| Basic Information | |
|---|---|
| Family ID | F103795 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 42 residues |
| Representative Sequence | GKTTVNRWKRGDVEFEARGSSHSARNVGQAVDVVLVALKP |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.99 % |
| % of genes near scaffold ends (potentially truncated) | 99.01 % |
| % of genes from short scaffolds (< 2000 bps) | 97.03 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (7.921 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.624 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (54.455 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 29.41% Coil/Unstructured: 70.59% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF13520 | AA_permease_2 | 92.08 |
| PF00311 | PEPcase | 1.98 |
| PF07690 | MFS_1 | 0.99 |
| PF02781 | G6PD_C | 0.99 |
| PF00587 | tRNA-synt_2b | 0.99 |
| PF01979 | Amidohydro_1 | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG2352 | Phosphoenolpyruvate carboxylase | Energy production and conversion [C] | 1.98 |
| COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908032|Perma_A_C_ConsensusfromContig36631 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300002561|JGI25384J37096_10158692 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300004643|Ga0062591_102833153 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005330|Ga0070690_100265755 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300005340|Ga0070689_101631938 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300005364|Ga0070673_100772668 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300005364|Ga0070673_101269318 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300005437|Ga0070710_10300156 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300005467|Ga0070706_101405769 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300005518|Ga0070699_101952323 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300005526|Ga0073909_10715847 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300005543|Ga0070672_100329487 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
| 3300005546|Ga0070696_101490060 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300005553|Ga0066695_10430906 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300005554|Ga0066661_10302213 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300005560|Ga0066670_10131551 | All Organisms → cellular organisms → Bacteria | 1442 | Open in IMG/M |
| 3300005576|Ga0066708_10862971 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300005616|Ga0068852_102316437 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300005713|Ga0066905_100055906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2448 | Open in IMG/M |
| 3300005764|Ga0066903_103270171 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300005844|Ga0068862_100230095 | All Organisms → cellular organisms → Bacteria | 1681 | Open in IMG/M |
| 3300006031|Ga0066651_10462738 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300006042|Ga0075368_10113241 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300006049|Ga0075417_10478753 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300006173|Ga0070716_100126603 | All Organisms → cellular organisms → Bacteria | 1608 | Open in IMG/M |
| 3300006578|Ga0074059_12066949 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300006796|Ga0066665_10262556 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
