| Basic Information | |
|---|---|
| Family ID | F103670 |
| Family Type | Metagenome |
| Number of Sequences | 101 |
| Average Sequence Length | 43 residues |
| Representative Sequence | TKLLVTLKNEKASIKQQRIERGMEAKFSKLPSKDLPKGSGL |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 8.91 % |
| % of genes near scaffold ends (potentially truncated) | 87.13 % |
| % of genes from short scaffolds (< 2000 bps) | 93.07 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (63.366 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (9.901 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.673 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.604 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.03% β-sheet: 0.00% Coil/Unstructured: 57.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF13884 | Peptidase_S74 | 8.91 |
| PF00561 | Abhydrolase_1 | 8.91 |
| PF00781 | DAGK_cat | 0.99 |
| PF12697 | Abhydrolase_6 | 0.99 |
| PF07043 | DUF1328 | 0.99 |
| PF13418 | Kelch_4 | 0.99 |
| PF06280 | fn3_5 | 0.99 |
| PF13415 | Kelch_3 | 0.99 |
| PF11949 | DUF3466 | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG1597 | Phosphatidylglycerol kinase, diacylglycerol kinase family | Lipid transport and metabolism [I] | 1.98 |
| COG5487 | Uncharacterized membrane protein YtjA, UPF0391 family | Function unknown [S] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 64.36 % |
| Unclassified | root | N/A | 35.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16738356 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1390 | Open in IMG/M |
| 3300000890|JGI11643J12802_10044163 | Not Available | 533 | Open in IMG/M |
| 3300000955|JGI1027J12803_101098972 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 1651 | Open in IMG/M |
| 3300000956|JGI10216J12902_105786732 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1640 | Open in IMG/M |
| 3300002896|JGI24802J43972_1018794 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300002903|JGI24801J43971_1010326 | Not Available | 514 | Open in IMG/M |
| 3300004153|Ga0063455_100733650 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 671 | Open in IMG/M |
| 3300005294|Ga0065705_11135223 | Not Available | 515 | Open in IMG/M |
| 3300005329|Ga0070683_102014978 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300005365|Ga0070688_100346336 | Not Available | 1087 | Open in IMG/M |
| 3300005437|Ga0070710_11454452 | Not Available | 514 | Open in IMG/M |
| 3300005535|Ga0070684_101986011 | Not Available | 549 | Open in IMG/M |
| 3300005719|Ga0068861_101704730 | Not Available | 623 | Open in IMG/M |
| 3300005764|Ga0066903_100544078 | All Organisms → cellular organisms → Bacteria | 1988 | Open in IMG/M |
| 3300005764|Ga0066903_100702816 | All Organisms → cellular organisms → Bacteria | 1783 | Open in IMG/M |
| 3300005764|Ga0066903_105393698 | Not Available | 675 | Open in IMG/M |
| 3300005764|Ga0066903_106920286 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300005937|Ga0081455_10447686 | Not Available | 883 | Open in IMG/M |
