALTKDADGRLPIPMKGMPATMATPNR* |
| Ga0070708_1003652701 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | EARVDAVFDSIRTDREFIALTEGADGKLPIPMKGMPGTGSRDNK* |
| Ga0070708_1012720061 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | RYQAVRTKEMMEARVDAVFDSIRTDREFVALTRGADGKLPVPMKGMPATQANPNR* |
| Ga0066686_110830431 | 3300005446 | Soil | EARVDAVFDSIRTDREFVALTRGADGRLPIPMKGMPATQATPNR*DVFYVNV* |
| Ga0070699_1004641843 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | TKEMMEARVDAVFDSIRTDREFVALTRGADGKLPVPMKGMPATQANPNR* |
| Ga0070699_1018480981 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | ARVDAVFDSIRSDREFIALTKGADGRLPIPMKGMPATQASPNR* |
| Ga0070697_1018593601 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VRAKEMMEARVDAVFDSLRADPGFIALTRNADGRLPMPLKGMSSTRPND* |
| Ga0070686_1009648102 | 3300005544 | Switchgrass Rhizosphere | FQYERYQAVREKEMMEARVDAVFDSIRFDQEFVALTQGTDGKLPVPMKGMPATQAMPRQ* |
| Ga0070695_1010738251 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | KEMMEARVDAVFDSIRFDQEFVALTRGADGKLPVPMKGMPATQAMPRQ* |
| Ga0070696_1018996852 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MEARVDAVFDSIRTDRDFIALTKGADGKLPIPMKGMPATQASPNR* |
| Ga0070693_1010392492 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | RYHAVREKEMMEARVDAVFESIRTDREFVALTKDADGRLPIPMKGMPATQAQPNR* |
| Ga0066695_101722944 | 3300005553 | Soil | FDSIRTDREFVALTRGADGRLPIPMKGMPATQATPNR* |
| Ga0066698_110339462 | 3300005558 | Soil | VRAKEMMEARVDAVFESIRTDREFIALTRGADGKLPIPMKGMPATQATPNR* |
| Ga0068864_1020350112 | 3300005618 | Switchgrass Rhizosphere | IRTDRDFIALTRGADGKLPIPMKGMSATMASPNR* |
| Ga0068866_108141741 | 3300005718 | Miscanthus Rhizosphere | VDAVFDSIRFDHEFVALTKGADGKLPIPMKGMPATQATPNR* |
| Ga0066903_1008739833 | 3300005764 | Tropical Forest Soil | AVFESIRADRDFVALTRGADGRLPIPMKGMPATMATPNR* |
| Ga0066652_1012019361 | 3300006046 | Soil | DSIRTDREFVALTRGADGRLPIPMKGMPATQATPNR* |
| Ga0070716_1000349485 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | YERYQSVRAKEMMEARVDAVFESIRFDREFVALTNGADGRLPIPMKGMPATQATPNR* |
| Ga0066665_112488102 | 3300006796 | Soil | AVFDSIRSDRQFIALTKGADGRLPIPMKGMPATQASPNR* |
| Ga0066659_106815942 | 3300006797 | Soil | FFQYERYQSVRAKEMMEARVDAVFDSIRSDRDFVALTRGADGRLPIPMKGMPATQATPNR |
| Ga0066660_102787422 | 3300006800 | Soil | VRAKEMMEARVDAVFNSIRTDGEFVALTKGADGRLPIPMKGMPATQATPNR* |
| Ga0075425_1012116651 | 3300006854 | Populus Rhizosphere | VRAKEMMEARVDAVFESIRTDREFVALTKGADGRLPIPMKGMPATQAMPNR* |
