NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F103670

Metagenome Family F103670

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F103670
Family Type Metagenome
Number of Sequences 101
Average Sequence Length 43 residues
Representative Sequence TKLLVTLKNEKASIKQQRIERGMEAKFSKLPSKDLPKGSGL
Number of Associated Samples 85
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 8.91 %
% of genes near scaffold ends (potentially truncated) 87.13 %
% of genes from short scaffolds (< 2000 bps) 93.07 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (63.366 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(9.901 % of family members)
Environment Ontology (ENVO) Unclassified
(32.673 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(39.604 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 42.03%    β-sheet: 0.00%    Coil/Unstructured: 57.97%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF13884Peptidase_S74 8.91
PF00561Abhydrolase_1 8.91
PF00781DAGK_cat 0.99
PF12697Abhydrolase_6 0.99
PF07043DUF1328 0.99
PF13418Kelch_4 0.99
PF06280fn3_5 0.99
PF13415Kelch_3 0.99
PF11949DUF3466 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG1597Phosphatidylglycerol kinase, diacylglycerol kinase familyLipid transport and metabolism [I] 1.98
COG5487Uncharacterized membrane protein YtjA, UPF0391 familyFunction unknown [S] 0.99

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms64.36 %
UnclassifiedrootN/A35.64 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_16738356All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1390Open in IMG/M
3300000890|JGI11643J12802_10044163Not Available533Open in IMG/M
3300000955|JGI1027J12803_101098972All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales1651Open in IMG/M
3300000956|JGI10216J12902_105786732All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1640Open in IMG/M
3300002896|JGI24802J43972_1018794All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300002903|JGI24801J43971_1010326Not Available514Open in IMG/M
3300004153|Ga0063455_100733650All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium671Open in IMG/M
3300005294|Ga0065705_11135223Not Available515Open in IMG/M
3300005329|Ga0070683_102014978All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300005365|Ga0070688_100346336Not Available1087Open in IMG/M
3300005437|Ga0070710_11454452Not Available514Open in IMG/M
3300005535|Ga0070684_101986011Not Available549Open in IMG/M
3300005719|Ga0068861_101704730Not Available623Open in IMG/M
3300005764|Ga0066903_100544078All Organisms → cellular organisms → Bacteria1988Open in IMG/M
3300005764|Ga0066903_100702816All Organisms → cellular organisms → Bacteria1783Open in IMG/M
3300005764|Ga0066903_105393698Not Available675Open in IMG/M
3300005764|Ga0066903_106920286All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300005937|Ga0081455_10447686Not Available883Open in IMG/M
3300006032|Ga0066696_10898835All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300006175|Ga0070712_100501408All Organisms → cellular organisms → Bacteria1017Open in IMG/M
3300006175|Ga0070712_101651261All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300006175|Ga0070712_101655090All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300006175|Ga0070712_101698753Not Available553Open in IMG/M
3300006800|Ga0066660_10920188All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium711Open in IMG/M
3300006904|Ga0075424_102604528Not Available529Open in IMG/M