| 3300006032|Ga0066696_10898835 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300006175|Ga0070712_100501408 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300006175|Ga0070712_101651261 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300006175|Ga0070712_101655090 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300006175|Ga0070712_101698753 | Not Available | 553 | Open in IMG/M |
| 3300006800|Ga0066660_10920188 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 711 | Open in IMG/M |
| 3300006904|Ga0075424_102604528 | Not Available | 529 | Open in IMG/M |
| 3300009093|Ga0105240_12531108 | Not Available | 531 | Open in IMG/M |
| 3300009098|Ga0105245_12372224 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300009162|Ga0075423_11014366 | Not Available | 882 | Open in IMG/M |
| 3300009162|Ga0075423_13163030 | Not Available | 504 | Open in IMG/M |
| 3300010048|Ga0126373_11872338 | Not Available | 663 | Open in IMG/M |
| 3300010335|Ga0134063_10125005 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1181 | Open in IMG/M |
| 3300010336|Ga0134071_10242087 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 897 | Open in IMG/M |
| 3300010361|Ga0126378_12049439 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300010366|Ga0126379_12135615 | Not Available | 662 | Open in IMG/M |
| 3300010376|Ga0126381_100315211 | All Organisms → cellular organisms → Bacteria | 2148 | Open in IMG/M |
| 3300010376|Ga0126381_100411137 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1888 | Open in IMG/M |
| 3300010376|Ga0126381_101149300 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300010376|Ga0126381_101576958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 949 | Open in IMG/M |
| 3300012004|Ga0120134_1074746 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 613 | Open in IMG/M |
| 3300012200|Ga0137382_10352105 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1033 | Open in IMG/M |
| 3300012205|Ga0137362_10661318 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 899 | Open in IMG/M |
| 3300012356|Ga0137371_10484554 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 955 | Open in IMG/M |
| 3300012361|Ga0137360_10382532 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
| 3300012361|Ga0137360_11355055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 614 | Open in IMG/M |
| 3300012362|Ga0137361_10157695 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2033 | Open in IMG/M |
| 3300012683|Ga0137398_10068841 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2152 | Open in IMG/M |
| 3300012923|Ga0137359_11792099 | Not Available | 501 | Open in IMG/M |
| 3300012924|Ga0137413_11140949 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300012930|Ga0137407_12388651 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 505 | Open in IMG/M |
| 3300012955|Ga0164298_11391686 | Not Available | 542 | Open in IMG/M |
| 3300012958|Ga0164299_10872057 | Not Available | 650 | Open in IMG/M |
| 3300012971|Ga0126369_13113907 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 543 | Open in IMG/M |
| 3300013297|Ga0157378_10155782 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2133 | Open in IMG/M |
