| Basic Information | |
|---|---|
| Family ID | F103759 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 45 residues |
| Representative Sequence | VRAHRYRITISGNLGEIGREAFGDFRIESNGANTALVGDLDQAAL |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 94.06 % |
| % of genes near scaffold ends (potentially truncated) | 98.02 % |
| % of genes from short scaffolds (< 2000 bps) | 94.06 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (63.366 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (24.752 % of family members) |
| Environment Ontology (ENVO) | Unclassified (19.802 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.584 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.33% β-sheet: 30.14% Coil/Unstructured: 57.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF03781 | FGE-sulfatase | 12.87 |
| PF11139 | SfLAP | 8.91 |
| PF05199 | GMC_oxred_C | 5.94 |
| PF06271 | RDD | 5.94 |
| PF13977 | TetR_C_6 | 2.97 |
| PF03358 | FMN_red | 1.98 |
| PF09851 | SHOCT | 0.99 |
| PF00884 | Sulfatase | 0.99 |
| PF12710 | HAD | 0.99 |
| PF00408 | PGM_PMM_IV | 0.99 |
| PF08327 | AHSA1 | 0.99 |
| PF12680 | SnoaL_2 | 0.99 |
| PF10604 | Polyketide_cyc2 | 0.99 |
| PF00480 | ROK | 0.99 |
| PF00440 | TetR_N | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 12.87 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 5.94 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 5.94 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.98 |
| COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.99 |
| COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.37 % |
| Unclassified | root | N/A | 36.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005329|Ga0070683_102137411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 538 | Open in IMG/M |
| 3300005355|Ga0070671_101885561 | Not Available | 531 | Open in IMG/M |
| 3300005435|Ga0070714_100002421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 13744 | Open in IMG/M |
| 3300005435|Ga0070714_100068976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 3052 | Open in IMG/M |
| 3300005435|Ga0070714_101322639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. Iso899 | 703 | Open in IMG/M |
| 3300005435|Ga0070714_101939708 | Not Available | 575 | Open in IMG/M |
| 3300005454|Ga0066687_10758755 | Not Available | 577 | Open in IMG/M |
| 3300005458|Ga0070681_11012193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 751 | Open in IMG/M |
| 3300005539|Ga0068853_101431390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 669 | Open in IMG/M |
| 3300005542|Ga0070732_10362715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 873 | Open in IMG/M |
| 3300005602|Ga0070762_11298034 | Not Available | 505 | Open in IMG/M |
| 3300006028|Ga0070717_10266122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1517 | Open in IMG/M |
| 3300006059|Ga0075017_101136659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 611 | Open in IMG/M |
| 3300006173|Ga0070716_100906637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 691 | Open in IMG/M |
| 3300006576|Ga0074047_11847680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 547 | Open in IMG/M |
| 3300006797|Ga0066659_10306446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus | 1214 | Open in IMG/M |
