| Basic Information | |
|---|---|
| Family ID | F103718 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 45 residues |
| Representative Sequence | LAARHTGIEPAGLISECLEDLLSFQEGLKQTDDLTLLAVRRAE |
| Number of Associated Samples | 71 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.99 % |
| % of genes near scaffold ends (potentially truncated) | 98.02 % |
| % of genes from short scaffolds (< 2000 bps) | 89.11 % |
| Associated GOLD sequencing projects | 65 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.050 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (42.574 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.614 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.564 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.70% β-sheet: 0.00% Coil/Unstructured: 49.30% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF05193 | Peptidase_M16_C | 3.96 |
| PF10944 | DUF2630 | 2.97 |
| PF00027 | cNMP_binding | 1.98 |
| PF13560 | HTH_31 | 1.98 |
| PF00577 | Usher | 0.99 |
| PF13411 | MerR_1 | 0.99 |
| PF02866 | Ldh_1_C | 0.99 |
| PF05229 | SCPU | 0.99 |
| PF00326 | Peptidase_S9 | 0.99 |
| PF00069 | Pkinase | 0.99 |
| PF00330 | Aconitase | 0.99 |
| PF00296 | Bac_luciferase | 0.99 |
| PF08681 | DUF1778 | 0.99 |
| PF16264 | SatD | 0.99 |
| PF00180 | Iso_dh | 0.99 |
| PF06271 | RDD | 0.99 |
| PF03992 | ABM | 0.99 |
| PF00115 | COX1 | 0.99 |
| PF00970 | FAD_binding_6 | 0.99 |
| PF02371 | Transposase_20 | 0.99 |
| PF03473 | MOSC | 0.99 |
| PF05050 | Methyltransf_21 | 0.99 |
| PF00535 | Glycos_transf_2 | 0.99 |
| PF00578 | AhpC-TSA | 0.99 |
| PF00440 | TetR_N | 0.99 |
| PF07228 | SpoIIE | 0.99 |
| PF00092 | VWA | 0.99 |
| PF04255 | DUF433 | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.96 |
| COG3188 | Outer membrane usher protein FimD/PapC | Cell motility [N] | 1.98 |
| COG0039 | Malate/lactate dehydrogenase | Energy production and conversion [C] | 0.99 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.99 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.99 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.99 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.99 |
| COG4453 | Uncharacterized conserved protein, DUF1778 family | Function unknown [S] | 0.99 |
| COG5430 | Fimbrial subunit ScuA/B, ScuA/B/SCPU domain | Extracellular structures [W] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.05 % |
| Unclassified | root | N/A | 4.95 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000789|JGI1027J11758_12621152 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 864 | Open in IMG/M |
| 3300001593|JGI12635J15846_10150903 | All Organisms → cellular organisms → Bacteria | 1594 | Open in IMG/M |
| 3300001593|JGI12635J15846_10425174 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300001867|JGI12627J18819_10096425 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100659962 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100951677 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300004635|Ga0062388_101841149 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300005171|Ga0066677_10639754 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300005176|Ga0066679_10142614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1494 | Open in IMG/M |