| 3300013307|Ga0157372_11358445 | Not Available | 819 | Open in IMG/M |
| 3300014745|Ga0157377_10040392 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2583 | Open in IMG/M |
| 3300015358|Ga0134089_10163199 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300015372|Ga0132256_102584320 | Not Available | 608 | Open in IMG/M |
| 3300015373|Ga0132257_100564880 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1402 | Open in IMG/M |
| 3300015374|Ga0132255_100608343 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1616 | Open in IMG/M |
| 3300015374|Ga0132255_102830059 | Not Available | 742 | Open in IMG/M |
| 3300015374|Ga0132255_103932584 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 631 | Open in IMG/M |
| 3300016294|Ga0182041_11467809 | Not Available | 627 | Open in IMG/M |
| 3300016357|Ga0182032_11503763 | Not Available | 584 | Open in IMG/M |
| 3300017997|Ga0184610_1118326 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300018051|Ga0184620_10290498 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300018073|Ga0184624_10131627 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium 13_1_20CM_4_54_11 | 1090 | Open in IMG/M |
| 3300018081|Ga0184625_10393128 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300018433|Ga0066667_11066709 | Not Available | 698 | Open in IMG/M |
| 3300018482|Ga0066669_10200408 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1528 | Open in IMG/M |
| 3300018482|Ga0066669_11412784 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 631 | Open in IMG/M |
| 3300019881|Ga0193707_1204065 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300019882|Ga0193713_1057435 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300020002|Ga0193730_1145394 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300021344|Ga0193719_10413812 | Not Available | 553 | Open in IMG/M |
| 3300021411|Ga0193709_1006693 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2917 | Open in IMG/M |
| 3300021510|Ga0222621_1028720 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300021560|Ga0126371_10670137 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1186 | Open in IMG/M |
| 3300022694|Ga0222623_10224340 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300022756|Ga0222622_11422150 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300025915|Ga0207693_10923360 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300025942|Ga0207689_11569460 | Not Available | 548 | Open in IMG/M |
| 3300026116|Ga0207674_10259286 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1686 | Open in IMG/M |
| 3300026116|Ga0207674_10576440 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300026328|Ga0209802_1326369 | Not Available | 507 | Open in IMG/M |
| 3300026332|Ga0209803_1263029 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 593 | Open in IMG/M |
| 3300026540|Ga0209376_1258831 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 737 | Open in IMG/M |
| 3300026550|Ga0209474_10446129 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300027907|Ga0207428_11167150 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300028811|Ga0307292_10332467 | Not Available | 640 | Open in IMG/M |
