| Basic Information | |
|---|---|
| Family ID | F103738 |
| Family Type | Metagenome |
| Number of Sequences | 101 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VEREIRRRLRKGTKEQSMEYLILVAVVSMMALYALIIVGCLKQPEW |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (99.010 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (15.842 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.693 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.525 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.05% β-sheet: 0.00% Coil/Unstructured: 45.95% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF12833 | HTH_18 | 30.69 |
| PF13545 | HTH_Crp_2 | 12.87 |
| PF02776 | TPP_enzyme_N | 7.92 |
| PF01180 | DHO_dh | 5.94 |
| PF13180 | PDZ_2 | 0.99 |
| PF00165 | HTH_AraC | 0.99 |
| PF11638 | DnaA_N | 0.99 |
| PF13442 | Cytochrome_CBB3 | 0.99 |
| PF10006 | DUF2249 | 0.99 |
| PF01979 | Amidohydro_1 | 0.99 |
| PF05154 | TM2 | 0.99 |
| PF02775 | TPP_enzyme_C | 0.99 |
| PF00107 | ADH_zinc_N | 0.99 |
| PF00137 | ATP-synt_C | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 5.94 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 5.94 |
| COG0167 | Dihydroorotate dehydrogenase | Nucleotide transport and metabolism [F] | 5.94 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 5.94 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 5.94 |
| COG0636 | FoF1-type ATP synthase, membrane subunit c/Archaeal/vacuolar-type H+-ATPase, subunit K | Energy production and conversion [C] | 0.99 |
| COG2314 | Uncharacterized membrane protein YozV, TM2 domain, contains pTyr | General function prediction only [R] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 99.01 % |
| All Organisms | root | All Organisms | 0.99 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300025315|Ga0207697_10004156 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 6976 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 15.84% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.97% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.97% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.98% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.98% |
| Mangrove Soil | Environmental → Aquatic → Marine → Oceanic → Sediment → Mangrove Soil | 0.99% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.99% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.99% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.99% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.99% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002128 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Environmental | Open in IMG/M |