| 3300005553|Ga0066695_10140694 | All Organisms → cellular organisms → Bacteria | 1499 | Open in IMG/M |
| 3300005557|Ga0066704_10285861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1117 | Open in IMG/M |
| 3300005568|Ga0066703_10148539 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
| 3300005569|Ga0066705_10839818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300005569|Ga0066705_10921628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300005993|Ga0080027_10027255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2038 | Open in IMG/M |
| 3300006162|Ga0075030_100422177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1062 | Open in IMG/M |
| 3300006162|Ga0075030_101154836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300006174|Ga0075014_100122442 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
| 3300006800|Ga0066660_11552672 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300007265|Ga0099794_10111925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1368 | Open in IMG/M |
| 3300007265|Ga0099794_10539583 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300009088|Ga0099830_11261606 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300009089|Ga0099828_11170468 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300010159|Ga0099796_10437239 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300010337|Ga0134062_10768547 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300011271|Ga0137393_11536226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300012198|Ga0137364_10835165 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300012198|Ga0137364_11046885 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300012198|Ga0137364_11375577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300012202|Ga0137363_10002280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 11375 | Open in IMG/M |
| 3300012202|Ga0137363_11694190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300012203|Ga0137399_10393440 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300012203|Ga0137399_11204052 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300012203|Ga0137399_11220640 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300012205|Ga0137362_11250552 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300012208|Ga0137376_11606971 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300012361|Ga0137360_10738371 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300012361|Ga0137360_10770951 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300012361|Ga0137360_11856004 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300012362|Ga0137361_10324880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1410 | Open in IMG/M |
| 3300012582|Ga0137358_10051372 | All Organisms → cellular organisms → Bacteria | 2746 | Open in IMG/M |
| 3300012683|Ga0137398_10501004 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300012683|Ga0137398_10963430 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300012917|Ga0137395_10058359 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2454 | Open in IMG/M |