3300009093|Ga0105240_12531108Not Available531Open in IMG/M
3300009098|Ga0105245_12372224All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300009162|Ga0075423_11014366Not Available882Open in IMG/M
3300009162|Ga0075423_13163030Not Available504Open in IMG/M
3300010048|Ga0126373_11872338Not Available663Open in IMG/M
3300010335|Ga0134063_10125005All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1181Open in IMG/M
3300010336|Ga0134071_10242087All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia897Open in IMG/M
3300010361|Ga0126378_12049439All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300010366|Ga0126379_12135615Not Available662Open in IMG/M
3300010376|Ga0126381_100315211All Organisms → cellular organisms → Bacteria2148Open in IMG/M
3300010376|Ga0126381_100411137All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1888Open in IMG/M
3300010376|Ga0126381_101149300All Organisms → cellular organisms → Bacteria1122Open in IMG/M
3300010376|Ga0126381_101576958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium949Open in IMG/M
3300012004|Ga0120134_1074746All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium613Open in IMG/M
3300012200|Ga0137382_10352105All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1033Open in IMG/M
3300012205|Ga0137362_10661318All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium899Open in IMG/M
3300012356|Ga0137371_10484554All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium955Open in IMG/M
3300012361|Ga0137360_10382532All Organisms → cellular organisms → Bacteria1183Open in IMG/M
3300012361|Ga0137360_11355055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium614Open in IMG/M
3300012362|Ga0137361_10157695All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2033Open in IMG/M
3300012683|Ga0137398_10068841All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus2152Open in IMG/M
3300012923|Ga0137359_11792099Not Available501Open in IMG/M
3300012924|Ga0137413_11140949All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300012930|Ga0137407_12388651All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium505Open in IMG/M
3300012955|Ga0164298_11391686Not Available542Open in IMG/M
3300012958|Ga0164299_10872057Not Available650Open in IMG/M
3300012971|Ga0126369_13113907All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia543Open in IMG/M
3300013297|Ga0157378_10155782All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2133Open in IMG/M
3300013307|Ga0157372_11358445Not Available819Open in IMG/M
3300014745|Ga0157377_10040392All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2583Open in IMG/M
3300015358|Ga0134089_10163199All Organisms → cellular organisms → Bacteria884Open in IMG/M
3300015372|Ga0132256_102584320Not Available608Open in IMG/M
3300015373|Ga0132257_100564880All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1402Open in IMG/M
3300015374|Ga0132255_100608343All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1616Open in IMG/M
3300015374|Ga0132255_102830059Not Available742Open in IMG/M
3300015374|Ga0132255_103932584All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia631Open in IMG/M
3300016294|Ga0182041_11467809Not Available627Open in IMG/M
3300016357|Ga0182032_11503763Not Available584Open in IMG/M
3300017997|Ga0184610_1118326All Organisms → cellular organisms → Bacteria852Open in IMG/M