| 3300002822 | Illumina_Fosmid_Bertioga | Environmental | Open in IMG/M |
| 3300003995 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
| 3300023069 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S049-202B-5 | Environmental | Open in IMG/M |
| 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Host-Associated | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_00015620 | 2088090014 | Soil | MVRLLKRKKEITMEYLILVAVVSMMALYTLIIVGCLKQPEW |
| JGI11643J12802_104661261 | 3300000890 | Soil | KTRNAEPKTGRRLTKPMKEQSMEYLILVAVVAMMALYASIIVGCLKQPEW* |
| JGI10214J12806_126950522 | 3300000891 | Soil | MKEQSMEYLILVAVVAMMALYASIIVGCLKQPEW* |
| JGI1027J12803_1000776401 | 3300000955 | Soil | VEHKIGSRLTKAIKEQSMEYVILVAVLAMAALYALII |
| JGI1027J12803_1039030412 | 3300000955 | Soil | VEHEIRRRLTKCTKEQNMEYLILVAVVSMATLYALIIVGCLKQPEW* |
| JGI10216J12902_1053404072 | 3300000956 | Soil | MVALPKPIKEVTMEYLILVAVVSMMALYALIIVGCLKQPEW* |
| JGI24036J26619_100493872 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | VEHEICRRLTQGTKEQNMEYLILVAVVAMMVLYALIIVGCLKQPEW* |
| BMAI_11440303 | 3300002822 | Mangrove Soil | VEHETLRRLTKGTTEEIMEYLILVAVVSVMALYALIIIGCLKQPEW* |
| Ga0055438_100363273 | 3300003995 | Natural And Restored Wetlands | MKSVAALLKPTKEQNMEYLIFGAVGAMIALYALIIVGCLKQPEW* |
| Ga0062595_1013436001 | 3300004479 | Soil | MHRCRTKDNKGANMEYLIIAAVVSMMALYALIIVGCLKHAEW* |
| Ga0062595_1021015721 | 3300004479 | Soil | NASNGQREIGGRLTKSTKELSMEYVIVVAVVSIMALYALIIVGCLRQPEW* |
| Ga0062592_1005957271 | 3300004480 | Soil | GMHRCRTKDNKGANMEYLIIAAVVSMMALYALIIVGCLKHAEW* |
| Ga0062592_1009646102 | 3300004480 | Soil | VEHEIRRRLTKETKEQSMEYVILLAVVAVMALYALIIVGCLKQPEW* |
| Ga0066673_102363292 | 3300005175 | Soil | VEREIRRRVTKHTKEQSMEYLILVAVVSIMALYALIIVGCLKQREW* |
| Ga0066688_106623121 | 3300005178 | Soil | VEREIRRRVTKRTKEQSMEYLILVAVVSIMALYALIIVGCLKQPEW* |
| Ga0065712_101710162 | 3300005290 | Miscanthus Rhizosphere | VEHEICRGLTKGTKEQNMAYLILIAVVAMMALYALIIVGCVKQPEW* |
| Ga0065705_102758692 | 3300005294 | Switchgrass Rhizosphere | VEHAIRRRLTNDTKEQIMEYLILVAVVAVMALYALIIVVCLKQPEW* |
| Ga0070690_1002667852 | 3300005330 | Switchgrass Rhizosphere | MHRCRTKDNKGANMEYLIIAAVVSMMELYALIIVGCLKHAEW* |
| Ga0066388_1001278392 | 3300005332 | Tropical Forest Soil | MPKNAEREIRHRVTNRTKEQSMEYLILAAVVSMMALYALIIIGCLKQPEW* |
| Ga0066388_1005859731 | 3300005332 | Tropical Forest Soil | TRRHASKADKELNMEYLILVAVVPMMALYTLIIVGSLKQPEW* |
| Ga0066388_1053491892 | 3300005332 | Tropical Forest Soil | VEHEIWRRLTKADKEQSMEYLILVAVVSMIALYALIIVGCMKEPEW* |
| Ga0070680_1001959604 | 3300005336 | Corn Rhizosphere | MHRCRTKDNKGANMEYLIIAAVVSMMALYALIIVGCLKHAE |