| 3300031231|Ga0170824_102344469 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 778 | Open in IMG/M |
| 3300031231|Ga0170824_102747272 | All Organisms → cellular organisms → Bacteria | 2352 | Open in IMG/M |
| 3300031474|Ga0170818_110304971 | Not Available | 640 | Open in IMG/M |
| 3300031820|Ga0307473_10773075 | Not Available | 682 | Open in IMG/M |
| 3300031890|Ga0306925_11990795 | Not Available | 549 | Open in IMG/M |
| 3300031942|Ga0310916_10398686 | Not Available | 1171 | Open in IMG/M |
| 3300032076|Ga0306924_11127600 | Not Available | 853 | Open in IMG/M |
| 3300032770|Ga0335085_11401313 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300033289|Ga0310914_10506734 | Not Available | 1092 | Open in IMG/M |
| 3300033412|Ga0310810_11144228 | Not Available | 640 | Open in IMG/M |
| 3300033475|Ga0310811_10851160 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300034115|Ga0364945_0100000 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium 13_1_20CM_4_54_11 | 848 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.90% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.94% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.96% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.97% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.98% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.98% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.99% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.99% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.99% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.99% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.99% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002896 | Soil microbial communities from Manhattan, Kansas, USA - Sample 300um Nextera | Environmental | Open in IMG/M |
| 3300002903 | Soil microbial communities from Manhattan, Kansas, USA - Sample 200um Nextera | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012004 | Permafrost microbial communities from Nunavut, Canada - A30_5cm_6M | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021411 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2 | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_03814110 | 2088090014 | Soil | LVTLKNEKASIKQQRMERGMEAKFSKLPSKDLPKGSGL |
| JGI11643J12802_100441631 | 3300000890 | Soil | MLVTLKNEKASIKQQRIERGMEAKFSKLPSKDLPRGSGL* |
| JGI1027J12803_1010989723 | 3300000955 | Soil | TLKNEKASIKQQRIEHGMEAKFSKLPSKDLPKGSGP* |
| JGI10216J12902_1057867321 | 3300000956 | Soil | LLVTLKNEKASIKQQRIQRGMEAKFGKLPNKDLPKGARP* |
| JGI24802J43972_10187941 | 3300002896 | Soil | LTKLLVTLKNEKASIKQQRIERGMEAKFSKLPSKDLPKGPVL* |
| JGI24801J43971_10103261 | 3300002903 | Soil | GLTKLLITLKNEKASIKQQRKEHGMEAKFGKLPSKDLPKGSAL* |
| Ga0063455_1007336502 | 3300004153 | Soil | NEGMTKLLMSLKNEKASIKQQRIQHGMEAKFRKLPNKDLPKGPGL* |
| Ga0065705_111352231 | 3300005294 | Switchgrass Rhizosphere | NEGLTKLLVTLKNEKASIKQQRIEHGMEAKFSKLPSKDLPKGLGL* |
| Ga0070683_1020149782 | 3300005329 | Corn Rhizosphere | LTKLLITLKNEKASIKQQRKEHGMEAKFGKLPSKDLPKGSAL* |
| Ga0070688_1003463362 | 3300005365 | Switchgrass Rhizosphere | EGMTKLLVTLKNEKASIKQQRIEHGMKAKFSKLPSKDLPKGSAL* |