| 3300006881|Ga0068865_101490730 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300006903|Ga0075426_10682987 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300007076|Ga0075435_100358586 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
| 3300007076|Ga0075435_100481422 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300007076|Ga0075435_101140857 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300009012|Ga0066710_100932470 | All Organisms → cellular organisms → Bacteria | 1338 | Open in IMG/M |
| 3300009088|Ga0099830_10378400 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300009089|Ga0099828_11160028 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300009098|Ga0105245_11121933 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300009101|Ga0105247_10440810 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300009101|Ga0105247_10889873 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300009147|Ga0114129_10724137 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300009156|Ga0111538_10012020 | All Organisms → cellular organisms → Bacteria | 11444 | Open in IMG/M |
| 3300009177|Ga0105248_10202609 | All Organisms → cellular organisms → Bacteria | 2236 | Open in IMG/M |
| 3300010304|Ga0134088_10544623 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300010323|Ga0134086_10151281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300010329|Ga0134111_10295226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300010329|Ga0134111_10345566 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300010360|Ga0126372_12397081 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300010401|Ga0134121_10652833 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300010403|Ga0134123_10505897 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300010403|Ga0134123_10967010 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300011271|Ga0137393_10677352 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300012199|Ga0137383_10187282 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
| 3300012349|Ga0137387_11015855 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300012908|Ga0157286_10074072 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300012912|Ga0157306_10104075 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300012977|Ga0134087_10580192 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300012989|Ga0164305_11014168 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300015201|Ga0173478_10479374 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300015245|Ga0137409_11280675 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300015371|Ga0132258_12389389 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300015372|Ga0132256_101128465 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300015373|Ga0132257_102126625 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300015374|Ga0132255_100511873 | All Organisms → cellular organisms → Bacteria | 1765 | Open in IMG/M |
| 3300017947|Ga0187785_10093422 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300017961|Ga0187778_11043576 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300018431|Ga0066655_10100607 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| 3300022756|Ga0222622_10674867 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300024219|Ga0247665_1072563 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300025900|Ga0207710_10416192 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300025903|Ga0207680_10660060 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300025906|Ga0207699_10810768 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300025908|Ga0207643_10149032 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