| 3300012922|Ga0137394_10024779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4837 | Open in IMG/M |
| 3300012925|Ga0137419_11249189 | Not Available | 623 | Open in IMG/M |
| 3300012925|Ga0137419_11358465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300012925|Ga0137419_11923123 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300012927|Ga0137416_10420382 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1136 | Open in IMG/M |
| 3300012927|Ga0137416_11870963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300012927|Ga0137416_12172966 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300014166|Ga0134079_10001614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6099 | Open in IMG/M |
| 3300014166|Ga0134079_10155932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300015241|Ga0137418_10094649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2695 | Open in IMG/M |
| 3300015372|Ga0132256_103355565 | Not Available | 538 | Open in IMG/M |
| 3300018431|Ga0066655_10087845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1711 | Open in IMG/M |
| 3300020580|Ga0210403_10301813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1312 | Open in IMG/M |
| 3300020581|Ga0210399_10163754 | All Organisms → cellular organisms → Bacteria | 1842 | Open in IMG/M |
| 3300021170|Ga0210400_10370305 | Not Available | 1180 | Open in IMG/M |
| 3300021170|Ga0210400_10518769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 983 | Open in IMG/M |
| 3300021475|Ga0210392_10058524 | All Organisms → cellular organisms → Bacteria | 2403 | Open in IMG/M |
| 3300021479|Ga0210410_10422754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1193 | Open in IMG/M |
| 3300021559|Ga0210409_10006874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 11809 | Open in IMG/M |
| 3300021559|Ga0210409_11560820 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300024288|Ga0179589_10104021 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300025527|Ga0208714_1093633 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300026277|Ga0209350_1143525 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300026285|Ga0209438_1074751 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300026296|Ga0209235_1202550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300026318|Ga0209471_1002817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9934 | Open in IMG/M |
| 3300026446|Ga0257178_1038411 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300026482|Ga0257172_1054097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300026482|Ga0257172_1092459 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300026508|Ga0257161_1023393 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300026524|Ga0209690_1286512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300026557|Ga0179587_10605072 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300026557|Ga0179587_11144413 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300027034|Ga0209730_1006231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1066 | Open in IMG/M |
| 3300027061|Ga0209729_1026949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
| 3300027629|Ga0209422_1023855 | Not Available | 1517 | Open in IMG/M |
