NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F103653

Metagenome / Metatranscriptome Family F103653

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F103653
Family Type Metagenome / Metatranscriptome
Number of Sequences 101
Average Sequence Length 52 residues
Representative Sequence SLHHFKARFDPEGLVEAAVGKAIHDEAAYRELSGGEAGYEGFFPAYRRPSG
Number of Associated Samples 94
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.99 %
% of genes near scaffold ends (potentially truncated) 98.02 %
% of genes from short scaffolds (< 2000 bps) 90.10 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.079 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(22.772 % of family members)
Environment Ontology (ENVO) Unclassified
(32.673 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.554 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 22.78%    β-sheet: 0.00%    Coil/Unstructured: 77.22%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF00535Glycos_transf_2 63.37
PF01741MscL 3.96
PF13360PQQ_2 2.97
PF00561Abhydrolase_1 1.98
PF02397Bac_transf 0.99
PF13570PQQ_3 0.99
PF00486Trans_reg_C 0.99
PF00534Glycos_transf_1 0.99
PF01545Cation_efflux 0.99
PF06092DUF943 0.99
PF13517FG-GAP_3 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG1970Large-conductance mechanosensitive channelCell wall/membrane/envelope biogenesis [M] 3.96
COG0053Divalent metal cation (Fe/Co/Zn/Cd) efflux pumpInorganic ion transport and metabolism [P] 0.99
COG1230Co/Zn/Cd efflux system componentInorganic ion transport and metabolism [P] 0.99
COG2148Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid)Cell wall/membrane/envelope biogenesis [M] 0.99
COG3965Predicted Co/Zn/Cd cation transporter, cation efflux familyInorganic ion transport and metabolism [P] 0.99


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.08 %
UnclassifiedrootN/A7.92 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000156|NODE_c0677934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2951Open in IMG/M
3300000956|JGI10216J12902_119924841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium645Open in IMG/M
3300001205|C688J13580_1066746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium506Open in IMG/M
3300004157|Ga0062590_101612770All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300005093|Ga0062594_103319793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium505Open in IMG/M
3300005184|Ga0066671_11016389All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria521Open in IMG/M
3300005332|Ga0066388_107752588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium538Open in IMG/M
3300005338|Ga0068868_101171653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium709Open in IMG/M
3300005339|Ga0070660_100408294All Organisms → cellular organisms → Bacteria1124Open in IMG/M
3300005347|Ga0070668_101395067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium639Open in IMG/M
3300005356|Ga0070674_101133783All Organisms → cellular organisms → Bacteria → Terrabacteria group692Open in IMG/M
3300005438|Ga0070701_10103799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1578Open in IMG/M
3300005441|Ga0070700_101433275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium585Open in IMG/M
3300005459|Ga0068867_101804229All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300005549|Ga0070704_100229188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1514Open in IMG/M