| 3300025910|Ga0207684_11133868 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300025925|Ga0207650_10415179 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300025926|Ga0207659_10682222 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300025931|Ga0207644_11062451 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300025935|Ga0207709_11219767 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300025939|Ga0207665_10158519 | All Organisms → cellular organisms → Bacteria | 1626 | Open in IMG/M |
| 3300025940|Ga0207691_10324021 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300025941|Ga0207711_10826032 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300025941|Ga0207711_11875661 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300025986|Ga0207658_11411214 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300026023|Ga0207677_11143040 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300026142|Ga0207698_10371254 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
| 3300026557|Ga0179587_11171887 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300027903|Ga0209488_11127765 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300028380|Ga0268265_10167608 | All Organisms → cellular organisms → Bacteria | 1873 | Open in IMG/M |
| 3300028381|Ga0268264_12680315 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300028881|Ga0307277_10215743 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300031184|Ga0307499_10261988 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300031548|Ga0307408_101957945 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300031562|Ga0310886_11057338 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300031731|Ga0307405_10181558 | All Organisms → cellular organisms → Bacteria | 1511 | Open in IMG/M |
| 3300031736|Ga0318501_10682948 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300031942|Ga0310916_10698105 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300031943|Ga0310885_10520334 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300031981|Ga0318531_10263622 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300032051|Ga0318532_10186070 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300032205|Ga0307472_100509194 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300032275|Ga0315270_11111956 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300033290|Ga0318519_10197713 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300033412|Ga0310810_11439696 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 5.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.95% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.97% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.98% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.98% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.98% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.98% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.99% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.99% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.99% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.99% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.99% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.99% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908032 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_all | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024219 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06 | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Perma_A_C_02602370 | 2124908032 | Soil | NRWTRGDVEFEGLGTSHSARNVGGAVDVVLVALKPQ |