| 3300027629|Ga0209422_1067898 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300027643|Ga0209076_1136112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| 3300027671|Ga0209588_1057877 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
| 3300027729|Ga0209248_10126122 | Not Available | 768 | Open in IMG/M |
| 3300027738|Ga0208989_10178165 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300027862|Ga0209701_10447670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 711 | Open in IMG/M |
| 3300027875|Ga0209283_10341027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 984 | Open in IMG/M |
| 3300028536|Ga0137415_10281330 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1469 | Open in IMG/M |
| 3300028536|Ga0137415_11265735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300028536|Ga0137415_11330766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300028536|Ga0137415_11388196 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300030991|Ga0073994_12078355 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300031446|Ga0170820_14653218 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300031720|Ga0307469_10122828 | All Organisms → cellular organisms → Bacteria | 1882 | Open in IMG/M |
| 3300031820|Ga0307473_10365871 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 933 | Open in IMG/M |
| 3300031962|Ga0307479_10003128 | All Organisms → cellular organisms → Bacteria | 15053 | Open in IMG/M |
| 3300031962|Ga0307479_11898400 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300032180|Ga0307471_100385841 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1523 | Open in IMG/M |
| 3300032180|Ga0307471_100602315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1258 | Open in IMG/M |
| 3300032180|Ga0307471_101281930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 895 | Open in IMG/M |
| 3300032180|Ga0307471_102254052 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 42.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.90% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.96% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.97% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.98% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.99% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.99% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.99% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027034 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027061 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J11758_126211521 | 3300000789 | Soil | SLAARHTGMEPDGLISKCLEDLLTFGEGLKQTDDLTLLAVRRAD* |
| JGI12635J15846_101509031 | 3300001593 | Forest Soil | KPAGLISECIGDLLSFGEGSKQTDDLTLLAVRRADKIAPPA* |
| JGI12635J15846_104251741 | 3300001593 | Forest Soil | KPAGLISECIGDLLSFGEGSKQTDDLTLLAVRRADKSAPPA* |
| JGI12627J18819_100964251 | 3300001867 | Forest Soil | ASRHLGKTPDGLISECLQDLTFFGDGLKQTDDLTLLVVRRAA* |
| JGIcombinedJ26739_1006599621 | 3300002245 | Forest Soil | AARHVRMKPAGLISECIGDLLSFGEGSKQTDDLTLLAVRRADKSAPPA* |
| JGIcombinedJ26739_1009516772 | 3300002245 | Forest Soil | LAARHVRMKPAGLISECIGDLLSFGEGSKQTDDLTLLAVRRADKSALPV* |
| Ga0062388_1018411491 | 3300004635 | Bog Forest Soil | QHKCAESAALISKCLEDLLLFGEGEKQADDLTLLAVRRVA* |