3300018051|Ga0184620_10290498All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300018073|Ga0184624_10131627All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium 13_1_20CM_4_54_111090Open in IMG/M
3300018081|Ga0184625_10393128All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300018433|Ga0066667_11066709Not Available698Open in IMG/M
3300018482|Ga0066669_10200408All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1528Open in IMG/M
3300018482|Ga0066669_11412784All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium631Open in IMG/M
3300019881|Ga0193707_1204065All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300019882|Ga0193713_1057435All Organisms → cellular organisms → Bacteria1113Open in IMG/M
3300020002|Ga0193730_1145394All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300021344|Ga0193719_10413812Not Available553Open in IMG/M
3300021411|Ga0193709_1006693All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus2917Open in IMG/M
3300021510|Ga0222621_1028720All Organisms → cellular organisms → Bacteria1140Open in IMG/M
3300021560|Ga0126371_10670137All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1186Open in IMG/M
3300022694|Ga0222623_10224340All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300022756|Ga0222622_11422150All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300025915|Ga0207693_10923360All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300025942|Ga0207689_11569460Not Available548Open in IMG/M
3300026116|Ga0207674_10259286All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1686Open in IMG/M
3300026116|Ga0207674_10576440All Organisms → cellular organisms → Bacteria1087Open in IMG/M
3300026328|Ga0209802_1326369Not Available507Open in IMG/M
3300026332|Ga0209803_1263029All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium593Open in IMG/M
3300026540|Ga0209376_1258831All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium737Open in IMG/M
3300026550|Ga0209474_10446129All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300027907|Ga0207428_11167150All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300028811|Ga0307292_10332467Not Available640Open in IMG/M
3300031231|Ga0170824_102344469All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium778Open in IMG/M
3300031231|Ga0170824_102747272All Organisms → cellular organisms → Bacteria2352Open in IMG/M
3300031474|Ga0170818_110304971Not Available640Open in IMG/M
3300031820|Ga0307473_10773075Not Available682Open in IMG/M
3300031890|Ga0306925_11990795Not Available549Open in IMG/M
3300031942|Ga0310916_10398686Not Available1171Open in IMG/M
3300032076|Ga0306924_11127600Not Available853Open in IMG/M
3300032770|Ga0335085_11401313All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300033289|Ga0310914_10506734Not Available1092Open in IMG/M
3300033412|Ga0310810_11144228Not Available640Open in IMG/M
3300033475|Ga0310811_10851160All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300034115|Ga0364945_0100000All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium 13_1_20CM_4_54_11848Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.90%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.90%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.91%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.94%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.96%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.96%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.97%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.97%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.97%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.98%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.98%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.98%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.99%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.99%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.99%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.99%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.99%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.99%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.99%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.99%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002896Soil microbial communities from Manhattan, Kansas, USA - Sample 300um NexteraEnvironmentalOpen in IMG/M
3300002903Soil microbial communities from Manhattan, Kansas, USA - Sample 200um NexteraEnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300012004Permafrost microbial communities from Nunavut, Canada - A30_5cm_6MEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021411Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2EnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_038141102088090014SoilLVTLKNEKASIKQQRMERGMEAKFSKLPSKDLPKGSGL
JGI11643J12802_1004416313300000890SoilMLVTLKNEKASIKQQRIERGMEAKFSKLPSKDLPRGSGL*
JGI1027J12803_10109897233300000955SoilTLKNEKASIKQQRIEHGMEAKFSKLPSKDLPKGSGP*
JGI10216J12902_10578673213300000956SoilLLVTLKNEKASIKQQRIQRGMEAKFGKLPNKDLPKGARP*
JGI24802J43972_101879413300002896SoilLTKLLVTLKNEKASIKQQRIERGMEAKFSKLPSKDLPKGPVL*
JGI24801J43971_101032613300002903SoilGLTKLLITLKNEKASIKQQRKEHGMEAKFGKLPSKDLPKGSAL*
Ga0063455_10073365023300004153SoilNEGMTKLLMSLKNEKASIKQQRIQHGMEAKFRKLPNKDLPKGPGL*
Ga0065705_1113522313300005294Switchgrass RhizosphereNEGLTKLLVTLKNEKASIKQQRIEHGMEAKFSKLPSKDLPKGLGL*
Ga0070683_10201497823300005329Corn RhizosphereLTKLLITLKNEKASIKQQRKEHGMEAKFGKLPSKDLPKGSAL*
Ga0070688_10034633623300005365Switchgrass RhizosphereEGMTKLLVTLKNEKASIKQQRIEHGMKAKFSKLPSKDLPKGSAL*
Ga0070710_1145445213300005437Corn, Switchgrass And Miscanthus RhizosphereLNEGLTKLLVTLKNEKASIKQQRIERGMEAKFSKLPNKDLPKGSGL*
Ga0070684_10198601123300005535Corn RhizosphereAANKELNEGMTKLLVMLKNEKASIKQQRNERGMETKFGKLSNKELPKGLGL*
Ga0068861_10170473023300005719Switchgrass RhizosphereGMTKLLVTLKNEKASIKQQRIEHGMEAKFSKLPSKDLQDRAYD*
Ga0066903_10054407823300005764Tropical Forest SoilMNQRLRMLKEQKASSKQQRIEDGMEAKFGKLPNKDLPKGSGL*
Ga0066903_10070281653300005764Tropical Forest SoilMTKLLKTLKNEKANIKQQRIERGMETKFSKLPSKDLPKGSGL*
Ga0066903_10539369813300005764Tropical Forest SoilTLKNEKASIKQQRTERGMEAKFGKLPSKELPKGSGL*
Ga0066903_10692028613300005764Tropical Forest SoilMTKLLVTLKNEKASIKQQRIEHGMEGKFGKLPSKDLPKGSGL*
Ga0081455_1044768623300005937Tabebuia Heterophylla RhizosphereVELGLTKLLTTLKNEKASIKQQRVEHGMEAKFSQLPSKDLPKGSGL*
Ga0066696_1089883523300006032SoilAGNKALNEGMTKLLMTLKNEKASIKQQRIERGMETKFSKLPSKDLPKGSGL*
Ga0070712_10050140813300006175Corn, Switchgrass And Miscanthus RhizosphereTKLLVTLKNEKASIKQQRIEHGMETKFGKLPSKDLPKGLGL*
Ga0070712_10165126113300006175Corn, Switchgrass And Miscanthus RhizosphereTLKNEKASIKQQRIEHGMEAKFGKLPSKELPKGSAL*
Ga0070712_10165509023300006175Corn, Switchgrass And Miscanthus RhizosphereNKGLNEGLTKLLMTLKNEKASIKQQRIERGLEAKFSKLPSKDLPKESAL*
Ga0070712_10169875313300006175Corn, Switchgrass And Miscanthus RhizosphereKALNEGMTKLLVTLKNEKASIKQQRIERGMEAKFSKLPSKDLPKGSGL*