| Ga0066682_101830022 | 3300005450 | Soil | VEREIRRRVTKRTKEQSMEYLILVAVVSIMALYALIIVGCLKQREW* |
| Ga0070663_1005863161 | 3300005455 | Corn Rhizosphere | KPKNVQHEIPRGLTKVTEEQSMEYLILVGVVAMMALYVAIIAGCLKQAEW* |
| Ga0070685_100504831 | 3300005466 | Switchgrass Rhizosphere | KQKAKNGKHGMHRCRTKDNKGANMEYLIIAAVVSMMALYALIIVGCLKHAEW* |
| Ga0070665_1004897772 | 3300005548 | Switchgrass Rhizosphere | VEHEICRGLTKGTKEQNMAYLILIAVVAMMALYALIIVGC |
| Ga0070665_1014504772 | 3300005548 | Switchgrass Rhizosphere | VQHEIPRGLTKVTEEQSMEYLILVGVVAMMALYVAIIAGCLKQAEW* |
| Ga0066695_107336362 | 3300005553 | Soil | VAGLLKPTKEQNMEYLILLAVVAVMALYALIIFGCLKQPEW* |
| Ga0066707_105167022 | 3300005556 | Soil | VEREIRRRITKRTKEQSMEYLILVAVVSIMALYALIIVGCLKQREW* |
| Ga0066698_107695661 | 3300005558 | Soil | ALLTPTKEQSMEYLILVAVVSMMALYALIIVGCLKQPEW* |
| Ga0066706_108076801 | 3300005598 | Soil | MARNVEREIRRRVTKRTKEQSMEYLILVAVVSIMALYALIIVGCLKQREW* |
| Ga0066696_102699392 | 3300006032 | Soil | VEREIRRHVTKHTKEQSMEYLISVAVVSIMALYALIIVGCLKQREW* |
| Ga0070716_1014389433 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | TKEQSMEYLILVAVLAVMALYALIIVVCLKQPEW* |
| Ga0079220_107795771 | 3300006806 | Agricultural Soil | GLKKELTMEYLILIPIVSMMALYALIIVGCLKQPEW* |
| Ga0105245_122746962 | 3300009098 | Miscanthus Rhizosphere | LTKTQKEQNMEYLILAAVVAMMALYALIIIGCLKHAEW* |
| Ga0105242_120416942 | 3300009176 | Miscanthus Rhizosphere | KHGMHRCRTKDNKGANMEYLIIAAVVSMMALYALIIVGCLKHAEW* |
| Ga0105248_125332452 | 3300009177 | Switchgrass Rhizosphere | MHRCRTKANKGANMEYLIIAAVVSMMALYALIIVGCLKHAEW* |
| Ga0126314_104464691 | 3300010042 | Serpentine Soil | RRCLTKGTKEQSMEYLIVVAVAAMMALYALIIVGCLKQPEW* |
| Ga0134109_101125722 | 3300010320 | Grasslands Soil | VEREIRRRLTKRTKQQSMEYLILVAVVSKMALYALTIVGCLKR* |
| Ga0134066_102424972 | 3300010364 | Grasslands Soil | VEREIRRRVTKHTKEQSMEYLILVAVVAMTVLYALIIVGCLKQPEW* |
| Ga0137389_117202121 | 3300012096 | Vadose Zone Soil | EHEIRGRCNQLTKGNHMEHLILVAVVAMMALYALIIVGCLKQPEW* |
| Ga0137364_114807551 | 3300012198 | Vadose Zone Soil | MVGLPKPKEEITMEYLILVAVVSMMALYALIIVGCLKQPEW* |
| Ga0137383_104312952 | 3300012199 | Vadose Zone Soil | VEQESHRCITKAGMEYLILVAVVSMMALYALIIIGCLKQPEW* |
| Ga0137365_103195802 | 3300012201 | Vadose Zone Soil | VEREIRRRLTKRTKEQSMEYLILVAVVSIMALYALIIVGCLKQREW* |
| Ga0137363_101909272 | 3300012202 | Vadose Zone Soil | MQTKEQSMEYLILVAVVSVMALYALIIIGCLKQPEW* |
| Ga0137374_100000974 | 3300012204 | Vadose Zone Soil | MVALRKPVKEATMEYLILLAVVSMMALYALIIIGCLRQPEW* |
| Ga0137374_112947581 | 3300012204 | Vadose Zone Soil | VEREIRRRLRKGTKEQSMEYLILVAVVAMMALYALIIVGCLKQREW* |
| Ga0137380_105407323 | 3300012206 | Vadose Zone Soil | VEREIHRRVTKHTKEQSMEYLILVAVVSIMALYALIIVGCLKQRVW* |