| Ga0070710_114544521 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | LNEGLTKLLVTLKNEKASIKQQRIERGMEAKFSKLPNKDLPKGSGL* |
| Ga0070684_1019860112 | 3300005535 | Corn Rhizosphere | AANKELNEGMTKLLVMLKNEKASIKQQRNERGMETKFGKLSNKELPKGLGL* |
| Ga0068861_1017047302 | 3300005719 | Switchgrass Rhizosphere | GMTKLLVTLKNEKASIKQQRIEHGMEAKFSKLPSKDLQDRAYD* |
| Ga0066903_1005440782 | 3300005764 | Tropical Forest Soil | MNQRLRMLKEQKASSKQQRIEDGMEAKFGKLPNKDLPKGSGL* |
| Ga0066903_1007028165 | 3300005764 | Tropical Forest Soil | MTKLLKTLKNEKANIKQQRIERGMETKFSKLPSKDLPKGSGL* |
| Ga0066903_1053936981 | 3300005764 | Tropical Forest Soil | TLKNEKASIKQQRTERGMEAKFGKLPSKELPKGSGL* |
| Ga0066903_1069202861 | 3300005764 | Tropical Forest Soil | MTKLLVTLKNEKASIKQQRIEHGMEGKFGKLPSKDLPKGSGL* |
| Ga0081455_104476862 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VELGLTKLLTTLKNEKASIKQQRVEHGMEAKFSQLPSKDLPKGSGL* |
| Ga0066696_108988352 | 3300006032 | Soil | AGNKALNEGMTKLLMTLKNEKASIKQQRIERGMETKFSKLPSKDLPKGSGL* |
| Ga0070712_1005014081 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | TKLLVTLKNEKASIKQQRIEHGMETKFGKLPSKDLPKGLGL* |
| Ga0070712_1016512611 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | TLKNEKASIKQQRIEHGMEAKFGKLPSKELPKGSAL* |
| Ga0070712_1016550902 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | NKGLNEGLTKLLMTLKNEKASIKQQRIERGLEAKFSKLPSKDLPKESAL* |
| Ga0070712_1016987531 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | KALNEGMTKLLVTLKNEKASIKQQRIERGMEAKFSKLPSKDLPKGSGL* |
| Ga0066660_109201881 | 3300006800 | Soil | KNEKASIKQQRVERGMEAKFGKLPSKDLPKGVGL* |
| Ga0075424_1026045281 | 3300006904 | Populus Rhizosphere | TKLLVTLKNEKASIKEQRMERGMEAKFSKLPSKDLPKGPVL* |
| Ga0105240_125311082 | 3300009093 | Corn Rhizosphere | NKALNEGLTKLLITLKNEKASIKQQRKEHGMEAKFGKLPSKDLPKGSAL* |
| Ga0105245_123722241 | 3300009098 | Miscanthus Rhizosphere | KGLNEGLTKLLVTLKNEKASIKQQRIERGMEAKFSKLPSKDLPEGSGL* |
| Ga0075423_110143662 | 3300009162 | Populus Rhizosphere | NKGLNEGLTKLLITLKNEKASIKQQREERGMEAKFSKLPSKDLPKGPVL* |
| Ga0075423_131630302 | 3300009162 | Populus Rhizosphere | MSLKNEKASIKQQRIEHGMEAKFSKLLSKDLPKGSGL* |
| Ga0126373_118723381 | 3300010048 | Tropical Forest Soil | KNEKASIKQQRKEHGMETKFGKLPNKDLPKESAL* |
| Ga0134063_101250051 | 3300010335 | Grasslands Soil | EGLTKLLITLKNEKASIKQQRVERGMEAKFGKLPSKDLPKGVGL* |
| Ga0134071_102420874 | 3300010336 | Grasslands Soil | LNEGLTKLLVTLKNEKASIKQQRIERGMEAKFSKLPSKDLPKGSER* |
| Ga0126378_120494392 | 3300010361 | Tropical Forest Soil | KNEKASIKQQRIEHGMEAKFSKLPSKDLPQASGQ* |
| Ga0126379_121356151 | 3300010366 | Tropical Forest Soil | NKGLNEGMTKLLITLKNEKARIKQQRIERGMETKFSKLSSKDLPNGSGL* |
| Ga0126381_1003152113 | 3300010376 | Tropical Forest Soil | LITLKNEKASIKQQRKEHGMDTKFGKLPSKELPKGSGL* |
| Ga0126381_1004111372 | 3300010376 | Tropical Forest Soil | MNQRLRMLKEQKASSKQQRIEDGMEAKFGKLPKGLAKGSGL* |
| Ga0126381_1011493001 | 3300010376 | Tropical Forest Soil | ALNEGMTKLLITLKNEKASIKQQRKERGMEAKFGKLPSKELPKGSAL* |
| Ga0126381_1015769582 | 3300010376 | Tropical Forest Soil | VTLKNEKASIKQQRIEHGMEAKFGKLPSKELPTGSEL* |