| Ga0075426_107199202 | 3300006903 | Populus Rhizosphere | AKEMMEARVDAVFDSIRTDREFVALTRGADGRLPIPMKGMPATQATPNR* |
| Ga0075424_1013395813 | 3300006904 | Populus Rhizosphere | AVFESIRTDKEFVALTKDADGRLPIPMKGMPATQAQPNR* |
| Ga0097620_1000139291 | 3300006931 | Switchgrass Rhizosphere | KEMMEARVDAVFESIRTDRDFIALTRGADGKLPIPMKGMPATMASPNR* |
| Ga0079218_133118371 | 3300007004 | Agricultural Soil | EMMEARVDAMFDSIRFDRHFIALTRNADGKLPVPMKGMPATQAMPHR* |
| Ga0066710_1002427446 | 3300009012 | Grasslands Soil | SVVAVFATISTDHEFIALTLGVDGKLPIPMKGMPATKATPNR |
| Ga0066710_1012822722 | 3300009012 | Grasslands Soil | YQSVRAKEMMEARVDAVFESIRTDREFVALTRNADGRLPIPIKGMPATQATPNR |
| Ga0066710_1045571331 | 3300009012 | Grasslands Soil | VHEKEMMEARVDAVFDSIRAEHAYIALTSGADGKLPIPMKGMPASQASPNR |
| Ga0099829_107412551 | 3300009038 | Vadose Zone Soil | RAKEMMEARVDAVFDSIRTDREFIALTKGADGRLPIPMKGMGSGSRENK* |
| Ga0099829_113323831 | 3300009038 | Vadose Zone Soil | RAKEMMEARVDAVFDSIRTDREFIALTKGADGRLPIPMKGMPATQASPNR* |
| Ga0099830_110868991 | 3300009088 | Vadose Zone Soil | FKYERYSSVRAKEMMEARVDAVFDSIRTDREFVALTRGADGRLPIPMKGMPATLASPNR* |
| Ga0099828_115750492 | 3300009089 | Vadose Zone Soil | RAKEMMEARVDAVFDSIRTDREFIALTKGADGKLPIPMKGMPATQASPNR* |
| Ga0066709_1011141211 | 3300009137 | Grasslands Soil | KEMMEACVDAVFDSIRADHAFIALTSGADGKLPIPMKGMPASQASPNR* |
| Ga0066709_1011571241 | 3300009137 | Grasslands Soil | DAVFDSIRTDREFVALTRGADGKLPIPMKGMPATQATPNR* |
| Ga0099792_101875054 | 3300009143 | Vadose Zone Soil | KEMMEARVDAVFESIRTDREFIALTNGADGKLPIPMKGMPATQASPNR* |
| Ga0105243_109052554 | 3300009148 | Miscanthus Rhizosphere | EMMEARVDAVFESIRTDREFVALTKDADGRLPIPMKGMPATQAGTPNR* |
| Ga0075423_106935021 | 3300009162 | Populus Rhizosphere | EMMEARVDAVFDSIRFDQEFVALTRGADGKLPVPMKGMPATQAMPRQ* |
| Ga0126309_111543221 | 3300010039 | Serpentine Soil | KEMMEARVDAMFDSIRFDRDFIALTHGADGKLPVPMKGMPATQAMPHR* |
| Ga0126384_107349102 | 3300010046 | Tropical Forest Soil | YERYQAVREKEMMEARVDAVFDSIRFDQEFVALTRGADGKLPVPMKGMPATQAMPRQ* |
| Ga0099796_100838663 | 3300010159 | Vadose Zone Soil | SIRTDREFVALTRNADGRLPIPMKGMPATQASPNR* |
| Ga0134109_101901401 | 3300010320 | Grasslands Soil | VRAKEMMEARVDAVFDSIRSDKEFVALTKNADGRLPIPMKGMPATQANPNR* |
| Ga0126378_111395141 | 3300010361 | Tropical Forest Soil | KEMMEARVDAVFESIRTDREFVALTKDADGRLPIPMKGMPATQASPNR* |
| Ga0126379_100788973 | 3300010366 | Tropical Forest Soil | MMEARVDAVFESIRTDREFVALTKDADGRLPIPMKGMPATQASPNR* |