| Ga0066677_106397541 | 3300005171 | Soil | HTGIEPAGLISKCLEDLQSFAEGVKQPDDLTLLAVQRAE* |
| Ga0066679_101426141 | 3300005176 | Soil | LHRIRALAARHIGIAPDGLISECLGDLVNFGEGLKQTDDLTLLVVRRAE* |
| Ga0066695_101406943 | 3300005553 | Soil | ALAAQHKGKAPDGLISECLEDLVSFGEGLKQTDDLTLLVVRRAE* |
| Ga0066704_102858611 | 3300005557 | Soil | GKAPDGLISECLEDLVSFGEGLKQTDDLTLLVVRRSE* |
| Ga0066703_101485391 | 3300005568 | Soil | AARHTGIEPAGLISKCLEDLQSFAEGLKQPDDLTLLALQRAE* |
| Ga0066705_108398182 | 3300005569 | Soil | TGIEPAGLISKCLEDLQSFAEGVKQPDDLTLLAVQRAE* |
| Ga0066705_109216281 | 3300005569 | Soil | AEYGLHRIRTLAARHPGIEPAGLISKCLEDLQGFAEGLKQPDDLTLLAVQRAE* |
| Ga0080027_100272551 | 3300005993 | Prmafrost Soil | LISECLGDLLSFGEGSKQTDDLTLLAIRRAEKNAPPA* |
| Ga0075030_1004221771 | 3300006162 | Watersheds | EPAGLISKCLEDLLTFREGLKQTDDLTLLAIRRTE* |
| Ga0075030_1011548361 | 3300006162 | Watersheds | EPAGLISKCLEDLLTFREGLKQTDDLTLLAVRRAE* |
| Ga0075014_1001224421 | 3300006174 | Watersheds | ERIRTLAGRNRGIEPEGLISKSLEDLVTFREGLKQTDDLTLLAVRRGV* |
| Ga0066660_115526721 | 3300006800 | Soil | IAPDGLISECLGDLVNFGEGLKQTDDLTLLVVRRAE* |
| Ga0099794_101119251 | 3300007265 | Vadose Zone Soil | NRAGAEYGLDRIRALAARHTEIESAGLISECLADLLRFQEGLKQTDDLALLAVRRAD* |
| Ga0099794_105395831 | 3300007265 | Vadose Zone Soil | NHVGAEYGLQRIRTLTARHAGLEPKGLISECLVDLLSFQEGLRQTDDLTLLAVQRAN* |
| Ga0099830_112616061 | 3300009088 | Vadose Zone Soil | EYGLHRIRTLAAQQTGIESAGLISQCLEDLLIFGEGLKQTDDLTLLAVRRAE* |
| Ga0099828_111704681 | 3300009089 | Vadose Zone Soil | RIRTLAARHIGIEPAGLISKCLEDLLSFGEGLKQTDDLTLLAVRRAE* |
| Ga0099796_104372391 | 3300010159 | Vadose Zone Soil | IRTLAARHAGIEPAGLLSECLKDLLSFGEGLKQTDDLTLLVLRRSE* |
| Ga0134062_107685471 | 3300010337 | Grasslands Soil | RIRTLTAQQTGIESAGLISQCLEDLLIFGEGLKQTDDLTLLAVRRAE* |
| Ga0137393_115362262 | 3300011271 | Vadose Zone Soil | IEPAGLISECLEDLLSFREGLKQTDDLTLLAVRRAE* |
| Ga0137364_108351652 | 3300012198 | Vadose Zone Soil | GQEYGLHRIRALAARHGGIAPAGLISECLEDLVSFGEGLKQTDDLTLLVVRRAAQAGVSA |
| Ga0137364_110468852 | 3300012198 | Vadose Zone Soil | GLQRIRALAARLIGKAPDALISECLEDLLSFGEGLKQTDDLTLLVLRRTE* |
| Ga0137364_113755772 | 3300012198 | Vadose Zone Soil | TLAARHAGTEPAGLISKCLEDLQSFAEGLKQPDDLTLLAVQRVE* |
| Ga0137363_1000228012 | 3300012202 | Vadose Zone Soil | GLHRIRGLAARHIGKTPDGLISECLEDLMSFGEGLKQTDDLTLLVVRRAE* |
| Ga0137363_116941902 | 3300012202 | Vadose Zone Soil | EYGLQRIRSLATRHTGTEPAGLISKCLEDLQTFGEGLKQTDDLTLLAVQRAE* |
| Ga0137399_103934401 | 3300012203 | Vadose Zone Soil | RIQTLAARHTGREPAGLISECLGDLLSFQEGTKQTDDLTLLAVRRAE* |
| Ga0137399_112040522 | 3300012203 | Vadose Zone Soil | AGQEYGLHRIRGLAARHIGKAPDGLIAECLQDLMSFGDGLKQTDDLTLLVVRRAELSPL* |
| Ga0137399_112206401 | 3300012203 | Vadose Zone Soil | GLHRIGTLAAQQTGIESAGLISQCLEDLLIFGEGLKQTDDLTLLAVRRAE* |
| Ga0137362_112505522 | 3300012205 | Vadose Zone Soil | PAGLISECLGDLLSFLEGLKQTDDLTLLALRRAE* |
| Ga0137376_116069711 | 3300012208 | Vadose Zone Soil | LHRIRTLAAQQTGIESAGLISQCLEDLLIFGEGLKQTDDLTLLAVRRAE* |
| Ga0137360_107383711 | 3300012361 | Vadose Zone Soil | PAGLISECLEDLLSFREGLKQTDDLTLLVVRRAE* |
| Ga0137360_107709511 | 3300012361 | Vadose Zone Soil | KTPDGLISECLQDLMSFGDGLKQTDDLTLLVVRRAD* |