| Ga0120134_10747462 | 3300012004 | Permafrost | MTKLLVTLKNEKASIKQQRIERGMEAKFSKLPSKDLPKGSGL* |
| Ga0137382_103521051 | 3300012200 | Vadose Zone Soil | LNEGLGKLVDTLKEQKASIKQQRIERGMEAKFSQLPNKELPKQ* |
| Ga0137362_106613182 | 3300012205 | Vadose Zone Soil | VETLKEQKASIKQQRIERGMEAKFSKLSSKELPKQTTQ* |
| Ga0137371_104845542 | 3300012356 | Vadose Zone Soil | LITLKNEKASIKQQRVERGMEAKFGKLPSKDLPKASGP* |
| Ga0137360_103825321 | 3300012361 | Vadose Zone Soil | KLLVTLKNEKASIKQQRIERGTEAKFSKLPSKDLPKGSGL* |
| Ga0137360_113550551 | 3300012361 | Vadose Zone Soil | KLLVTLKNEKASIKQQRIERGMEAKFSKLPNKELPKASGL* |
| Ga0137361_101576954 | 3300012362 | Vadose Zone Soil | VETLKEQKASIKQQRIERGMEAKFSKLSSKELPKQSSQ* |
| Ga0137398_100688411 | 3300012683 | Vadose Zone Soil | LLVTLKNETASIKQQRIERGMEARFSKLPSKDLPKGWGL* |
| Ga0137359_117920992 | 3300012923 | Vadose Zone Soil | DGLTKLLMTLKAQKASIKQQRIEHGMEAKFSKLPSKELPKGSAP* |
| Ga0137413_111409491 | 3300012924 | Vadose Zone Soil | NEGLTKLLVTLKNEKASIKQQRTERGMEAKFSKLPSKDLPKGSGL* |
| Ga0137407_123886511 | 3300012930 | Vadose Zone Soil | LVTLKNEKASIKQQRIEREMEAKFGKLSGKELPKGSGP* |
| Ga0164298_113916861 | 3300012955 | Soil | NKGLNEGLTKLLVTLKNEKAIIKQQRIEHGMEAKFSKLTSKDLPKGSGL* |
| Ga0164299_108720572 | 3300012958 | Soil | TLKNEKASIKQQRIEHGMEAKFSKLPSKDLPKASGL* |
| Ga0126369_131139072 | 3300012971 | Tropical Forest Soil | MTKLLKTLKNEKANIKQQRIERGMETKFSKLPSEDLPKGSGL* |
| Ga0157378_101557821 | 3300013297 | Miscanthus Rhizosphere | LVTLKNEKASIKQQRIEHGMETKFLKLPSKDLPKGSGL* |
| Ga0157372_113584451 | 3300013307 | Corn Rhizosphere | KNQKTSLKQQRIEHGMEAKFGKLPSKDLPRGSGL* |
| Ga0157377_100403921 | 3300014745 | Miscanthus Rhizosphere | GNKGLNEGLTKLLVTLKNEKASIKQQRIEHGMEAKFSKLPSKDLPKGSAL* |
| Ga0134089_101631991 | 3300015358 | Grasslands Soil | MTLKDQKASINQQRIERGMEAKFSKLPSKELPKGSGP* |
| Ga0132256_1025843201 | 3300015372 | Arabidopsis Rhizosphere | AGNMALNEGMTKLLVTLKNQKTSLKQQRIEHGMEAKFGKLPSKDLPRGSGL* |
| Ga0132257_1005648801 | 3300015373 | Arabidopsis Rhizosphere | MTKLLVTLKNEKASIKQQRTERGMETKFSKLPSKDLPKGSGP* |
| Ga0132255_1006083433 | 3300015374 | Arabidopsis Rhizosphere | NDGLTKLLVTLKNEKASIKQQRIEHGMETKFGKLPSKELPKGSAL* |
| Ga0132255_1028300593 | 3300015374 | Arabidopsis Rhizosphere | GLTKLLVTLKNEKASIKQQRIDRGMEAKFSKLPSKDLPKGSGL* |
| Ga0132255_1039325842 | 3300015374 | Arabidopsis Rhizosphere | VTLKNEKASIKQQRIEHGMEAKFSKLPSKELPKGSKL* |
| Ga0182041_114678091 | 3300016294 | Soil | LLITLKNEKASIKQQREERGMEAKFSKLPSKDLPKGPVL |
| Ga0182032_115037631 | 3300016357 | Soil | NKGLNDGLTKLLTTLKNEKASVKQQRIDRGMETKFGKLPSKDLPKGSGS |
| Ga0184610_11183262 | 3300017997 | Groundwater Sediment | TKLLVTLKNEKASIKQQRIERGMEAKFSKLPSKDLPK |
| Ga0184620_102904982 | 3300018051 | Groundwater Sediment | TKLLVTLKNEKASIKQQRIERGMEAKFSKLPSKDLPKGSGL |
| Ga0184624_101316271 | 3300018073 | Groundwater Sediment | GNKGLNEGLTKLLMTLKKEKASIKQQRIERGMEAKFSKLPSKDLPKGLGL |
| Ga0184625_103931281 | 3300018081 | Groundwater Sediment | NKGLNEGMTKLLMTLKNEKASIKQQRIERGMEAKFSKLPSKDLPKGSGL |
| Ga0066667_110667091 | 3300018433 | Grasslands Soil | VTLKNEKASIKQQRIERGMETKFSKLPSKDLPKGSGL |
| Ga0066669_102004081 | 3300018482 | Grasslands Soil | EGLTKLLITLKNEKASIKQQRVERGMEAKFGKLPSKDLPKGVGL |