3300005587|Ga0066654_10573658All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300005614|Ga0068856_100190711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2063Open in IMG/M
3300005615|Ga0070702_100361736All Organisms → cellular organisms → Bacteria1026Open in IMG/M
3300005764|Ga0066903_103195025All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300006031|Ga0066651_10034202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2295Open in IMG/M
3300006031|Ga0066651_10116274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1367Open in IMG/M
3300006175|Ga0070712_100777641All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300006175|Ga0070712_101265484All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300006576|Ga0074047_11964304All Organisms → cellular organisms → Bacteria1577Open in IMG/M
3300006755|Ga0079222_12589490All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300006854|Ga0075425_100510153All Organisms → cellular organisms → Bacteria1384Open in IMG/M
3300007076|Ga0075435_101053495Not Available711Open in IMG/M
3300009098|Ga0105245_10073481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3109Open in IMG/M
3300009148|Ga0105243_10655822Not Available1018Open in IMG/M
3300009174|Ga0105241_10775125Not Available881Open in IMG/M
3300009840|Ga0126313_10346908All Organisms → cellular organisms → Bacteria1169Open in IMG/M
3300010045|Ga0126311_10028859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3394Open in IMG/M
3300010335|Ga0134063_10321088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium748Open in IMG/M
3300010399|Ga0134127_13176913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium537Open in IMG/M
3300011994|Ga0120157_1056156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium835Open in IMG/M
3300012212|Ga0150985_105950025Not Available1141Open in IMG/M
3300012350|Ga0137372_10099112All Organisms → cellular organisms → Bacteria2448Open in IMG/M
3300012351|Ga0137386_11290290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium507Open in IMG/M
3300012353|Ga0137367_10312563Not Available1122Open in IMG/M
3300012491|Ga0157329_1010980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium718Open in IMG/M
3300012497|Ga0157319_1002353All Organisms → cellular organisms → Bacteria1079Open in IMG/M
3300012508|Ga0157315_1011823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia794Open in IMG/M
3300012512|Ga0157327_1023735All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium714Open in IMG/M
3300012519|Ga0157352_1094244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium521Open in IMG/M
3300012912|Ga0157306_10005366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2342Open in IMG/M
3300012951|Ga0164300_10971373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium544Open in IMG/M
3300012958|Ga0164299_11316022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium553Open in IMG/M
3300012960|Ga0164301_11250169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium599Open in IMG/M
3300012986|Ga0164304_11562322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium548Open in IMG/M
3300012988|Ga0164306_10291078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1188Open in IMG/M
3300012988|Ga0164306_11151869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria648Open in IMG/M
3300012989|Ga0164305_11504107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium597Open in IMG/M
3300013297|Ga0157378_10353593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1436Open in IMG/M