| 3300006804|Ga0079221_10062077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1715 | Open in IMG/M |
| 3300006804|Ga0079221_10460654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 811 | Open in IMG/M |
| 3300006904|Ga0075424_102677733 | Not Available | 521 | Open in IMG/M |
| 3300006954|Ga0079219_10954893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. Iso899 | 703 | Open in IMG/M |
| 3300009174|Ga0105241_10574754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1015 | Open in IMG/M |
| 3300009523|Ga0116221_1344910 | Not Available | 646 | Open in IMG/M |
| 3300010046|Ga0126384_11574655 | Not Available | 618 | Open in IMG/M |
| 3300010047|Ga0126382_11358970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 646 | Open in IMG/M |
| 3300010152|Ga0126318_10601956 | Not Available | 790 | Open in IMG/M |
| 3300010337|Ga0134062_10772106 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300010359|Ga0126376_11339330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 738 | Open in IMG/M |
| 3300010359|Ga0126376_12848027 | Not Available | 533 | Open in IMG/M |
| 3300010371|Ga0134125_11331262 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300010396|Ga0134126_11944030 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300011120|Ga0150983_13884706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 535 | Open in IMG/M |
| 3300012198|Ga0137364_10510385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 904 | Open in IMG/M |
| 3300012210|Ga0137378_11271126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Terrabacter → unclassified Terrabacter → Terrabacter sp. Root85 | 652 | Open in IMG/M |
| 3300012350|Ga0137372_10118182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2201 | Open in IMG/M |
| 3300012357|Ga0137384_10916583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 706 | Open in IMG/M |
| 3300012985|Ga0164308_11806616 | Not Available | 570 | Open in IMG/M |
| 3300012989|Ga0164305_10575934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 900 | Open in IMG/M |
| 3300013100|Ga0157373_10918338 | Not Available | 650 | Open in IMG/M |
| 3300013104|Ga0157370_11392751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 631 | Open in IMG/M |
| 3300013296|Ga0157374_10641325 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300014326|Ga0157380_10452616 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| 3300016357|Ga0182032_10699047 | Not Available | 851 | Open in IMG/M |
| 3300016371|Ga0182034_11399628 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300016387|Ga0182040_11023362 | Not Available | 689 | Open in IMG/M |
| 3300017926|Ga0187807_1048091 | Not Available | 1321 | Open in IMG/M |
| 3300017932|Ga0187814_10238608 | Not Available | 688 | Open in IMG/M |
| 3300017942|Ga0187808_10331466 | Not Available | 689 | Open in IMG/M |
| 3300017943|Ga0187819_10212629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1138 | Open in IMG/M |
| 3300017955|Ga0187817_10674579 | Not Available | 659 | Open in IMG/M |
| 3300017995|Ga0187816_10232046 | Not Available | 804 | Open in IMG/M |
| 3300020170|Ga0179594_10372338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 542 | Open in IMG/M |