| Ga0137379_102037692 | 3300012209 | Vadose Zone Soil | VEREIHRRVTKHTKEQSMEYLILVAVVSIMALYALIIVGCLKQREW* |
| Ga0137372_110133872 | 3300012350 | Vadose Zone Soil | VEREIRRRLTKRIKEQSMDYLILVAVVSIMALYALIIVGCLKQREW* |
| Ga0137386_100423321 | 3300012351 | Vadose Zone Soil | VEREIRRRVTKRTKEQSMEYVILVAVVSIMALYALIIVGCLKQREW* |
| Ga0137366_109623492 | 3300012354 | Vadose Zone Soil | FAKQKTRNVQHEIRRRLTKGTKEQSMEYLILVAVVTMMALYALIIVGCLKQREW* |
| Ga0137369_106454663 | 3300012355 | Vadose Zone Soil | VEREIRRRLRKGTKEQSMEYLILVAVVSMMALYALIIVGCLKQPEW* |
| Ga0157284_101797111 | 3300012893 | Soil | VEHEICRGLTKGTKEQNMAYLILIAVVAMMALYALIIVGCLKQPEW* |
| Ga0157301_100569543 | 3300012911 | Soil | MLRLPKGTKQQSMEYLILVAVVSVMTLYALIIIGCLKQPEW* |
| Ga0126375_113997173 | 3300012948 | Tropical Forest Soil | VEREIRRRLTKPTKEQIMEYLILVAVVVMMALYAMIIVGCLRQPEW* |
| Ga0164298_100768053 | 3300012955 | Soil | ERENRRRLTKRTKEQNMGYLILVAVVAMMVLYALIIVGCLKQPEW* |
| Ga0126369_110083203 | 3300012971 | Tropical Forest Soil | TKEQSMEYLILVAVVSVMALYALIIVGCLKQPEW* |
| Ga0164309_119063661 | 3300012984 | Soil | TKHKKEQSMEYLILLAVVSVMALYALIIVGCLKQPEW* |
| Ga0182008_106083221 | 3300014497 | Rhizosphere | LTKCTKEQSMEYLILVAVVAVMVLYALIIVGCLKQPEW* |
| Ga0132257_1014664921 | 3300015373 | Arabidopsis Rhizosphere | VEHEIYRGLTKGTKEQNMEYLILVAVVAMMGLYALIIVGCLKQPEW* |
| Ga0132255_1014480573 | 3300015374 | Arabidopsis Rhizosphere | VERENRRRLTKGTKEQSMAYLILVAVVAIMVLYALIIVGCLKQPEW* |
| Ga0132255_1030748813 | 3300015374 | Arabidopsis Rhizosphere | RLIKTDKGASMEYLILVAVVSMMALYALIIVGCLKQPEW* |
| Ga0182036_110319181 | 3300016270 | Soil | TKRTKEQSMEYLILVAVVSMMALYALIIVGCLKQPEW |
| Ga0182035_100929382 | 3300016341 | Soil | VEHQIRRRLTNGKKEQIMEYLIVVAVVSVAALYALFIIRCLKQPEW |
| Ga0182038_104717173 | 3300016445 | Soil | SDLTNPSKEQIMEYLILVAVVSMMALYALIIVGCLKQPEW |
| Ga0182038_112821132 | 3300016445 | Soil | VQHEMPRRLTKGTKEKIMEYLILVAVISVMALYALIIIGCLKQPEW |
| Ga0134069_13096672 | 3300017654 | Grasslands Soil | VEREIRRRLTKPTKQQSMEYLILVAVVSKMALYALTIVGCLKR |
| Ga0184626_101748552 | 3300018053 | Groundwater Sediment | VEREIRRRLTKRTNQQSMEYLILVAVVSMMALYALIIVGCLKPPEW |
| Ga0184635_104022002 | 3300018072 | Groundwater Sediment | VEREIRRRLTKHTKEQSMEYLILVAVVSMMALYALIIVGSLKQPEW |
| Ga0193713_10112594 | 3300019882 | Soil | VEREIRRRLTKRTKEQSMEYLILVAVVSTMALYALIIVGCLRQPEW |
| Ga0210403_102988282 | 3300020580 | Soil | MQTKEQSMEYLILVAVVSVMALYTLIIVGCLKQPEW |
| Ga0247786_10235013 | 3300022883 | Soil | IPRRLTKGTKEQSMEYLMLVAVVAMMALYALIIVGCLKQPEW |
| Ga0247751_11094351 | 3300023069 | Soil | RNGEHETPGRITTAKKEITMEYLILVAVVAVMALYALIIIGCMKQPEW |