3300013307|Ga0157372_10245789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2076Open in IMG/M
3300014058|Ga0120149_1084740All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium835Open in IMG/M
3300014157|Ga0134078_10682716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium501Open in IMG/M
3300014745|Ga0157377_10832139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium684Open in IMG/M
3300015371|Ga0132258_12386243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1325Open in IMG/M
3300017944|Ga0187786_10178487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium790Open in IMG/M
3300018032|Ga0187788_10235146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium722Open in IMG/M
3300018066|Ga0184617_1063119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium970Open in IMG/M
3300019873|Ga0193700_1069445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium524Open in IMG/M
3300022756|Ga0222622_10092033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1843Open in IMG/M
3300023057|Ga0247797_1040900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium649Open in IMG/M
3300024245|Ga0247677_1051398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium602Open in IMG/M
3300025915|Ga0207693_10724108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium770Open in IMG/M
3300025919|Ga0207657_10561878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium892Open in IMG/M
3300025921|Ga0207652_11901909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium501Open in IMG/M
3300025929|Ga0207664_10925873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium782Open in IMG/M
3300025934|Ga0207686_10556626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium897Open in IMG/M
3300025935|Ga0207709_10543674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium912Open in IMG/M
3300025935|Ga0207709_10875385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium729Open in IMG/M
3300025938|Ga0207704_11517620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium575Open in IMG/M
3300025972|Ga0207668_11136012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium701Open in IMG/M
3300026023|Ga0207677_10831986Not Available828Open in IMG/M
3300026075|Ga0207708_10034165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter3866Open in IMG/M
3300026121|Ga0207683_10106444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter2508Open in IMG/M
3300026121|Ga0207683_10430597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1215Open in IMG/M
3300028379|Ga0268266_10644956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1019Open in IMG/M
3300028592|Ga0247822_11355994All Organisms → cellular organisms → Bacteria → Terrabacteria group597Open in IMG/M
3300028711|Ga0307293_10227163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium594Open in IMG/M
3300028715|Ga0307313_10084908All Organisms → cellular organisms → Bacteria955Open in IMG/M
3300028744|Ga0307318_10260372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium605Open in IMG/M
3300028784|Ga0307282_10671565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium502Open in IMG/M
3300028787|Ga0307323_10279757All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium600Open in IMG/M
3300028787|Ga0307323_10300352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium577Open in IMG/M
3300028793|Ga0307299_10087601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1160Open in IMG/M