| Ga0066669_114127841 | 3300018482 | Grasslands Soil | EGLTKLLITLKNEKASIKQQRVERGMEAKFGKLPSKDLPKASGP |
| Ga0193707_12040651 | 3300019881 | Soil | MTKLLVTLKNEKASIKQQRIERGMEAKFSKLPSKDLPK |
| Ga0193713_10574352 | 3300019882 | Soil | LNDGLTKLLMTLKAQKASIKQQRIEHGMEAKFSKLPSKELPKGSGP |
| Ga0193730_11453941 | 3300020002 | Soil | AGNKALNEGMTKLLVTLKNEKASIKQQRIERGMEAKFSKLPSKDLPK |
| Ga0193719_104138122 | 3300021344 | Soil | TKLLMTLKAQKASIKQQRIEHGMEAKFSKLPSKELPKGSGT |
| Ga0193709_10066935 | 3300021411 | Soil | AGNKAPNEGMTKLLVTLKNEKASIKQQRIERGMEAKFSKLPSKDLPKGSGF |
| Ga0222621_10287202 | 3300021510 | Groundwater Sediment | GLNEGLTKLLMTLKNEKASIKQQRIERGMEAKFSKLPSKDLPK |
| Ga0126371_106701372 | 3300021560 | Tropical Forest Soil | MNQRLRMLKEQKASSKQQRIEDGMEAKFGKLPNKDLPKGSGL |
| Ga0222623_102243401 | 3300022694 | Groundwater Sediment | NKGLNEGMTKLLMTLKNEKASIKQQRIERGMEAKFSKLPSKDLPK |
| Ga0222622_114221501 | 3300022756 | Groundwater Sediment | KLLVTLKNEKASIKQQRIEHGMEAKFGKLPSKDLPK |
| Ga0207693_109233601 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LNEGLTKLLMTLKNEKASIKQQRIEHGMEAKFGKLPSKELPKGSAL |
| Ga0207689_115694601 | 3300025942 | Miscanthus Rhizosphere | NEGLTKMLVTLKNEKASIKQQRIERGMEAKFSKLPNTELPKGSGLSPRD |
| Ga0207674_102592861 | 3300026116 | Corn Rhizosphere | LKNEKASIKQQRKEHGMEAKFGKLPSKDLPKGSAL |
| Ga0207674_105764401 | 3300026116 | Corn Rhizosphere | NEKASIKQQRIERGMEAKFSKLPNTELPKGSGLSPRD |
| Ga0209802_13263692 | 3300026328 | Soil | LTKLLMTLKDQKASINQQRIERGMEAKFSKLPSKELPKGSGPAMCWDY |
| Ga0209803_12630292 | 3300026332 | Soil | LNEGLGKLVETLKEQKASIKQQRIERGMEAKFSKLPSKELPK |
| Ga0209376_12588313 | 3300026540 | Soil | NEGLTKLLITLKNEKASIKQQRVERGMEAKFGKLPSKDLPKGVGL |
| Ga0209474_104461292 | 3300026550 | Soil | LLVTLKNEKASIKQQRIERGMEAKFSKLPSKDLPKGLGL |
| Ga0207428_111671502 | 3300027907 | Populus Rhizosphere | GLTKLLVTLKNEMASIKHQRIERGMDAKFSKLPSKDLPKGL |
| Ga0307292_103324671 | 3300028811 | Soil | NEGLTKLLVTLKNEKASIKQQRIERGMEAKFSKLPSKDLPKGSGL |
| Ga0170824_1023444691 | 3300031231 | Forest Soil | GNKGLNEGLTKLLITLKNEKASIKQQREERGMEAKFGKLPNKDLPKGSGL |
| Ga0170824_1027472721 | 3300031231 | Forest Soil | TLKNEKASIKQQRIEHGMEAKFSKLLSKDLPKGSGL |
| Ga0170818_1103049712 | 3300031474 | Forest Soil | AGNKGLNEGLTKLLVTLKNEKASIKQQRIERGMEAKFSKLPSKDLPKGSGL |
| Ga0307473_107730752 | 3300031820 | Hardwood Forest Soil | LVTLQNEKSSIKQQRIERGMEAKFSKLPSKDLPKGSGL |
| Ga0306925_119907952 | 3300031890 | Soil | LNEGMTKLLITLKNEKASIKQQRIERGMEGKFGKLPSKDLPKGLSL |
| Ga0310916_103986862 | 3300031942 | Soil | GLNDGLTKLLTILKNEKASIKQQRIERGMEAKFSKLPNKELPKGSGP |
| Ga0306924_111276002 | 3300032076 | Soil | KGLNEGLTKLLITLKNEKASIKQQREERGMEAKFSKLPSKDLPKGPVL |
| Ga0335085_114013131 | 3300032770 | Soil | LTKLLVTLKNEKASIKQQRIEHGMEAKFLNLPSKDLPKVSGP |
| Ga0310914_105067341 | 3300033289 | Soil | LTKLLTTLKNEKASIKQQRIERGMEAKFSKLPNKELPKGSGP |
| Ga0310810_111442282 | 3300033412 | Soil | EGMTKLLVMLKNEKASIKQQRNERGMETKFGKLSNKELPKGLGL |
| Ga0310811_108511602 | 3300033475 | Soil | VTLKNEKASIKQQRIEHGMEAKFSKLPSKDLPKASGL |
| Ga0364945_0100000_21_149 | 3300034115 | Sediment | MTKLLMTLKNEKASIKQQRIERGMEAKFSKLPSKDLPKGSGL |
| ⦗Top⦘ |