| 3300020579|Ga0210407_10155227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales | 1766 | Open in IMG/M |
| 3300021171|Ga0210405_10502908 | Not Available | 950 | Open in IMG/M |
| 3300021181|Ga0210388_10160123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1958 | Open in IMG/M |
| 3300021403|Ga0210397_11379761 | Not Available | 547 | Open in IMG/M |
| 3300021405|Ga0210387_10222052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1646 | Open in IMG/M |
| 3300021405|Ga0210387_10380511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Microthrixaceae → Candidatus Microthrix → Candidatus Microthrix parvicella | 1249 | Open in IMG/M |
| 3300021478|Ga0210402_11595731 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300021560|Ga0126371_13426158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora globispora | 535 | Open in IMG/M |
| 3300021560|Ga0126371_13660566 | Not Available | 518 | Open in IMG/M |
| 3300022533|Ga0242662_10327981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
| 3300022718|Ga0242675_1025633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 862 | Open in IMG/M |
| 3300024224|Ga0247673_1032951 | Not Available | 714 | Open in IMG/M |
| 3300024254|Ga0247661_1005171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2067 | Open in IMG/M |
| 3300024317|Ga0247660_1028734 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300025905|Ga0207685_10091868 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
| 3300025906|Ga0207699_10288826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Microthrixaceae → Candidatus Microthrix → Candidatus Microthrix parvicella | 1142 | Open in IMG/M |
| 3300025906|Ga0207699_11151195 | Not Available | 574 | Open in IMG/M |
| 3300025912|Ga0207707_11549198 | Not Available | 523 | Open in IMG/M |
| 3300025915|Ga0207693_10562525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales | 889 | Open in IMG/M |
| 3300025929|Ga0207664_10171300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1858 | Open in IMG/M |
| 3300025936|Ga0207670_10450032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1038 | Open in IMG/M |
| 3300025944|Ga0207661_11554394 | Not Available | 606 | Open in IMG/M |
| 3300025972|Ga0207668_11876325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 540 | Open in IMG/M |
| 3300026041|Ga0207639_10015257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5415 | Open in IMG/M |
| 3300026557|Ga0179587_10876142 | Not Available | 592 | Open in IMG/M |
| 3300027725|Ga0209178_1416943 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 512 | Open in IMG/M |
| 3300027853|Ga0209274_10283746 | Not Available | 850 | Open in IMG/M |
| 3300028793|Ga0307299_10170427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 819 | Open in IMG/M |
| 3300031543|Ga0318516_10172387 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300031544|Ga0318534_10809715 | Not Available | 526 | Open in IMG/M |
| 3300031680|Ga0318574_10150451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1321 | Open in IMG/M |
| 3300031682|Ga0318560_10061633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1873 | Open in IMG/M |
| 3300031723|Ga0318493_10317605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 843 | Open in IMG/M |