3300028807|Ga0307305_10098437All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1352Open in IMG/M
3300028807|Ga0307305_10366472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium653Open in IMG/M
3300028819|Ga0307296_10208043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1062Open in IMG/M
3300028828|Ga0307312_11177482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria507Open in IMG/M
3300028875|Ga0307289_10238675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium748Open in IMG/M
3300028884|Ga0307308_10347285All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium710Open in IMG/M
3300030336|Ga0247826_10290466All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1167Open in IMG/M
3300031562|Ga0310886_10364325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium844Open in IMG/M
3300031771|Ga0318546_11273070Not Available516Open in IMG/M
3300031995|Ga0307409_101291323Not Available755Open in IMG/M
3300032008|Ga0318562_10249719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1030Open in IMG/M
3300033004|Ga0335084_11798088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium600Open in IMG/M
3300033158|Ga0335077_11829739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium569Open in IMG/M
3300033412|Ga0310810_11278479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium582Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil22.77%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere4.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere3.96%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.97%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.98%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.98%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.98%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.98%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.98%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.98%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.99%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.99%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.99%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.99%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.99%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.99%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.99%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.99%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.99%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.99%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.99%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.99%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.99%
Sugar Cane Bagasse Incubating BioreactorEngineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000156Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobicEngineeredOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001205Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011994Permafrost microbial communities from Nunavut, Canada - A7_65cm_12MEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012491Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610Host-AssociatedOpen in IMG/M
3300012497Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510Host-AssociatedOpen in IMG/M
3300012508Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510Host-AssociatedOpen in IMG/M
3300012512Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510Host-AssociatedOpen in IMG/M