Ga0066660_1092018813300006800SoilKNEKASIKQQRVERGMEAKFGKLPSKDLPKGVGL*
Ga0075424_10260452813300006904Populus RhizosphereTKLLVTLKNEKASIKEQRMERGMEAKFSKLPSKDLPKGPVL*
Ga0105240_1253110823300009093Corn RhizosphereNKALNEGLTKLLITLKNEKASIKQQRKEHGMEAKFGKLPSKDLPKGSAL*
Ga0105245_1237222413300009098Miscanthus RhizosphereKGLNEGLTKLLVTLKNEKASIKQQRIERGMEAKFSKLPSKDLPEGSGL*
Ga0075423_1101436623300009162Populus RhizosphereNKGLNEGLTKLLITLKNEKASIKQQREERGMEAKFSKLPSKDLPKGPVL*
Ga0075423_1316303023300009162Populus RhizosphereMSLKNEKASIKQQRIEHGMEAKFSKLLSKDLPKGSGL*
Ga0126373_1187233813300010048Tropical Forest SoilKNEKASIKQQRKEHGMETKFGKLPNKDLPKESAL*
Ga0134063_1012500513300010335Grasslands SoilEGLTKLLITLKNEKASIKQQRVERGMEAKFGKLPSKDLPKGVGL*
Ga0134071_1024208743300010336Grasslands SoilLNEGLTKLLVTLKNEKASIKQQRIERGMEAKFSKLPSKDLPKGSER*
Ga0126378_1204943923300010361Tropical Forest SoilKNEKASIKQQRIEHGMEAKFSKLPSKDLPQASGQ*
Ga0126379_1213561513300010366Tropical Forest SoilNKGLNEGMTKLLITLKNEKARIKQQRIERGMETKFSKLSSKDLPNGSGL*
Ga0126381_10031521133300010376Tropical Forest SoilLITLKNEKASIKQQRKEHGMDTKFGKLPSKELPKGSGL*
Ga0126381_10041113723300010376Tropical Forest SoilMNQRLRMLKEQKASSKQQRIEDGMEAKFGKLPKGLAKGSGL*
Ga0126381_10114930013300010376Tropical Forest SoilALNEGMTKLLITLKNEKASIKQQRKERGMEAKFGKLPSKELPKGSAL*
Ga0126381_10157695823300010376Tropical Forest SoilVTLKNEKASIKQQRIEHGMEAKFGKLPSKELPTGSEL*
Ga0120134_107474623300012004PermafrostMTKLLVTLKNEKASIKQQRIERGMEAKFSKLPSKDLPKGSGL*
Ga0137382_1035210513300012200Vadose Zone SoilLNEGLGKLVDTLKEQKASIKQQRIERGMEAKFSQLPNKELPKQ*
Ga0137362_1066131823300012205Vadose Zone SoilVETLKEQKASIKQQRIERGMEAKFSKLSSKELPKQTTQ*
Ga0137371_1048455423300012356Vadose Zone SoilLITLKNEKASIKQQRVERGMEAKFGKLPSKDLPKASGP*
Ga0137360_1038253213300012361Vadose Zone SoilKLLVTLKNEKASIKQQRIERGTEAKFSKLPSKDLPKGSGL*
Ga0137360_1135505513300012361Vadose Zone SoilKLLVTLKNEKASIKQQRIERGMEAKFSKLPNKELPKASGL*
Ga0137361_1015769543300012362Vadose Zone SoilVETLKEQKASIKQQRIERGMEAKFSKLSSKELPKQSSQ*
Ga0137398_1006884113300012683Vadose Zone SoilLLVTLKNETASIKQQRIERGMEARFSKLPSKDLPKGWGL*
Ga0137359_1179209923300012923Vadose Zone SoilDGLTKLLMTLKAQKASIKQQRIEHGMEAKFSKLPSKELPKGSAP*
Ga0137413_1114094913300012924Vadose Zone SoilNEGLTKLLVTLKNEKASIKQQRTERGMEAKFSKLPSKDLPKGSGL*
Ga0137407_1238865113300012930Vadose Zone SoilLVTLKNEKASIKQQRIEREMEAKFGKLSGKELPKGSGP*
Ga0164298_1139168613300012955SoilNKGLNEGLTKLLVTLKNEKAIIKQQRIEHGMEAKFSKLTSKDLPKGSGL*
Ga0164299_1087205723300012958SoilTLKNEKASIKQQRIEHGMEAKFSKLPSKDLPKASGL*
Ga0126369_1311390723300012971Tropical Forest SoilMTKLLKTLKNEKANIKQQRIERGMETKFSKLPSEDLPKGSGL*
Ga0157378_1015578213300013297Miscanthus RhizosphereLVTLKNEKASIKQQRIEHGMETKFLKLPSKDLPKGSGL*
Ga0157372_1135844513300013307Corn RhizosphereKNQKTSLKQQRIEHGMEAKFGKLPSKDLPRGSGL*
Ga0157377_1004039213300014745Miscanthus RhizosphereGNKGLNEGLTKLLVTLKNEKASIKQQRIEHGMEAKFSKLPSKDLPKGSAL*
Ga0134089_1016319913300015358Grasslands SoilMTLKDQKASINQQRIERGMEAKFSKLPSKELPKGSGP*
Ga0132256_10258432013300015372Arabidopsis RhizosphereAGNMALNEGMTKLLVTLKNQKTSLKQQRIEHGMEAKFGKLPSKDLPRGSGL*
Ga0132257_10056488013300015373Arabidopsis RhizosphereMTKLLVTLKNEKASIKQQRTERGMETKFSKLPSKDLPKGSGP*
Ga0132255_10060834333300015374Arabidopsis RhizosphereNDGLTKLLVTLKNEKASIKQQRIEHGMETKFGKLPSKELPKGSAL*
Ga0132255_10283005933300015374Arabidopsis RhizosphereGLTKLLVTLKNEKASIKQQRIDRGMEAKFSKLPSKDLPKGSGL*
Ga0132255_10393258423300015374Arabidopsis RhizosphereVTLKNEKASIKQQRIEHGMEAKFSKLPSKELPKGSKL*