| 3300031740|Ga0307468_100162767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1453 | Open in IMG/M |
| 3300031744|Ga0306918_10028482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3499 | Open in IMG/M |
| 3300031805|Ga0318497_10529656 | Not Available | 660 | Open in IMG/M |
| 3300031912|Ga0306921_12226300 | Not Available | 577 | Open in IMG/M |
| 3300032035|Ga0310911_10160043 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
| 3300032041|Ga0318549_10239484 | Not Available | 816 | Open in IMG/M |
| 3300032044|Ga0318558_10429773 | Not Available | 658 | Open in IMG/M |
| 3300032054|Ga0318570_10461620 | Not Available | 579 | Open in IMG/M |
| 3300032055|Ga0318575_10434091 | Not Available | 667 | Open in IMG/M |
| 3300032066|Ga0318514_10078178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Microthrixaceae → Candidatus Microthrix → Candidatus Microthrix parvicella | 1648 | Open in IMG/M |
| 3300032174|Ga0307470_10101657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1648 | Open in IMG/M |
| 3300032174|Ga0307470_10482903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 899 | Open in IMG/M |
| 3300032770|Ga0335085_10587186 | Not Available | 1256 | Open in IMG/M |
| 3300032896|Ga0335075_10574569 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300032898|Ga0335072_10651696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1044 | Open in IMG/M |
| 3300032898|Ga0335072_10979426 | Not Available | 779 | Open in IMG/M |
| 3300033289|Ga0310914_11355135 | Not Available | 614 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.75% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.94% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.95% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 4.95% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.96% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.96% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.97% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.97% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.98% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.99% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.99% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.99% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.99% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.99% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.99% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.99% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024224 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK14 | Environmental | Open in IMG/M |
| 3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
| 3300024317 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01 | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070683_1021374112 | 3300005329 | Corn Rhizosphere | VRTHSYRITIAGGLGEIGREAFGDFRIEADGGDTILIGYLDQAA |
| Ga0070671_1018855612 | 3300005355 | Switchgrass Rhizosphere | VHPYSYQITISGDLGDVGREAFGDFKIESYEATTVLTAYLDQA |
| Ga0070714_10000242117 | 3300005435 | Agricultural Soil | VYPHRYQITISGGLGEIGREAFGGFKIESDDTTTVLIGDLDQAALYGTLNRILSLG |
| Ga0070714_1000689762 | 3300005435 | Agricultural Soil | MRTHRYQITINGGLDEAGREAFADFGIESDGANIVLTGDLDQAALYGALARIQALGGWPVQAAARP* |
| Ga0070714_1013226391 | 3300005435 | Agricultural Soil | VHPYQYQITISGGLGEIGREAFGDFKIESDDSTTVLIGDLDQAALYGALNR |