3300012519Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014058Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25MEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300019873Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300023057Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6EnvironmentalOpen in IMG/M
3300024245Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
NODE_067793453300000156Sugar Cane Bagasse Incubating BioreactorRADSLHHFKARFDPEGLLEAAVGKAIHDGEAYSRLGGGEASLDGFFPAYRRARQE*
JGI10216J12902_11992484123300000956SoilGGKADSLHHFKARFDPEGLVEAAVGKAIHDEDAYRRLSGGETGFDGFFPTYRSRTPT*
C688J13580_106674613300001205SoilHFKARFDPEGLVPAAIGKAIHDEAAYRELSGGETGFDGFFPAYRRSNG*
Ga0062590_10161277013300004157SoilALHHFKARFDPEGLVPAAVGKAIHDEDAYRELSGGEAGFDGFFPAYRRSSG*
Ga0062594_10331979313300005093SoilPEGLVPAAIGKAIHDEAAYRELSGGEARYDGFFPAYRQPVE*
Ga0066671_1101638923300005184SoilKADALHHFKARFDPEGLVPAAIGKAIHDEAVYRELSGGRVGGFDGFFPAYRRPSG*
Ga0066388_10775258823300005332Tropical Forest SoilRFDPEGLVDAAVGKAVHDEDAYRELSGGEAGYDGFFPAYRATVPA*
Ga0068868_10117165333300005338Miscanthus RhizosphereSLHHFKARFDPEGLVEAAVGKAIHDEDTYRRLSGGETGFDGFFPSYRRRTP*
Ga0070660_10040829413300005339Corn RhizosphereDSLHHFKARFDPEGLVEAALGKAIHDEDAYRELSGGDAGYDGFFPAYRRPSG*
Ga0070668_10139506723300005347Switchgrass RhizosphereEGLVEAAVGKAIHDEESYRELTGGETGYEGFFPSYRSRTPN*
Ga0070674_10113378313300005356Miscanthus RhizosphereDSLHEFKLRFDPGGEVEAAIGKAIHDEAAYRRLAGPGAGLDGFFPAYRRA*
Ga0070701_1010379933300005438Corn, Switchgrass And Miscanthus RhizosphereARFDPEGLVEAAVGKAIHDEESYRELTGGETGYEGFFPSYRSRTPN*
Ga0070700_10143327513300005441Corn, Switchgrass And Miscanthus RhizosphereHFKARFDPEGLVEAAVGKAIHDENTYRRLSGGETGFDGFFPAYRSRTP*
Ga0068867_10180422913300005459Miscanthus RhizosphereLHHFKARFDPEGLVPAAVGKAIHDEDAYRELSGGEVGYEGFFPAYRQRVE*
Ga0070704_10022918833300005549Corn, Switchgrass And Miscanthus RhizosphereARFDPEGLVEAAVGKAIHDEAAYRELSGGEAGYEGFFPAYRRPSG*
Ga0066654_1057365823300005587SoilALHHFKARFDPEGLVPAAIGKAIHDEAAYRELSGGRVDGLDGFFPAYRRPTG*
Ga0068856_10019071113300005614Corn RhizosphereHFKARFDPDGLVPAAIGKAIHDEERYRELGGDGFDGFFPAYRHRASSVNACS*
Ga0070702_10036173633300005615Corn, Switchgrass And Miscanthus RhizosphereGLGGKADSLHHFKARFDPEGLVEAAVGKAIHDEDTYRRLSGGETGFDGFFPAYRSRTP*
Ga0066903_10319502523300005764Tropical Forest SoilDSLHRFKARFDPEGLVPAAVGKAIHDEAAYRELSGGDAVYDGFFPAYRRRAS*
Ga0066651_1003420233300006031SoilLGGGVGGADDSLLEFKLRFDPGGLIESAVGKAIHDDDAYRKLGGEGFDGFFPAYRRAA*
Ga0066651_1011627413300006031SoilLRFDEGGLIESAVGKAIHDEVRYRELGGEGYDGFFPAYRATVTA*
Ga0070712_10077764123300006175Corn, Switchgrass And Miscanthus RhizosphereEDSLHHFKARFDPEGLVPAAVGKAIHDEDAYRRLSGGSEAVFEGFFPAYRRPSR*
Ga0070712_10126548423300006175Corn, Switchgrass And Miscanthus RhizosphereEDSLHHFKARFDPEGLVPAAVGKAIHDEDAYRRLSGGEASYDGFFPAYRAASVARR*
Ga0074047_1196430433300006576SoilDDSLLEFKLRFDPGGLIESAVGKAIHDEQAYRELAGAGAGLDGFFPAYRRNQATVSA*
Ga0079222_1258949023300006755Agricultural SoilGGVGGARDSLYEFKLRFDPCGEVEAAIGKAIHDEKAYHRLAGPQAGLEGFFPAYRQAARAAT*
Ga0075425_10051015313300006854Populus RhizosphereGRGGKQDSLHHFKARFDPEGLVDAAVGKAIHDEDAYRELSGGEAGYDGFFPAYRAETIGTVAP*
Ga0075435_10105349513300007076Populus RhizosphereRRFDPGGLVDAAIGKAIHDENAYRRLAGGVASLDRYFPAYRRP*
Ga0105245_1007348143300009098Miscanthus RhizosphereGGLGGKQDSLHHFKARFDPEGLVDAAVGKAIHDEDAYRELSGGEAGYDGFFPAYRAEAIGTVAP*
Ga0105243_1065582213300009148Miscanthus RhizosphereLGGKADSLHHFKARFDPEGLVKAAVGKAIHDEDAYRELSGGEAGYDGFFPAYRRASG*