| Ga0126379_138778161 | 3300010366 | Tropical Forest Soil | EARVDAVFESIRTDRDFVALTKNADGRLPIPMKGMPATQASPNR* |
| Ga0105239_125673841 | 3300010375 | Corn Rhizosphere | ARVDAVFESIRTDREFGALTKHAEGRLPIPMKGMPATQATPNR* |
| Ga0134124_1000958511 | 3300010397 | Terrestrial Soil | YERYQAVREKEMMEARVDAVFDSIRFDREFVALTRGADGKLPVPMKGMPATQATPR* |
| Ga0134122_107094432 | 3300010400 | Terrestrial Soil | VREKEMMEARVDAVFDSIRFDHEFVALTKGADGKLPIPMKGMPATQATPNR* |
| Ga0134122_113805601 | 3300010400 | Terrestrial Soil | KEMMEARVDAVFNSIRTDGEFVALTKDADGRLPIPMKGMPATMAQPNR* |
| Ga0137393_109322461 | 3300011271 | Vadose Zone Soil | KEMMEARVDAVFDSLRTDSAFLALTSGADGRLPMPMKGVAEPARMNR* |
| Ga0137443_12214452 | 3300011433 | Soil | EKEMMEARVDAVFDSIRFDKDFIALTSGADGKLPVPMKGMPATQASPNR* |
| Ga0137389_117425772 | 3300012096 | Vadose Zone Soil | EARVDAVFDSIRTDREFIALTKGADGRLPIPMKGMPATQASPNR* |
| Ga0137388_106747473 | 3300012189 | Vadose Zone Soil | RVDAVFDSIRTDREFIALTKGADGKLPIPMKGMPATQASPNR* |
| Ga0137388_119992031 | 3300012189 | Vadose Zone Soil | RAKEMMEARVDAVFDSIRSDREFIALTKGADGRLPIPMKGMPATQASPNR* |
| Ga0137399_116989712 | 3300012203 | Vadose Zone Soil | VFDSIRADHAFIALTSGADGKLPIPMKGMPASQASPNR* |
| Ga0137380_105059381 | 3300012206 | Vadose Zone Soil | ARVDAVFEFIRTDRKFVALTKGADGRLPIPMKGMPATQATPNR* |
| Ga0137376_115836881 | 3300012208 | Vadose Zone Soil | DAVFESIRTDREFVALTHDADGRLPIPMKGMPATQATPNR* |
| Ga0137378_102069712 | 3300012210 | Vadose Zone Soil | VRAKEMMEARVDAVFESIRTDREFVALTKGADGRLPIPMKGMSATQATPIR* |
| Ga0137377_101319404 | 3300012211 | Vadose Zone Soil | YQAVRAKEMMEARVDAVFDSIRTDREFVALTRGADGKLPIPMKGMPATQATPNR* |
| Ga0137377_111762851 | 3300012211 | Vadose Zone Soil | FFQYERYGAVREKEMMEARVDAVFDSIRADHAFIALTSGADGKLPIPMKGMPASQASPNR |
| Ga0137372_101103551 | 3300012350 | Vadose Zone Soil | YQSVRAKEMMEARVDAVFDSIRSDQAFIALTRGADGRLPMPMKGMGTR* |
| Ga0137372_105786911 | 3300012350 | Vadose Zone Soil | KEMMEARVDAVFESIRTDREFVALTRNADGRLPIPMKGMPATQATPNR* |
| Ga0137372_110039972 | 3300012350 | Vadose Zone Soil | DAVFDSIRTDREFVALTSGADGRLPIPMKGMPATQATPNR* |
| Ga0137369_108370241 | 3300012355 | Vadose Zone Soil | KEMMEARVDAVFESIRSDQAFMALTRGADGKLPMPMKGMPASASPNR* |
| Ga0137371_107324772 | 3300012356 | Vadose Zone Soil | FDSIRTDREFVALTRGADGRLPIPMKGMPATQASPNR* |
| Ga0137368_101105391 | 3300012358 | Vadose Zone Soil | EARVDAVFDSIRTDREFIALTRGADGRLPIPMKGMPATQATPNR* |