| Ga0070714_1019397081 | 3300005435 | Agricultural Soil | MRTHRYQITINGGLGEVGREAFADFGIESDGANIVLTGDL |
| Ga0066687_107587552 | 3300005454 | Soil | MRTHRYQITVNGGLGEAGREAFADFGIESDGANIVLTGDLDQAAL |
| Ga0070681_110121931 | 3300005458 | Corn Rhizosphere | VRTHSYRITIAGGLGEIGREAFGDFRIEADGGDTILIGYLDQA |
| Ga0068853_1014313902 | 3300005539 | Corn Rhizosphere | VHTHRYRIIVAGGLSKTGREAFSDFRIETNGTNTVLVRDLDQ |
| Ga0070732_103627152 | 3300005542 | Surface Soil | VRTHRYRITIAGGLGQIGREAFADFAVEANGTNTMLTAVLDQAALYGALN |
| Ga0070762_112980341 | 3300005602 | Soil | VRTHRYKITISGGLGDTGREAFGDFQIERNGKNTMLTGELDQSGLYG |
| Ga0070717_102661223 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VHPYSYQITISGDLGDVGREAFGDFKIEPCEATTVL |
| Ga0075017_1011366591 | 3300006059 | Watersheds | MHRYMITILGGLGNTCREAFGDFRIEPNGMNTVLIGDLDQPGLYG |
| Ga0070716_1009066372 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VRTHSYRITIAGGLGEIGREAFGDFRIEIDGGDTVLIGYLDQAALYGTLNRI |
| Ga0074047_118476802 | 3300006576 | Soil | VRTHRYRIIVAGGLSEIGREAFSDFRIEANGTNTALVRDLDQAA |
| Ga0066659_103064461 | 3300006797 | Soil | VRTYSYLITIVGGLGEIGREAFGDFRIESNGINTVLAAEMDQ |
| Ga0079221_100620771 | 3300006804 | Agricultural Soil | VRTHSYRITIAGGLGEIGREAFGDFRIEIDGGDTVLIGYLDQAA |
| Ga0079221_104606541 | 3300006804 | Agricultural Soil | VTAHRYQITLAGVLGEVGREAFGDFKIESDDSTTVLTGYLDQAALYGALN |
| Ga0075424_1026777331 | 3300006904 | Populus Rhizosphere | VYPYRYQITISGGLGEIGREAFGDFKIESDDSTTVLT |
| Ga0079219_109548931 | 3300006954 | Agricultural Soil | VHPYRYQITISGDLGEIGREAFGDFKIESDDSTTVLTGDLDQAAL |
| Ga0105241_105747541 | 3300009174 | Corn Rhizosphere | VHTHRYRIIVAGGLSKTGREAFSDFRIETNGTNTVLVRDLDQAAL |
| Ga0116221_13449101 | 3300009523 | Peatlands Soil | MSEGDVRAHRYRITISGNLGEIGREAFGDFRIESSGANTSLVGDLDQAA |
| Ga0126384_115746552 | 3300010046 | Tropical Forest Soil | VHTHRYRIVVAGDLSKISREAFSDFRIEANGTNTALVRDL |
| Ga0126382_113589701 | 3300010047 | Tropical Forest Soil | VRTHCYRITIAGGLGEIGREAFGDFRIEVNGTNTVLVGDLD |
| Ga0126318_106019563 | 3300010152 | Soil | VHPYLYQITISGDLGEIGREAFSDFKIESNETTTVLTADLDQAAL |
| Ga0134062_107721062 | 3300010337 | Grasslands Soil | VRTHRYQITISGGLGATAREAFADFRIEPNGINTALIGDLDQAA |
| Ga0126376_113393302 | 3300010359 | Tropical Forest Soil | VGRHRYRITVSGNLGEIGREAFTDLGSEFDGVNTALTGELD |
| Ga0126376_128480272 | 3300010359 | Tropical Forest Soil | VRTHSYRITIAGGLGEIGREAFGDFQIEIDGGDTILVGYLDQA |
| Ga0134125_113312621 | 3300010371 | Terrestrial Soil | VRTHSYRITIAGGLGEIGREAFGDFRIEIDGGDTVL |
| Ga0134126_119440301 | 3300010396 | Terrestrial Soil | VHTHCYRIIVAGGLSEIGREAFSDFRIEANGTNTVLVRDLDQAALYGTLNRILS |
| Ga0150983_138847061 | 3300011120 | Forest Soil | VRTYSYLITIAGGLGDIGREAFGDFRIESNGITTVLAAEMDQA |
| Ga0137364_105103851 | 3300012198 | Vadose Zone Soil | MRTHRYRITITGGLCEIDREAFGDFRIESGGANTVLIGDLDQAALF |
| Ga0137378_112711261 | 3300012210 | Vadose Zone Soil | VRTHCYRITIAGGLGEIGREAFSDFRIEANGTNTVLIGNLDQAGLHGTL |
| Ga0137372_101181824 | 3300012350 | Vadose Zone Soil | MGGDVGTHRYRITIAGGLGEIGREAFSDFLIKPTGTTNALVGALHQAALY |
| Ga0137384_109165831 | 3300012357 | Vadose Zone Soil | MRTHRYQITINGGLGEAGREAFADFGIESDGANIVLTGDLDQA |
| Ga0164308_118066162 | 3300012985 | Soil | VRTHSYRITIAGGLGEIGREAFGDFRIEIDGGDTVLIGYLDQAALYGTLNRIL |