| JGI25384J37096_101586921 | 3300002561 | Grasslands Soil | NGKTTVNRWKRGDVEFEARGSSHSARNVGKAVDVVLVALKQ* |
| Ga0062591_1028331531 | 3300004643 | Soil | KTAVNRWKRGDVEFEGLGSSHSARNVGGAVDVVLVALKP* |
| Ga0070690_1002657551 | 3300005330 | Switchgrass Rhizosphere | GKTKVNRWKHGDVEFEGRGSSHSARNLGPAVEAILVTLKP* |
| Ga0070689_1016319381 | 3300005340 | Switchgrass Rhizosphere | TTKVNHFKPGDVEFESRGSSHSARNAGQAVDVVLVALKP* |
| Ga0070673_1007726682 | 3300005364 | Switchgrass Rhizosphere | ADGKTVVNRWKRGDVEFESIGSSHSARNVGSAVDVVLVALKPQ* |
| Ga0070673_1012693182 | 3300005364 | Switchgrass Rhizosphere | DGKTVVNRWKPGDVEFESLGSSHSARNVGKPVEVVLVALKP* |
| Ga0070710_103001562 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | IEDTANGKTVVNKWKPGDVEYEALGSSHSARNVGGPVDVVLVALK* |
| Ga0070706_1014057691 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | DTAAGNTKVNRWKHGDVEFEAAGSSHSARNLGPAVDAVLVTLKP* |
| Ga0070699_1019523231 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | SDGKTVVNRWKRGDVEFEGLGTSHSARNVGGAVDVVLVALKPR* |
| Ga0073909_107158472 | 3300005526 | Surface Soil | DTADGKTIVNRWKRGDVEFESLGSSHSARNVGGAVDVVLVALKPQ* |
| Ga0070672_1003294871 | 3300005543 | Miscanthus Rhizosphere | IVNRWKPGDVEFESRGSSHSARNISHPVDVVLVALKP* |
| Ga0070696_1014900601 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | EDTANGKTVVNRWKPGDVEFESRGSSHSARNISHPVDVVLVALKP* |
| Ga0066695_104309061 | 3300005553 | Soil | NGKTVVNKWKPGDVEFEGRGSSHSARNIGKPIDVVLVALK* |
| Ga0066661_103022132 | 3300005554 | Soil | GKTVVNRWKPGDVEFEARGSSHSARNVGQPISVVLVELKP* |
| Ga0066670_101315511 | 3300005560 | Soil | RWKPGDVEFEARGSSHSARNVGQPISVVLVELKP* |
| Ga0066708_108629711 | 3300005576 | Soil | GGEIEDTANGKTVVNRWKRGDVELEGLGTSHSARNVAGPVDVVLVALKP* |
| Ga0068852_1023164371 | 3300005616 | Corn Rhizosphere | IEDTADGKTVVNRWKRGDVEFEGLGTSHSARNVGGAVDVVLVALKPQ* |
| Ga0066905_1000559061 | 3300005713 | Tropical Forest Soil | DGKTKVNRWSRGDVELETKGSSHSARNVGKAVDVFLVALKP* |
| Ga0066903_1032701711 | 3300005764 | Tropical Forest Soil | RWTRGDVEFEGRGTSHSARNAGGAVDVVLVVLKP* |
| Ga0068862_1002300951 | 3300005844 | Switchgrass Rhizosphere | IEDTANGKTAVNRWKHGDVEFEGLGSSHSARNVGPAVDVVLIALKP* |
| Ga0066651_104627381 | 3300006031 | Soil | VNRWKPGDVELESRGSSHAARNVGEAIDVVLVAFKP* |
| Ga0075368_101132412 | 3300006042 | Populus Endosphere | IEDTADGKTKVNRWKHGDVEFEGRGSSHSARNLGPAVEAILVTLKP* |
| Ga0075417_104787532 | 3300006049 | Populus Rhizosphere | TKVNRWKRGDVEFEGRGTSHSARNAGGAIDVVLVTLKP* |
| Ga0070716_1001266031 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | NRWTRGDVEFEGRGTSHSARNVGGAVDVVLVALKP* |
| Ga0074059_120669492 | 3300006578 | Soil | TIVNRWKPGDVEFESRGSSHSARNISHPVDVVLVALKP* |
| Ga0066665_102625562 | 3300006796 | Soil | EDTANGKTVVNKWKPGDVEFEGRGSSHSARNIGKPIDVVLVALK* |
| Ga0068865_1014907301 | 3300006881 | Miscanthus Rhizosphere | ADGKTVVNRWKPGDVEFESLGSSHSARNVGKPVEVVLVALKP* |
| Ga0075426_106829872 | 3300006903 | Populus Rhizosphere | DGRTVVNRWTRGDVEFEGRGTSHSARNVGGAVDVVLVALKP* |
| Ga0075435_1003585861 | 3300007076 | Populus Rhizosphere | GKTVVNRWTRGDVEFEGRGTSHSARNVGGAVDVVLVALKP* |
| Ga0075435_1004814222 | 3300007076 | Populus Rhizosphere | ADGKTIVNRWKRGDAEFEAFGSSHSARNVGAAVDVVLVALKP* |
| Ga0075435_1011408571 | 3300007076 | Populus Rhizosphere | IEDTADGKTIVNRWKPGDVEFEARGSSHSARNLSHAVDVVLVVLKH* |