Ga0105241_1077512523300009174Corn RhizosphereFDPEGLVPAAVGKAIHDADAYRELSGGETGYEGFFPAYRQRVE*
Ga0126313_1034690833300009840Serpentine SoilDPGGGLEAAVGKAIHDEDGYRRLAGPGAGLEGFFPAYRAA*
Ga0126311_1002885913300010045Serpentine SoilRRFDPGGLVDAAVGKAVHDEDAYARLTGGDASLEGFFPAYRATVAP*
Ga0134063_1032108823300010335Grasslands SoilADDSLLQFKLRFDEGGLIASAVGKAIHDEARCRELGGEGYDGFFPAYRATVTA*
Ga0134127_1317691313300010399Terrestrial SoilDDSLLEFKLRFDEGGLIESAVGKAVHDEDAYRALGGQGFDGFFPAYRRAA*
Ga0120157_105615623300011994PermafrostLRFNPGGELEMAVGKAIHDEEAYARLVGPEAGLDGFFPAYRATVRA*
Ga0150985_10595002523300012212Avena Fatua RhizosphereLGGGVGGREDSLHELKRRFDPGGLVEAAVGKAVHDERAYRRLSGAEGLVGFFPAYRRPDTVAT*
Ga0137372_1009911243300012350Vadose Zone SoilGVGGRRDSLYEFKLRFDPGGELEAAIGKAIHDEQAYRALAGPQAGLDGFFPAYRAPVAKAT*
Ga0137386_1129029023300012351Vadose Zone SoilQRFDPGGVLEAAVGKAVHDEAAYRALAGGDAGLEGYFPAYRAPASTVRA*
Ga0137367_1031256313300012353Vadose Zone SoilRRDSLYEFKLRFDPGGELEAAIGKAIHDEQAYRALAGPQAGLDGFFPAYRAPAAKAT*
Ga0157329_101098013300012491Arabidopsis RhizosphereHFKARFDPEGLVEAAVGKAIHDEAAYRDLSGGEAGYDGFFPAYRAASR*
Ga0157319_100235313300012497Arabidopsis RhizosphereLYEFKLRFDPCGEVEAAIGKAIHDEEAYHRLAGPQAGLDGFFPAYRQGARAAT*
Ga0157315_101182323300012508Arabidopsis RhizosphereDSLHHFKARFDPEGLVPAAVGKAIHDEAAYRDLSGGEAGYHGFFPAYRAASR*
Ga0157327_102373523300012512Arabidopsis RhizosphereADSLHHFKARFDPEGLVPAAVGKAIHDEDAYRELSGGEAGYEGFFPAYRRPSR*
Ga0157352_109424423300012519Unplanted SoilGGGLGGKEDSLHHFKARFDPEGLVEAAVGKAIHDEAAYRDLSGGEAGYDGFFPAYRAASR
Ga0157306_1000536613300012912SoilHHFKARFDPEGLVDAAVGKAIHDEDAYRELSGGEAGYDGFFPAYRAEAIGTVAP*
Ga0164300_1097137313300012951SoilEFKLRFDPGGVLEMAVGKVIHDEDGYRALGGAGTEGFFPAYRRAASTVRA*
Ga0164299_1131602213300012958SoilDSLHHFKARFDPEGLVEAAVGKAIHDEAAYRELSGGEAGYEGFFPAYRRSSG*
Ga0164301_1125016923300012960SoilLVPAAVGKALHDEDAYRELSGGRFAGYAGFFPAYRHRVE*
Ga0164304_1156232213300012986SoilLGGKEDSLHHFKARFDPEGLVPAAVGKAIHDEDAYRRLSGGSEVVFEGFFPAYRRPSR*
Ga0164306_1029107823300012988SoilLGGGLGGKADSLHHFKARFDPDGLVPAAVGKAIHDEDAYRRLSGGSEVAFEGFFPAYRRPSR*
Ga0164306_1115186923300012988SoilGGGVGGADDSLLQFKLRFDEGGLIESAVGKAIHDDNAYRRLGGKGFEGFFPAYRRATDA*
Ga0164305_1150410723300012989SoilGLGGKADSLHHFKARFDPEGLVEAAVGKAIHDEDAYRELSGGEAGYEGFFPAYRRSSG*
Ga0157378_1035359313300013297Miscanthus RhizosphereHFKARFDPEGQVGAAVGKAIHDENTYRRLSGGETGFDGFFPAYRSHSRTP*
Ga0157372_1024578943300013307Corn RhizosphereHHFKARFDPEGLVEAAVGKAIHDEDTYRRLSGGETGFDGFFPAYRSRTP*
Ga0120149_108474013300014058PermafrostEFKLRFDPGGELEMAVGKAIHDEEAYARLAGPEAGLDGFFPAYRATVRA*
Ga0134078_1068271623300014157Grasslands SoilLLQFKFRFDEGGLLESTVGKGIQDEQAHRALGGEGFDGYFPAYRRSP*
Ga0157377_1083213913300014745Miscanthus RhizosphereFDPEGLVPAAVGKAIHDEDAYRELSGGEVGYEGFFPAYRQRVE*
Ga0132258_1238624313300015371Arabidopsis RhizosphereARDSLYEFKLRFDPGGEVEAAIGKAIHDEEAYRRLAGPQAGLAGFFPAYRQAARTAT*
Ga0187786_1017848733300017944Tropical PeatlandADDSLLEFKLRFDEGGLIESAVGKAIHDEACYRDLGGEGFEGFFPAYRAAS
Ga0187788_1023514613300018032Tropical PeatlandDDSLLEFKLRFDEGGLIESAVGKAIHDEACYRDLGGEGSEGFFPAYRAAS
Ga0184617_106311933300018066Groundwater SedimentKRDSLLEFKLRFDPGGELEMAVGKAIHDEKAYVELAGPKPGLEGFFPAYRAAGSRDDR
Ga0193700_106944513300019873SoilLRFDPGGELEMAVGKAIHDEDAYRELAGRPAGLDGFFPAYRAGSRTTAEGRPGSGS
Ga0222622_1009203313300022756Groundwater SedimentFKLRFDPGGELEMAVGKAIHDEEAYRGLAGADAGVDGFFPAYRATVRA
Ga0247797_104090013300023057SoilGKQDSLHHFKARFDPEGLVDAAVGKAIHDEDAYRELSGGEAGYDGFFPAYRAEAIGTVAP
Ga0247677_105139813300024245SoilLGGKEDSLHHFKARFDPEGLVPAAVGKAIHDEDAYRRLSGAEASFAGFFPAYRRVRHN