| Ga0137360_118560041 | 3300012361 | Vadose Zone Soil | TGIESAGLISECLEDLLIFGEGLKQADDLTLLAVRRAE* |
| Ga0137361_103248802 | 3300012362 | Vadose Zone Soil | IRTLAARHIGMEPDGLISKCLEDLLSFGEGLKQTDDLTLLVVRRAE* |
| Ga0137358_100513724 | 3300012582 | Vadose Zone Soil | GIEPAGLISECLEDLLSFQEGLKQTDDLTLLAVRRAE* |
| Ga0137398_105010041 | 3300012683 | Vadose Zone Soil | ARHTGKEPAGLISECLGDLLSFQEGTKQTDDLTLLAVRRAD* |
| Ga0137398_109634301 | 3300012683 | Vadose Zone Soil | ARHTGKEPAGLISECLGDLLSFQEGTKQTDDLTLLAVRRAE* |
| Ga0137395_100583591 | 3300012917 | Vadose Zone Soil | VGIAPAGLISECLEDLVSFGEGLKQTDDLTLLAVRRAA* |
| Ga0137394_100247796 | 3300012922 | Vadose Zone Soil | AARHTGKAPDGLISECLDDLLSFGEGLKQMDDLTLLVVRRTE* |
| Ga0137419_112491891 | 3300012925 | Vadose Zone Soil | TLAAQHTGIESAGLISECLEDLLIFGEGLKQADDLTLLAVRRAE* |
| Ga0137419_113584651 | 3300012925 | Vadose Zone Soil | HRIRTLAARHTGIEPAGLISECLEDLLSFREGLKQTDDLTLLAVRRAD* |
| Ga0137419_119231231 | 3300012925 | Vadose Zone Soil | GIESAGLISQCLEDLLIFGEGLKQTDDLTLLAVRRAE* |
| Ga0137416_104203821 | 3300012927 | Vadose Zone Soil | HRIRTLAARHTGIEPAGLISECLEDLLSFQEGLKQTDDLTLLAVRRAE* |
| Ga0137416_118709632 | 3300012927 | Vadose Zone Soil | HRIRTLAARHTGIEPAGLISECLEDLLSFQEGLKQTDDLTLLAVRRAD* |
| Ga0137416_121729661 | 3300012927 | Vadose Zone Soil | RHTGIEPSGLISECLEDLLSFREGLKQTDDLTLLAVRRAE* |
| Ga0134079_100016141 | 3300014166 | Grasslands Soil | ARHGGIAPAGLISECLEDLVSFGEGLKQTDDLTLLVVRRAAQAGVSA* |
| Ga0134079_101559322 | 3300014166 | Grasslands Soil | ARHGGIAPAGLISECLEDLVSFGEGLKQTDDLTLLVVRRAAEAGVSA* |
| Ga0137418_100946493 | 3300015241 | Vadose Zone Soil | YGLHRIRTLAARHTGIEPAGLISKCLEDLQSFAEGVKQPDDLTLLAVQRAE* |
| Ga0132256_1033555651 | 3300015372 | Arabidopsis Rhizosphere | RNPAGQEYGVPRIRALAARHKGMGADGLISECLEDLASLGAGLKQAHDLTLLVVRRAA* |
| Ga0066655_100878452 | 3300018431 | Grasslands Soil | GAEYGLHRIRTLAARHPGIEPAGLISKCLEDLQCFAEGLKQPDDLTLLAVQRAE |
| Ga0210403_103018131 | 3300020580 | Soil | EYGLQRIRALAARHTGIEPDGLISKCLEDLFRFGEGVKQTDDLTLLAVRRAE |
| Ga0210399_101637541 | 3300020581 | Soil | LAEHHTGKTPDGLISACLEDLVSFGDGLKQTDDLTLLVVRRAE |
| Ga0210400_103703052 | 3300021170 | Soil | HRIRTLAAQKTGIESAGLISECLEDLLIFGEGLKQTDDLTLLAVRRAE |
| Ga0210400_105187691 | 3300021170 | Soil | EMESAGLISECLADLLSFQEGLKQTDDLALLAVRRAD |
| Ga0210392_100585241 | 3300021475 | Soil | EYGLRRIHALADQHRCIEAQELISKCLDDLASFGDGLKQTDDLTLLAVRRVA |
| Ga0210410_104227541 | 3300021479 | Soil | YGLHRIRMLAARHAGIEAAGLISECIGDLLSFAEGLKQTDDLTLLAVRRADKSSPPA |
| Ga0210409_1000687411 | 3300021559 | Soil | GLQRIRALAARSTGIEPDGLISKCLEDLFLFGEGVKQTDDLTLLAVRRAA |
| Ga0210409_115608201 | 3300021559 | Soil | TLAARHAGLEPKGLISECLVDLLSFQEGTKQTDDLTLLAVQRAV |
| Ga0179589_101040213 | 3300024288 | Vadose Zone Soil | TGKTPDGLISECLQDLMSFGDGLKQTDDLTLLVVRRAE |
| Ga0208714_10936332 | 3300025527 | Arctic Peat Soil | NPAGLISECLGDLLSFGGGSKQTDDLTLLAIRRTEKNRAPA |
| Ga0209350_11435251 | 3300026277 | Grasslands Soil | ARHVGIAPAGLISECLEDLVSFGEGLKQTDDLTLLVVRRAAQAGVSV |
| Ga0209438_10747512 | 3300026285 | Grasslands Soil | LASQHTGKTPDGLISECLQDLMSFGDGLKQTDDLTLLVVRRAE |
| Ga0209235_12025501 | 3300026296 | Grasslands Soil | IEPAGLISECLEDLQSFGEGLKQPDDLTLLAVQRAE |
| Ga0209471_10028179 | 3300026318 | Soil | YGLHRIRTLAARHAGTEPAGLISKCLEDLQSFAEGLKQPDDLTLLAVQRVE |