| Ga0066710_1009324702 | 3300009012 | Grasslands Soil | NRWKPGDVEFEARGSSHSARNVSHPIDVVLVELKP |
| Ga0099830_103784001 | 3300009088 | Vadose Zone Soil | IEDTANGTTKVNRWKPGDVEFESRGSSHSARNVGPAIDVVLVALKP* |
| Ga0099828_111600282 | 3300009089 | Vadose Zone Soil | TADGKTKVNRWEHGDVEFEARGSSHSARNLGAAVDVVLVALKP* |
| Ga0105245_111219331 | 3300009098 | Miscanthus Rhizosphere | RWKRGDVEFESVGSSHSARNVGGAVDVVLVALKPQ* |
| Ga0105247_104408102 | 3300009101 | Switchgrass Rhizosphere | GGEIEDTANGKTVVNRWKRGDVEFESLGSSHSARNAGGAVDVVLVVLKP* |
| Ga0105247_108898731 | 3300009101 | Switchgrass Rhizosphere | EDTANGKTTVNRWKHGDVEFEIRGSSHSARNVGQAVDVVLVALKP* |
| Ga0114129_107241371 | 3300009147 | Populus Rhizosphere | EDTADGKTIVNRWTRGDVEFEARGSSHSARNLGKPVDVFLVALKP* |
| Ga0111538_100120201 | 3300009156 | Populus Rhizosphere | DGKTKVNRWKHGDVEFEGRGSSHSARNLGPAVEAILVTLKP* |
| Ga0105248_102026091 | 3300009177 | Switchgrass Rhizosphere | TVVNRWKRGDVEFESLGSSHSARNVGGAVDVVLVALKPQ* |
| Ga0134088_105446232 | 3300010304 | Grasslands Soil | NRWKPGDVEFEARGSSHSARNVSHPIDVVLVELKP* |
| Ga0134086_101512812 | 3300010323 | Grasslands Soil | VNRWKPGDVELESRGSSHSARNVGEAIDVVLVALKR* |
| Ga0134111_102952261 | 3300010329 | Grasslands Soil | KTVVNRWQRGDVEFEGRGTSHSARNVGGAVDVVLVALKQSSAVVR* |
| Ga0134111_103455662 | 3300010329 | Grasslands Soil | EIEDTANGRTIVNRWKPGDVEFESRGSSHSARNISQPVDVVLVALKP* |
| Ga0126372_123970812 | 3300010360 | Tropical Forest Soil | GKTVVNRPRRGDVEFESKGSSHSARNLGAAVDVVLVTLKP* |
| Ga0134121_106528331 | 3300010401 | Terrestrial Soil | NRWKHGDVEFEALGSSHSARNVGPAVDVVLVALKP* |
| Ga0134123_105058971 | 3300010403 | Terrestrial Soil | TVNRWKRGDVEFEARGSSHSARNVGQAVDVVLVALKP* |
| Ga0134123_109670101 | 3300010403 | Terrestrial Soil | DTANGKTIVNRWKPGDVEFESRGSSHSARNISHPVDVVLVALKP* |
| Ga0137393_106773521 | 3300011271 | Vadose Zone Soil | HWKHGDVEFEGRGSSHSARNLGPAVDVVLVTLKP* |
| Ga0137383_101872821 | 3300012199 | Vadose Zone Soil | DGKTVVNRWKRGDVELEGIGTSHSARNVGGAVDVVLVALKPSSVVSR* |
| Ga0137387_110158551 | 3300012349 | Vadose Zone Soil | NRWKRGDVEFEGIGTSHSARNVGGAVDVVLVALKQSSVVGR* |
| Ga0157286_100740721 | 3300012908 | Soil | TADGQTKVNRWVPGDVEFEARGSSHSARNIGKAVDVVLVALKP* |
| Ga0157306_101040752 | 3300012912 | Soil | RWKHGDVEFEGRGSSHSARNLGPAVEAILVTLKP* |
| Ga0134087_105801921 | 3300012977 | Grasslands Soil | ADAVEDTAEGRTKVNRWKRGDVEFEGRGTSHSARNAGGAIDVVLVTLKP* |
| Ga0164305_110141681 | 3300012989 | Soil | IEDTANGKTIVNRWKPGDVEFESRGSSHSARNISHPVDVVLVALKP* |
| Ga0173478_104793741 | 3300015201 | Soil | SIEDTADGKTRVNHWKHGDVEFEGRGSSHSARNLGPAVDAILVTLKP* |
| Ga0137409_112806752 | 3300015245 | Vadose Zone Soil | WKRGDVEFEGLGTSHSARNVGGAVDVVLVALKPQ* |
| Ga0132258_123893892 | 3300015371 | Arabidopsis Rhizosphere | VVNRWKRGDVEFEGLGTSHSARNVGGAVDVVLVALKPQ* |
| Ga0132256_1011284651 | 3300015372 | Arabidopsis Rhizosphere | GKTKVNRWKHGDVEFEGRGTSHSARNLGPAVEDILVTLKP* |
| Ga0132257_1021266251 | 3300015373 | Arabidopsis Rhizosphere | DTADGKTVVNRWKRGDVEFEGLGSSHSARNVAGAVDVVLVVLKRP* |
| Ga0132255_1005118733 | 3300015374 | Arabidopsis Rhizosphere | KTIVNRWTPGDVEFESRGSSHSARNISHPVDVVLVALKP* |
| Ga0187785_100934222 | 3300017947 | Tropical Peatland | DTADGKTVAKHWKHGDVEFEARGSSHSARNLGPAVEVVLVRLKP |
| Ga0187778_110435762 | 3300017961 | Tropical Peatland | ADGKTQVKRWAHGDVEFEARGTSHSARNAGKAVDVVLVTLKP |
| Ga0066655_101006073 | 3300018431 | Grasslands Soil | DTAEGRTKVNRWKRGDVEFEGRGTSHSARNAGGAIDVVLVTLKP |
| Ga0222622_106748671 | 3300022756 | Groundwater Sediment | GKTTVNRWKRGDVEFEARGSSHSARNVGQAVDVVLVALKP |
| Ga0247665_10725631 | 3300024219 | Soil | NRWKRGDVEFESVGSSHSARNVGGAVDVVLVALKPQ |