| Ga0164305_105759341 | 3300012989 | Soil | VHPYSYQITISGDLGDVGREAFGDFKIESYEATTVLTAYLDQAA |
| Ga0157373_109183382 | 3300013100 | Corn Rhizosphere | MPGQECGDGGDVHPYQYQITISGGLGEIGREAFGDFKIESDDSTTVLIGDLDQAA |
| Ga0157370_113927511 | 3300013104 | Corn Rhizosphere | VRTYSYLITIVGGLGEIGREAFGDFRIESNGINTVLAAEMDQAALHG |
| Ga0157374_106413251 | 3300013296 | Miscanthus Rhizosphere | VHTHRYRIIVAGGLSEIGREAFSDFRIEANGTNTVLVR |
| Ga0157380_104526161 | 3300014326 | Switchgrass Rhizosphere | VHTHCYRIIVAGGLSEIGREAFSDFRIEATGTNTVLVRDLDQAALYGTLNRILS |
| Ga0182032_106990472 | 3300016357 | Soil | VRTHCYRITVSGSLSDVGREAFGEFRIEANGTHTALVGDLDQAALCGALNRILTLGFEL |
| Ga0182034_113996282 | 3300016371 | Soil | MPTHRYRIKIAGGLGETGREAFGDFLTESNGMNTVLTGDLDQAAL |
| Ga0182040_110233622 | 3300016387 | Soil | VRTHRYQITVSGSPGEVSREAFGEFRIEANGTSTILVGDLDQAALYGVLN |
| Ga0187807_10480913 | 3300017926 | Freshwater Sediment | VRAHRYRITVSGNLGEIGHEAFGDFRIESNGANTTLTGDLDQAALYGALN |
| Ga0187814_102386082 | 3300017932 | Freshwater Sediment | VRAHRYRITVSGNLGEIGHEAFGDFRIESNGANTTLTGDLDQAALYGALNR |
| Ga0187808_103314662 | 3300017942 | Freshwater Sediment | MSEGDVRAHRYRITISPNLGGIGREAFGDFRIESNGAN |
| Ga0187819_102126293 | 3300017943 | Freshwater Sediment | VRTHRYQITVSGSLGEIGREAFGDFRIEANGTNTALVGDLD |
| Ga0187817_106745792 | 3300017955 | Freshwater Sediment | VRAHRYRITISGNLGEIGREAFGDFRIESNGANTALVGDLDQAAL |
| Ga0187816_102320462 | 3300017995 | Freshwater Sediment | VRTHRYQITVSGSLGEIGREAFGDFRIEANGTNTALVGDLDQAALYG |
| Ga0179594_103723381 | 3300020170 | Vadose Zone Soil | VRTHSYRITIAGGLGEIGREAFGDFHIESSGINTVLAAEMDQAALQGALNRI |
| Ga0210407_101552274 | 3300020579 | Soil | VRTHRYQITIFGGLGELGREAFADFKIEYANGNTVLTGDLD |
| Ga0210405_105029081 | 3300021171 | Soil | VRTHRYQITISGGLGATAREAFADFRIEPNGINTALIGDLDQAALYG |
| Ga0210388_101601231 | 3300021181 | Soil | VRTHRYQITIFGGLGELGREAFADFKIEYANGNTVLTGDL |
| Ga0210397_113797612 | 3300021403 | Soil | MRTHRYQITINGGLGEAGREAFADFGIESDGANIVLTGDM |
| Ga0210387_102220522 | 3300021405 | Soil | MRTHRYQITINGGLGEAGREAFADFGIESDGANVVLTGDMDQA |
| Ga0210387_103805113 | 3300021405 | Soil | VRTHRYQITIFGGLGELGREAFADFKIEYANGNTVLTGDLDQAALYSALN |
| Ga0210402_115957311 | 3300021478 | Soil | VRTHRYQITISGGLGATAREAFADFRIELNGINTALV |
| Ga0126371_134261581 | 3300021560 | Tropical Forest Soil | VGRHRYRITVSGNLGEIGREAFTDLGSEFDGVNTALTGELDQAALY |
| Ga0126371_136605662 | 3300021560 | Tropical Forest Soil | VHPYSYRITISGDLGDVGREEFGDFKIESYDATTVLTAYLDQAALY |
| Ga0242662_103279812 | 3300022533 | Soil | VRSYSYLITIVGGLGDIGREAFGDFRIESNGINTVLAAELDQTGLHGALNR |
| Ga0242675_10256331 | 3300022718 | Soil | VRSYSYRITIVGGLGDIGREAFGDFRVESNGINTVLA |
| Ga0247673_10329512 | 3300024224 | Soil | VHTHCYRIIVAGGLSEIGREAFSDFRIEANGTNTVLVRDLDQAALYGTLNR |
| Ga0247661_10051711 | 3300024254 | Soil | VHPYSYQITISGDLGDVGREAFGDFKIESYEATTVLTAYLDQAAL |
| Ga0247660_10287341 | 3300024317 | Soil | VHTHCYRIIVAGGLSEIGREAFSDFRIEANGTNTVLVRDLDQA |
| Ga0207685_100918681 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VRTHSYRITIAGGLGEIGREAFGDFRIEIDGGDTVLIG |
| Ga0207699_102888261 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VYPHRYQITISGGLGEIGREAFGGFKIESDDTTTVLIGDL |
| Ga0207699_111511951 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTHRYQITINGGLGEVGREAFADFGIESDGANIVLTGNLDQAA |