Ga0207693_1072410813300025915Corn, Switchgrass And Miscanthus RhizosphereKARFDPEGLVPAAVGKAIHDEDAYRRLSGGEASYDGFFPAYRAASVARR
Ga0207657_1056187823300025919Corn RhizosphereKARFDPEGLVPAAVGKAIHDEDAYRELSGGEVGYEGFFPAYRQRVE
Ga0207652_1190190923300025921Corn RhizosphereRFDPEGLVPAAVGKAIHDEDAYRELSGGEAGYEGFFPAYRQRVE
Ga0207664_1092587313300025929Agricultural SoilGLVPAAVGKAIHDEDAYRRLSGGSEVAFEGFFPAYRRPSR
Ga0207686_1055662613300025934Miscanthus RhizosphereHHFKARFDPEGLVEAAVGKAIHDEDTYRRLSGGETGFDGFFPAYRSRTP
Ga0207709_1054367423300025935Miscanthus RhizosphereLGGGLGGKADSLHHFKSRFDPEGLVEAAVGKAIHDEDAYRELSGEADYEGFFPAYRRPSG
Ga0207709_1087538533300025935Miscanthus RhizosphereGGKADSLHHFKARFDPEGLVEAAVGKAIHDEESYRELTGGETGYEGFFPSYRSRTPN
Ga0207704_1151762023300025938Miscanthus RhizosphereSLHHFKTRFDPEGLVEAAVGKAIHDEDTYRRLSGGETGFDGFFPSYRSRTP
Ga0207668_1113601233300025972Switchgrass RhizosphereGGLGVKADSLHHFKARFDPEGLVEAAVGKAIHDEDTYRRLSGGETGFDGFFPAYRSRTP
Ga0207677_1083198623300026023Miscanthus RhizosphereSLHHFKARFDPEGLVEAAVGKAIHDEAAYRELSGGEAGYEGFFPAYRRPSG
Ga0207708_1003416553300026075Corn, Switchgrass And Miscanthus RhizosphereGGGLGGKADSLHHFKARFDPEGLVEAAVGKAIHDENTYRRLSGGETGFDGFFPAYRSRTP
Ga0207683_1010644413300026121Miscanthus RhizosphereSLHHFKARFDPEGLVPAAVGKAIHDEDAYRELSGGEVGYEGFFPAYRQRVE
Ga0207683_1043059733300026121Miscanthus RhizosphereHFKARFDPEGLVEAAVGKAIHDEDTYRRLSGGETGFDGFFPAYRSRTP
Ga0268266_1064495623300028379Switchgrass RhizosphereLHHFKARFDPEGLVPAAVGKAIHDEDAYRELSGRAVGYEGFFPAYRQRVE
Ga0247822_1135599413300028592SoilLRFDPGGEVEAGIGKAIHDETAYRRLAGPGAGLDGFFPAYRRA
Ga0307293_1022716323300028711SoilPEGLVPAAVGKAIHDEDAYRELSGGDTAYEGFFPAYRRSNG
Ga0307313_1008490813300028715SoilKLRIDPGGEVEAAIGKAIHDREAYRRLAGPEAGVDGFFPAYRRP
Ga0307318_1026037213300028744SoilGGGLGGKEDSLHHFKARFDPEGLVDAAVGKAIHDEDAYRRLSGGKAGYDGFFPAYRDPSR
Ga0307282_1067156513300028784SoilGGSDDSLLQFKLRFDEGGLIESAVGKAIHDNERYRELGGAGFDGYFPSYRRAA
Ga0307323_1027975713300028787SoilGRRDSLFDFKLHFDPGGELEMAVGKAIHDEEAYRGLAGADAGVDGFFPAYRATVRA
Ga0307323_1030035223300028787SoilGGVGGADDSLLQFKLRFDEGGLIESAVGKAIHEEARYRELGGAGYEGFFPVYRAPR
Ga0307299_1008760133300028793SoilFDPGGELEMAVGKAIHDDSAYRALAGAQAGLEGFFPAYRAAGSRDDR
Ga0307305_1009843723300028807SoilGADDSLLQFKLRFDEGGLIESAVGKAIHDNERYRELGGSGFDGYFPSYRRAA
Ga0307305_1036647223300028807SoilPEGLVPAAVGKAIHDEDAYRELSGGEAGYDGFFPAYRRSNG
Ga0307296_1020804333300028819SoilDSLLQFKLRFDEGGLIESAVGKAIHDNERYRELGGEDFEGFFPAYRSRG
Ga0307312_1117748213300028828SoilGGGLGGKEDSLHHFKARFDPEGLVDAAVGKAIHDEDAYRSLSGGEAGLEGYFPAYRAPSG
Ga0307289_1023867533300028875SoilKLRFDPGGELEMAVGKAIHDDSAYRALAGAQAGLEGFFPAYRAAGSRDDR
Ga0307308_1034728523300028884SoilDSLFEFKLRFDPGGELEMAVGKAIHDDGAYRALAGPQAGLEGFFPAYRAAGSRDDR
Ga0247826_1029046613300030336SoilARFDPEGLVEAAVGKAIHDEDAYRELSGGEAGYDGFFPAYRRPSG
Ga0310886_1036432523300031562SoilHFKARFDPEGLVDAAVGKAIHDEDAYRRLSGGSEVAFEGFFPAYRRPSR
Ga0318546_1127307013300031771SoilRRFDPGGLVEAAVGKAVHDEVAYGKLTGGAAGLGGFFPAYRR
Ga0307409_10129132313300031995RhizosphereFDPEGLLDAAVGKAIHDDAAYRELSGGEAGYDGFFPAYRAASL
Ga0318562_1024971933300032008SoilVGGASDSLHEYKRRFDPGGLVEAAVGKAVHDEVAYGKLTGGAAGLGGFFPAYRR
Ga0335084_1179808813300033004SoilGGGVGGADDSLLQFKLRFDEGGLIESAVGKTVHDETRYRDLGGAGFEGFFPAYRRPGRE
Ga0335077_1182973913300033158SoilVGGPHDSLLEFKLRFDPGGLIESAVGKAIHDEAAYRELAGPDAGLDGFFPAYRARQA
Ga0310810_1127847923300033412SoilDSLHHFKARFDPEGLVPAAVGKAIHDEDAYRELSGGATGYDGFFPAYRRPTG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.