| Ga0137398_112643881 | 3300012683 | Vadose Zone Soil | IRSDRAFIALTNGADGKLPIPMKGMPATQASPNR* |
| Ga0137397_101944712 | 3300012685 | Vadose Zone Soil | YERYQAVREKEMMEARVDAVFDSIRTDRAFIALTSGADGKLPIPMKGMPASQASPNR* |
| Ga0137397_111874092 | 3300012685 | Vadose Zone Soil | RVDAVFDSLRTDRAFIALTNGADGKLPIPMKGMPATQASPNR* |
| Ga0137419_119243511 | 3300012925 | Vadose Zone Soil | KKEMMEARVDAVFDSIRTDHAFIALTSGADGKLPIPMKGMPASQASPNR* |
| Ga0137416_117590672 | 3300012927 | Vadose Zone Soil | YQAVRSKEMMEARVDAVFNSLRQDSAFLALTRDVDGRLMMPMKGMPATQATPNR* |
| Ga0137404_116273712 | 3300012929 | Vadose Zone Soil | YQSVRAKEMMEARVDAVFESIRTDREFVALTRNADGRLPIPMKGMPATQASPNR* |
| Ga0137407_104448551 | 3300012930 | Vadose Zone Soil | RHFFQYERYRPVREKEMMEARVDAVFESIRTAREFIALTNGADGKLPIPMKGMPATQASPNR* |
| Ga0137407_121669941 | 3300012930 | Vadose Zone Soil | KEMMEARVDAVFDSIRADHAFIALTSGADGKLPIPMKGMPASQASPNR* |
| Ga0157380_106071934 | 3300014326 | Switchgrass Rhizosphere | MEARVDAVFESIRTDRDFLALTKGADGKLPIPMKGMPATMASPNR* |
| Ga0132255_1001499957 | 3300015374 | Arabidopsis Rhizosphere | VDAVFDSVRFDQEFIALTKGADGKLPVPMKGMPATQAMPNQ* |
| Ga0132255_1025524582 | 3300015374 | Arabidopsis Rhizosphere | HFFQYERYQAVRTKEMMEARVDAVFESIRTDRDFIALTRGADGKLPIPMKGMPATMASPNR* |
| Ga0182033_107199161 | 3300016319 | Soil | QSVRAKEMMEARVDAVFESIRTDREFVALTSDADGRLPIPMKGMPASQASPNR |
| Ga0190272_130663512 | 3300018429 | Soil | VDAMFDSIRFDRDFIALTHGADGKLPVPMKGMPATQAMPHR |
| Ga0193729_10041686 | 3300019887 | Soil | KEMMEARVDAVFDSIRTDREFVALTKNADGRLPIPMKGMPATQASPNR |
| Ga0193724_10637371 | 3300020062 | Soil | QYERYRAVREKEMMEARVDAVFESIRTDREFVALTNGADGKLPIPMKGMPATQASPNR |
| Ga0210404_103376462 | 3300021088 | Soil | YNSVRAKEMMEARVDAVFDSIRTDREFIELTKDADGRLPIPMKGMPATQASPHR |
| Ga0207684_114544892 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | FESIRTDREFVALTSGADGKLPIPMKGMPATQASPNR |
| Ga0207687_114756361 | 3300025927 | Miscanthus Rhizosphere | VRTKEMMEARVDAVFESIRTDRDFIALTRGADGKLPIPMKGMPATMASPNR |
| Ga0207670_110949821 | 3300025936 | Switchgrass Rhizosphere | ARVDAVFDSIRFDQEFVALTQGTDGKLPVPMKGMPATQAMPRQ |
| Ga0207711_106680791 | 3300025941 | Switchgrass Rhizosphere | RRHFFQYERYQAVRTKEMMEARVDAVFESIRTDRDFIALTRGADGKLPIPMKGMPATMASPNR |
| Ga0307469_101537991 | 3300031720 | Hardwood Forest Soil | MMEARVDAVFESIRTDREFIALTRGADGKLPIPMKGMPATQATPNR |
| Ga0307472_1022382452 | 3300032205 | Hardwood Forest Soil | ERYQAVRTKEMMEARVDAVFESIRTDRDFVALTRGADGKLPIPMKGMPATMASPNR |
| ⦗Top⦘ |