| Ga0207707_115491982 | 3300025912 | Corn Rhizosphere | VRTHSYRITIAGGLGEIGREAFGDFRIEADGGDTILIG |
| Ga0207693_105625251 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VHPYSYQITISGDLGDVGREAFGDFKIESCEATTVLTAHLDQAALYGTLNRIMSL |
| Ga0207664_101713002 | 3300025929 | Agricultural Soil | MRTHRYQITINGGLDEAGREAFADFGIESDGANIVLTGDLDQAALYGALARIQALG |
| Ga0207670_104500322 | 3300025936 | Switchgrass Rhizosphere | VHTHCYRIIVAGGLSEIGREAFSDFRIEATGTNTVLVRDLDQAA |
| Ga0207661_115543941 | 3300025944 | Corn Rhizosphere | VRTHSYRITIAGGLGEIGREAFGDFRIEADGGDTILIGYLDQAALYGTLNRILSLGF |
| Ga0207668_118763251 | 3300025972 | Switchgrass Rhizosphere | VHTHCYRIIVAGGLSEIGREAFSDFRIEANGTNTVLVRDLDQAALYGTLNRILSFGFEL |
| Ga0207639_100152571 | 3300026041 | Corn Rhizosphere | VHTHRYRIIVAGGLSKTGREAFSDFRIETNGTNTVLVRDLDQAALYG |
| Ga0179587_108761421 | 3300026557 | Vadose Zone Soil | VRTHRYKITISGGLGETGREAFRDFQIERNGTNTM |
| Ga0209178_14169431 | 3300027725 | Agricultural Soil | VHTHRYRIIVAGGLSKTGREAFSDFRIETNGTNTFLVRDLDQAALYGTL |
| Ga0209274_102837461 | 3300027853 | Soil | VRTHRYRITIAGGLGDIGREAFADFVIEANGANTVLT |
| Ga0307299_101704272 | 3300028793 | Soil | VHTHRYRIIVAGGLSEIGREAFSDFRIEANGTNTALVRDLDQAALYGTLSRILSL |
| Ga0318516_101723873 | 3300031543 | Soil | VGTHRYRITVAGALGGTGREVFADFAIEANGAATVLSG |
| Ga0318534_108097152 | 3300031544 | Soil | VRTHRYRITIAGGLGEIGREAFKDFTIEPNGTNTALVGDLD |
| Ga0318574_101504513 | 3300031680 | Soil | VGKHRYLITISGGLSETGREAFGDFRIELNGTNTALIADLDQSGLSGVLN |
| Ga0318560_100616333 | 3300031682 | Soil | VRTHCYRITVSGSLSDVGREAFGEFRIEANGTHTALVGDLDQAACTAR |
| Ga0318493_103176052 | 3300031723 | Soil | VRRHRYRITVAGGLGTVGQEAFADFRIEPNGIDTALIGTLDQAALH |
| Ga0307468_1001627671 | 3300031740 | Hardwood Forest Soil | VHTHRYRIIVAGGLSEIGREAFSDFRIEVKGTNTALVRD |
| Ga0306918_100284821 | 3300031744 | Soil | VGTHRYRITVAGALRGTGREVFADFAIEANGATTVLSADLDDAGL |
| Ga0318497_105296562 | 3300031805 | Soil | VRTHRYQVTVSGSLDEIGREAFGDLRIEANGTSTTLVGDLDQAALYG |
| Ga0306921_122263001 | 3300031912 | Soil | VRTHRYQITVSGSPGETSREAFGEFRIEGNGINTTLVGDLDQAALYGA |
| Ga0310911_101600431 | 3300032035 | Soil | VGTHRYRITVAGALGGTGREVFADFAIEANGATTVLSGDLDDAGLSGML |
| Ga0318549_102394842 | 3300032041 | Soil | VGKHRYLITISGGLSETGREAFGDFRIELNGTNTALIADLDQSGLS |
| Ga0318558_104297732 | 3300032044 | Soil | HCYRITVSGSLSDVGREAFGEFRIEANGTHTALVGDLDQAACTAR |
| Ga0318570_104616202 | 3300032054 | Soil | LCPYGGDVGKHRYLITISGGLSETGREAFGDFRIELNGTNTALIAD |
| Ga0318575_104340911 | 3300032055 | Soil | VRTHRYQITVSGSPGEVSREAFGEFRIEANGTSTILVGDLDQAALY |
| Ga0318514_100781783 | 3300032066 | Soil | VGKHRYLITISGGLSETGREAFGDFRIELNGTNTALIADLDQSGLSGV |
| Ga0307470_101016571 | 3300032174 | Hardwood Forest Soil | VHPYSYQITISGDLGDVGREAFGDFKIESYEATTV |
| Ga0307470_104829032 | 3300032174 | Hardwood Forest Soil | VHTHCYRIIVAGGLSEIGREAFSDFRIEANGTNTVLVRDLDQAAL |
| Ga0335085_105871862 | 3300032770 | Soil | VRKHGYQITIRGVLGEAGREAFEHFKIELDGINTVLICDLD |
| Ga0335075_105745691 | 3300032896 | Soil | VSTHRYRITVAGGLGEIGREAFADFLIEPNGTTTVLVGDLDEAA |
| Ga0335072_106516962 | 3300032898 | Soil | VHTHRYRIIVAGGLSEIGREAFSDFRIEAKGTNTALVRDLDQAALYGTLNRILS |
| Ga0335072_109794262 | 3300032898 | Soil | VATHCYRITIAGGLGELGREAFPDFRIERSGADTV |
| Ga0310914_113551351 | 3300033289 | Soil | RTHCYRITVSGSLSDVGREAFGEFRIEANGTHTALVGDLDQAACTAR |
| ⦗Top⦘ |