| Ga0207710_104161921 | 3300025900 | Switchgrass Rhizosphere | GGEIEDTANGKTVVNRWKRGDVEFESLGSSHSARNAGGAVDVVLVVLKP |
| Ga0207680_106600601 | 3300025903 | Switchgrass Rhizosphere | ESEDTANGKTIVNRWKPGDVEFESRGSSHSARNISDPVDVVLVALKP |
| Ga0207699_108107682 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VNKWKPGDVEYEALGSSHSARNVGGPVDVVLVALK |
| Ga0207643_101490321 | 3300025908 | Miscanthus Rhizosphere | IEDTADGKTKVNRWKHGDVEFEGRGSSHSARNLGPAVEAILVTLKP |
| Ga0207684_111338682 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | GTILDTAAGNTKVNRWKHGDVEFEAAGSSHSARNLGPAVDAVLVTLKP |
| Ga0207650_104151791 | 3300025925 | Switchgrass Rhizosphere | EIEDSADGKTVVNRWKRGDVEFEGLGTSHSARNVGGAVDVVLVALKRQ |
| Ga0207659_106822221 | 3300025926 | Miscanthus Rhizosphere | IEDTANGKTIVNRWKPGDVEFESRGSSHSARNISHPVDVVLVAVKP |
| Ga0207644_110624512 | 3300025931 | Switchgrass Rhizosphere | NGKTIVNRWKPGDVEFESRGSSHSARNISHPVDVVLVALKP |
| Ga0207709_112197671 | 3300025935 | Miscanthus Rhizosphere | GGEIEDTADGKTVVNRWKRGDVEFEGIGTSHSARNVGGAVDVVLVALKSQ |
| Ga0207665_101585193 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | NRWTRGDVEFEGRGTSHSARNVGGAVDVVLVALKP |
| Ga0207691_103240211 | 3300025940 | Miscanthus Rhizosphere | DTANGKTIVNRWKPGDVEFESRGSSHSARNISHPVDVVLVALKP |
| Ga0207711_108260321 | 3300025941 | Switchgrass Rhizosphere | VVNRWKRGDVEFESLGSSHSARNVGGAVDVVLVALKPQ |
| Ga0207711_118756612 | 3300025941 | Switchgrass Rhizosphere | GEIEDTADGKTSVNRWKRGDVEFESVGSSHSARNVGGAVDVVLVALKPQ |
| Ga0207658_114112142 | 3300025986 | Switchgrass Rhizosphere | GKTIVNRWKRGDVEFESVGSSHSARNVGGAVDVVLVALKPQ |
| Ga0207677_111430402 | 3300026023 | Miscanthus Rhizosphere | KTVVNRWKRGDVEFESLGSSHSARNAGGAVDVVLVVLKP |
| Ga0207698_103712541 | 3300026142 | Corn Rhizosphere | NRWKRGDAEFEAFGSSHSARNVGAAVDVVLVALKP |
| Ga0179587_111718871 | 3300026557 | Vadose Zone Soil | TSDGKTVVNRWKRGDVEFEGLGTSHSARNVGGAVDVVLVVLKPQ |
| Ga0209488_111277652 | 3300027903 | Vadose Zone Soil | RVNRWKPGDVEFESRGSSHSARNVGQAVDVVLVVLKP |
| Ga0268265_101676081 | 3300028380 | Switchgrass Rhizosphere | SIEDTANGKTAVNRWKHGDVEFEGLGSSHSARNVGPAVDVVLIALKP |
| Ga0268264_126803152 | 3300028381 | Switchgrass Rhizosphere | GKTVVNRWKRGDVEFEGLGTSHSARNVGGAVDVVLVALKRQ |
| Ga0307277_102157431 | 3300028881 | Soil | NGKTTVNRWKHGDVEFEARGSSHSARNVGQAVDVVLVALKP |
| Ga0307499_102619881 | 3300031184 | Soil | RWKRGDVEFEGLGTSHSARNVGGAVDVVLVALKRP |
| Ga0307408_1019579451 | 3300031548 | Rhizosphere | TVVNRWKPGDVEFEGRGSSHSARNMGSPVDVVLVALKP |
| Ga0310886_110573381 | 3300031562 | Soil | RHWKPGDVEFEGRGTSHSAKNLGAAIDVVLVVLKPR |
| Ga0307405_101815582 | 3300031731 | Rhizosphere | VNRWKPGDVEFEAQGSSHSARNVSHPVDVVLVALKP |
| Ga0318501_106829482 | 3300031736 | Soil | GKTAVNRWRSGDVEFEARGSSHSARNVSHPVDVVLVALKP |
| Ga0310916_106981051 | 3300031942 | Soil | TVVNRWKRGDVEFESLGSSHSARNVGGAVDVVLVVLKPQ |
| Ga0310885_105203342 | 3300031943 | Soil | EIEDTANGKTIVNRWKPGDVEFESRGSSHSARNISHPVDVVLVALKP |
| Ga0318531_102636222 | 3300031981 | Soil | IEDTANGKTAVNRWRSGDVEFEARGSSHSARNVSHPVDVVLVALKP |
| Ga0318532_101860702 | 3300032051 | Soil | IEDTAGGKTNVNRWKPGDVEFEARGSSHSARNVGQAVDVVLVRLEP |
| Ga0307472_1005091941 | 3300032205 | Hardwood Forest Soil | TADGKTVVNRWKRGDVEFEGLGSSHSARNAGGAVDVVLVVLKPE |
| Ga0315270_111119561 | 3300032275 | Sediment | EIEDTADGKTVVNRWKRGDVEFEGLGTSHSARNVGGAVDVVLVALKPR |
| Ga0318519_101977131 | 3300033290 | Soil | NRWKRGDVEFESLGSSHSARNVGGAVDVVLVVLKPQ |
| Ga0310810_114396962 | 3300033412 | Soil | GEIEDTADGKTVVNRWKRGDVEFEGLGTSHSARNVGAAVDVVLVALKRQ |
| ⦗Top⦘ |