Ga0182041_1146780913300016294SoilLLITLKNEKASIKQQREERGMEAKFSKLPSKDLPKGPVL
Ga0182032_1150376313300016357SoilNKGLNDGLTKLLTTLKNEKASVKQQRIDRGMETKFGKLPSKDLPKGSGS
Ga0184610_111832623300017997Groundwater SedimentTKLLVTLKNEKASIKQQRIERGMEAKFSKLPSKDLPK
Ga0184620_1029049823300018051Groundwater SedimentTKLLVTLKNEKASIKQQRIERGMEAKFSKLPSKDLPKGSGL
Ga0184624_1013162713300018073Groundwater SedimentGNKGLNEGLTKLLMTLKKEKASIKQQRIERGMEAKFSKLPSKDLPKGLGL
Ga0184625_1039312813300018081Groundwater SedimentNKGLNEGMTKLLMTLKNEKASIKQQRIERGMEAKFSKLPSKDLPKGSGL
Ga0066667_1106670913300018433Grasslands SoilVTLKNEKASIKQQRIERGMETKFSKLPSKDLPKGSGL
Ga0066669_1020040813300018482Grasslands SoilEGLTKLLITLKNEKASIKQQRVERGMEAKFGKLPSKDLPKGVGL
Ga0066669_1141278413300018482Grasslands SoilEGLTKLLITLKNEKASIKQQRVERGMEAKFGKLPSKDLPKASGP
Ga0193707_120406513300019881SoilMTKLLVTLKNEKASIKQQRIERGMEAKFSKLPSKDLPK
Ga0193713_105743523300019882SoilLNDGLTKLLMTLKAQKASIKQQRIEHGMEAKFSKLPSKELPKGSGP
Ga0193730_114539413300020002SoilAGNKALNEGMTKLLVTLKNEKASIKQQRIERGMEAKFSKLPSKDLPK
Ga0193719_1041381223300021344SoilTKLLMTLKAQKASIKQQRIEHGMEAKFSKLPSKELPKGSGT
Ga0193709_100669353300021411SoilAGNKAPNEGMTKLLVTLKNEKASIKQQRIERGMEAKFSKLPSKDLPKGSGF
Ga0222621_102872023300021510Groundwater SedimentGLNEGLTKLLMTLKNEKASIKQQRIERGMEAKFSKLPSKDLPK
Ga0126371_1067013723300021560Tropical Forest SoilMNQRLRMLKEQKASSKQQRIEDGMEAKFGKLPNKDLPKGSGL
Ga0222623_1022434013300022694Groundwater SedimentNKGLNEGMTKLLMTLKNEKASIKQQRIERGMEAKFSKLPSKDLPK
Ga0222622_1142215013300022756Groundwater SedimentKLLVTLKNEKASIKQQRIEHGMEAKFGKLPSKDLPK
Ga0207693_1092336013300025915Corn, Switchgrass And Miscanthus RhizosphereLNEGLTKLLMTLKNEKASIKQQRIEHGMEAKFGKLPSKELPKGSAL
Ga0207689_1156946013300025942Miscanthus RhizosphereNEGLTKMLVTLKNEKASIKQQRIERGMEAKFSKLPNTELPKGSGLSPRD
Ga0207674_1025928613300026116Corn RhizosphereLKNEKASIKQQRKEHGMEAKFGKLPSKDLPKGSAL
Ga0207674_1057644013300026116Corn RhizosphereNEKASIKQQRIERGMEAKFSKLPNTELPKGSGLSPRD
Ga0209802_132636923300026328SoilLTKLLMTLKDQKASINQQRIERGMEAKFSKLPSKELPKGSGPAMCWDY
Ga0209803_126302923300026332SoilLNEGLGKLVETLKEQKASIKQQRIERGMEAKFSKLPSKELPK
Ga0209376_125883133300026540SoilNEGLTKLLITLKNEKASIKQQRVERGMEAKFGKLPSKDLPKGVGL
Ga0209474_1044612923300026550SoilLLVTLKNEKASIKQQRIERGMEAKFSKLPSKDLPKGLGL
Ga0207428_1116715023300027907Populus RhizosphereGLTKLLVTLKNEMASIKHQRIERGMDAKFSKLPSKDLPKGL
Ga0307292_1033246713300028811SoilNEGLTKLLVTLKNEKASIKQQRIERGMEAKFSKLPSKDLPKGSGL
Ga0170824_10234446913300031231Forest SoilGNKGLNEGLTKLLITLKNEKASIKQQREERGMEAKFGKLPNKDLPKGSGL
Ga0170824_10274727213300031231Forest SoilTLKNEKASIKQQRIEHGMEAKFSKLLSKDLPKGSGL
Ga0170818_11030497123300031474Forest SoilAGNKGLNEGLTKLLVTLKNEKASIKQQRIERGMEAKFSKLPSKDLPKGSGL
Ga0307473_1077307523300031820Hardwood Forest SoilLVTLQNEKSSIKQQRIERGMEAKFSKLPSKDLPKGSGL
Ga0306925_1199079523300031890SoilLNEGMTKLLITLKNEKASIKQQRIERGMEGKFGKLPSKDLPKGLSL
Ga0310916_1039868623300031942SoilGLNDGLTKLLTILKNEKASIKQQRIERGMEAKFSKLPNKELPKGSGP
Ga0306924_1112760023300032076SoilKGLNEGLTKLLITLKNEKASIKQQREERGMEAKFSKLPSKDLPKGPVL
Ga0335085_1140131313300032770SoilLTKLLVTLKNEKASIKQQRIEHGMEAKFLNLPSKDLPKVSGP
Ga0310914_1050673413300033289SoilLTKLLTTLKNEKASIKQQRIERGMEAKFSKLPNKELPKGSGP
Ga0310810_1114422823300033412SoilEGMTKLLVMLKNEKASIKQQRNERGMETKFGKLSNKELPKGLGL
Ga0310811_1085116023300033475SoilVTLKNEKASIKQQRIEHGMEAKFSKLPSKDLPKASGL
Ga0364945_0100000_21_1493300034115SedimentMTKLLMTLKNEKASIKQQRIERGMEAKFSKLPSKDLPKGSGL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.