| Ga0207673_10610421 | 3300025290 | Corn, Switchgrass And Miscanthus Rhizosphere | VQHEIPRGLTKVTEEQSMEYLILVGVVAMMALYVAIIAGCLKQAEW |
| Ga0207697_100041569 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | VEHEICRGLTKGTKEQNMAYLILIAVVAMMALYALIIVGCVKQPEW |
| Ga0207692_104920202 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VEHEICRRLTKGTKEENMEYLILVAVVTMMALYALIIVGCVKQPEW |
| Ga0207680_108888402 | 3300025903 | Switchgrass Rhizosphere | MHRCRTKDNKGANMEYLIIAAVVSMMALYALIIVGCLKHAEW |
| Ga0207659_111198722 | 3300025926 | Miscanthus Rhizosphere | TKGTKEQNMAYLILIAVVAMMALYALIIVGCVKQPEW |
| Ga0207711_116365371 | 3300025941 | Switchgrass Rhizosphere | MHRCRTKANKGANMEYLIIAAVVSMMALYALIIVGCLKHAEW |
| Ga0207676_106836021 | 3300026095 | Switchgrass Rhizosphere | ARDLSSPYKDTKEQDMAYLILVAVVAMMALYALIIVGCLKQPEW |
| Ga0207675_1021224781 | 3300026118 | Switchgrass Rhizosphere | SPYKDTKEQDMAYLILVAVGAMMALYALIIVGCLKQPEW |
| Ga0209056_103690121 | 3300026538 | Soil | VEREIRRRVTKRTKEQSMEYLILVAVVSIMALYALIIVGCLKQREW |
| Ga0209056_106448791 | 3300026538 | Soil | SRRLIKSTKEQSMEYLILVAVVSMMALYALIIVGCLKQREW |
| Ga0209577_104533102 | 3300026552 | Soil | FFKRRHMEYMIAVGVVSMMALYALIIVGCLKQPEW |
| Ga0307307_102919752 | 3300028718 | Soil | YQGPKEVPMEYLIVVAVVSMMALYALIILGCLKQREW |
| Ga0170822_115413421 | 3300031122 | Forest Soil | VEREKRRRRIKHTKEQSMEYLILVAVVAMMVLYALIIVGCLKQPEW |
| Ga0170824_1143340382 | 3300031231 | Forest Soil | MQTKEQSMEYLILVAVVSVMALYALIIVGCLKQPEW |
| Ga0170824_1235735211 | 3300031231 | Forest Soil | VEHENRRRLIKRTKEQSMEYLILVAVVAMMVLYAL |
| Ga0170818_1109430764 | 3300031474 | Forest Soil | MVGLLMPIKEMTMDYLILIAVVSMMALYALIIVGCLKQPEW |
| Ga0310915_109246882 | 3300031573 | Soil | MPRRLTKGTKEEIMEYLILVAVVSVMALYALIIIGCLKQPEW |
| Ga0306917_102514673 | 3300031719 | Soil | NVQHEMPHRLTKGTKEKIMEYLILVAVISVMALYALIIIGCLKQPEW |
| Ga0318552_103477761 | 3300031782 | Soil | GTKEKIMEYLILVAVISVMALYALIIIGCLKQPEW |
| Ga0306921_109561913 | 3300031912 | Soil | VEHQIRRRLTNPQKEQIMEYLILVAVVSVAAFYALIIIGCLKQPEW |
| Ga0310912_107708813 | 3300031941 | Soil | IALRKHVKEITMEYLILVAVASMMALYALIIIGCLKQPEW |
| Ga0310909_106220043 | 3300031947 | Soil | RLTKGTKEKIMEYLILVAVISVMALYALIIIGCLKQPEW |
| Ga0310909_112516712 | 3300031947 | Soil | PTKEESMEYLILVAVVSMMALYALIIVGCLKQPEW |
| Ga0306922_101950311 | 3300032001 | Soil | RLTNPQKEQIMEYLILVAVVSVAAFYALIIIGCLKQPEW |
| Ga0310911_109234722 | 3300032035 | Soil | GTKEEIMEYLILVAVVSVMALYALIIIGCLKQPEW |
| Ga0306924_105661251 | 3300032076 | Soil | VEHQIRRRLTNGKKEQIMEYLILVAVVSVAALYALIIIRCLKQPEW |
| Ga0306924_106108433 | 3300032076 | Soil | NGEHETNGRVTKAKKEMAMEYLILVAVVSMMALYARIIVGCLKQPEW |
| ⦗Top⦘ |