| Ga0257178_10384111 | 3300026446 | Soil | APDALISECLEDLLNFGEGLRQTDDLTLLVVRRAE |
| Ga0257172_10540972 | 3300026482 | Soil | AARHTGIEPAGLISNCLEDLLSFREGLKQTDDLTLLAVRRVE |
| Ga0257172_10924591 | 3300026482 | Soil | VRALAARHTGIEPAGLISECLQDLLGFREGLKQTDDLTLLAVQRAE |
| Ga0257161_10233931 | 3300026508 | Soil | AEYGLHRIRTLAARHAGIEPAGLISECLKDLLSFGEGLKQTDDLTLLAVRRGD |
| Ga0209690_12865121 | 3300026524 | Soil | RNRAGTEYGLHRIQTLAARHTGIEPAGLISKCLEDLQSFAEGVKQPDDLTLLAVQRAE |
| Ga0179587_106050722 | 3300026557 | Vadose Zone Soil | TLAARHAGIEPAGLISACLKDLLSVGEGLKQTDDLTLLAVRRGD |
| Ga0179587_111444131 | 3300026557 | Vadose Zone Soil | GKAPDALISECLEDLLNFGEGLRQTDDLTLLVVRRAE |
| Ga0209730_10062312 | 3300027034 | Forest Soil | RNRAGTEYGLDRIRALAARHTEIESAGLISECLADLLSFQEGLKQTDDLALLAVRRAD |
| Ga0209729_10269492 | 3300027061 | Forest Soil | ASRHLGKTPDGLISECLQDLTFFGDGLKQTDDLTLLVVRRAA |
| Ga0209422_10238551 | 3300027629 | Forest Soil | ARHVRMNPAGLISECIGDLLSFGEGSKQTDDLTLLAVRRADKIAPPA |
| Ga0209422_10678982 | 3300027629 | Forest Soil | ISECIGDLLSFGEGSKQTDDLTLLAVRRADKSAPPA |
| Ga0209076_11361122 | 3300027643 | Vadose Zone Soil | IEPAGLISECLKDLLSFGEGLKQTDDLTLLAVRRGD |
| Ga0209588_10578771 | 3300027671 | Vadose Zone Soil | RNRAGAEYGLDRIRALAARHTEIESAGLISECLADLLRFQEGLKQTDDLALLAVRRAD |
| Ga0209248_101261221 | 3300027729 | Bog Forest Soil | LPRIHKLAAQHNCVEPADLISKCLEDLLLYGEGTKQADDLTLLAVRRAA |
| Ga0208989_101781652 | 3300027738 | Forest Soil | YGLHRIRTLAEQQVGIESAGLISKCLEDLVIFTEGLKQMDDLTLLAVRRAA |
| Ga0209701_104476702 | 3300027862 | Vadose Zone Soil | HRIRTLAARHTGIEPAGLITECLEDLLSFREGLKQTDDLTLLAVQRAE |
| Ga0209283_103410272 | 3300027875 | Vadose Zone Soil | RHTGIEPAGLITECLEDLLSFREGLKQTDDLTLLAVQRAE |
| Ga0137415_102813301 | 3300028536 | Vadose Zone Soil | EYGLHRIHTLAARHTGIEPAGLISNCLEDLLSFREGLKQTDDLTLLAVRRVE |
| Ga0137415_112657351 | 3300028536 | Vadose Zone Soil | LAARHTGIEPAGLISECLEDLLSFQEGLKQTDDLTLLAVRRAE |
| Ga0137415_113307661 | 3300028536 | Vadose Zone Soil | EYGLHRIRTLAARHTGIEPAGLISKCLEDLLSFAEGVKQPDDLTLLAVQRAE |
| Ga0137415_113881961 | 3300028536 | Vadose Zone Soil | RHTGIEPSGLISECLEDLLSFREGLKQTDDLTLLAVRRAE |
| Ga0073994_120783551 | 3300030991 | Soil | MKPAGLISECIGDLLSFGEGSKQIDDLTLLAVRRADKSAPPA |
| Ga0170820_146532181 | 3300031446 | Forest Soil | RCIAAAELIAKCLEDLTTFGDGLKQTDDLTLLAVRRVA |
| Ga0307469_101228284 | 3300031720 | Hardwood Forest Soil | AERHVGKAADGLISECLQDLVRFGDGLKPSDDLTLLVVRRAD |
| Ga0307473_103658711 | 3300031820 | Hardwood Forest Soil | KGPAGLISECLEDLLNFQEGIKQTDDLTLLAVRQAA |
| Ga0307479_100031281 | 3300031962 | Hardwood Forest Soil | RMQPAGLISECLQDLLSFREGLKQTDDLTLLAVRRAE |
| Ga0307479_118984001 | 3300031962 | Hardwood Forest Soil | ARHTGKAPDALISECLEDLLNFGEGLRQTDDLTLLVVRRAE |
| Ga0307471_1003858411 | 3300032180 | Hardwood Forest Soil | EYGLQRIRTLATRHAGIEPVGLISKCLEDLLSFGEGLKQTDDLTLLAVQRAE |
| Ga0307471_1006023151 | 3300032180 | Hardwood Forest Soil | EYGVPRIHALAARHTGKAPDGLISECLADLASFGQGLKQTDDLTLLVVRRAA |
| Ga0307471_1012819302 | 3300032180 | Hardwood Forest Soil | LATRHSTKGPAGLISECLEDLLNFQEGIKQTDDLTLLAVRQAA |
| Ga0307471_1022540521 | 3300032180 | Hardwood Forest Soil | GAEYGLRRIQALAARYTGKEPAGLISECLGDLLSFQEGMKQTDDLTLLAVRRAE |
| ⦗Top⦘ |