| Basic Information | |
|---|---|
| Family ID | F103653 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 52 residues |
| Representative Sequence | SLHHFKARFDPEGLVEAAVGKAIHDEAAYRELSGGEAGYEGFFPAYRRPSG |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.99 % |
| % of genes near scaffold ends (potentially truncated) | 98.02 % |
| % of genes from short scaffolds (< 2000 bps) | 90.10 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.079 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (22.772 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.673 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.554 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.78% β-sheet: 0.00% Coil/Unstructured: 77.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF00535 | Glycos_transf_2 | 63.37 |
| PF01741 | MscL | 3.96 |
| PF13360 | PQQ_2 | 2.97 |
| PF00561 | Abhydrolase_1 | 1.98 |
| PF02397 | Bac_transf | 0.99 |
| PF13570 | PQQ_3 | 0.99 |
| PF00486 | Trans_reg_C | 0.99 |
| PF00534 | Glycos_transf_1 | 0.99 |
| PF01545 | Cation_efflux | 0.99 |
| PF06092 | DUF943 | 0.99 |
| PF13517 | FG-GAP_3 | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG1970 | Large-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 3.96 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.99 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.99 |
| COG2148 | Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid) | Cell wall/membrane/envelope biogenesis [M] | 0.99 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.08 % |
| Unclassified | root | N/A | 7.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000156|NODE_c0677934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2951 | Open in IMG/M |
| 3300000956|JGI10216J12902_119924841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 645 | Open in IMG/M |
| 3300001205|C688J13580_1066746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 506 | Open in IMG/M |
| 3300004157|Ga0062590_101612770 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300005093|Ga0062594_103319793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 505 | Open in IMG/M |
| 3300005184|Ga0066671_11016389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 521 | Open in IMG/M |
| 3300005332|Ga0066388_107752588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 538 | Open in IMG/M |
| 3300005338|Ga0068868_101171653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 709 | Open in IMG/M |
| 3300005339|Ga0070660_100408294 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300005347|Ga0070668_101395067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 639 | Open in IMG/M |
| 3300005356|Ga0070674_101133783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 692 | Open in IMG/M |
| 3300005438|Ga0070701_10103799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1578 | Open in IMG/M |
| 3300005441|Ga0070700_101433275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 585 | Open in IMG/M |
| 3300005459|Ga0068867_101804229 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300005549|Ga0070704_100229188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1514 | Open in IMG/M |
| 3300005587|Ga0066654_10573658 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300005614|Ga0068856_100190711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2063 | Open in IMG/M |
| 3300005615|Ga0070702_100361736 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300005764|Ga0066903_103195025 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300006031|Ga0066651_10034202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2295 | Open in IMG/M |
| 3300006031|Ga0066651_10116274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1367 | Open in IMG/M |
| 3300006175|Ga0070712_100777641 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300006175|Ga0070712_101265484 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300006576|Ga0074047_11964304 | All Organisms → cellular organisms → Bacteria | 1577 | Open in IMG/M |
| 3300006755|Ga0079222_12589490 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300006854|Ga0075425_100510153 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
| 3300007076|Ga0075435_101053495 | Not Available | 711 | Open in IMG/M |
| 3300009098|Ga0105245_10073481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3109 | Open in IMG/M |
| 3300009148|Ga0105243_10655822 | Not Available | 1018 | Open in IMG/M |
| 3300009174|Ga0105241_10775125 | Not Available | 881 | Open in IMG/M |
| 3300009840|Ga0126313_10346908 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300010045|Ga0126311_10028859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3394 | Open in IMG/M |
| 3300010335|Ga0134063_10321088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 748 | Open in IMG/M |
| 3300010399|Ga0134127_13176913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 537 | Open in IMG/M |
| 3300011994|Ga0120157_1056156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 835 | Open in IMG/M |
| 3300012212|Ga0150985_105950025 | Not Available | 1141 | Open in IMG/M |
| 3300012350|Ga0137372_10099112 | All Organisms → cellular organisms → Bacteria | 2448 | Open in IMG/M |
| 3300012351|Ga0137386_11290290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
| 3300012353|Ga0137367_10312563 | Not Available | 1122 | Open in IMG/M |
| 3300012491|Ga0157329_1010980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 718 | Open in IMG/M |
| 3300012497|Ga0157319_1002353 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300012508|Ga0157315_1011823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 794 | Open in IMG/M |
| 3300012512|Ga0157327_1023735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 714 | Open in IMG/M |
| 3300012519|Ga0157352_1094244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 521 | Open in IMG/M |
| 3300012912|Ga0157306_10005366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2342 | Open in IMG/M |
| 3300012951|Ga0164300_10971373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 544 | Open in IMG/M |
| 3300012958|Ga0164299_11316022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 553 | Open in IMG/M |
| 3300012960|Ga0164301_11250169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 599 | Open in IMG/M |
| 3300012986|Ga0164304_11562322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 548 | Open in IMG/M |
| 3300012988|Ga0164306_10291078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1188 | Open in IMG/M |
| 3300012988|Ga0164306_11151869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 648 | Open in IMG/M |
| 3300012989|Ga0164305_11504107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 597 | Open in IMG/M |
| 3300013297|Ga0157378_10353593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1436 | Open in IMG/M |
| 3300013307|Ga0157372_10245789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2076 | Open in IMG/M |
| 3300014058|Ga0120149_1084740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 835 | Open in IMG/M |
| 3300014157|Ga0134078_10682716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
| 3300014745|Ga0157377_10832139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 684 | Open in IMG/M |
| 3300015371|Ga0132258_12386243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1325 | Open in IMG/M |
| 3300017944|Ga0187786_10178487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 790 | Open in IMG/M |
| 3300018032|Ga0187788_10235146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 722 | Open in IMG/M |
| 3300018066|Ga0184617_1063119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 970 | Open in IMG/M |
| 3300019873|Ga0193700_1069445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 524 | Open in IMG/M |
| 3300022756|Ga0222622_10092033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1843 | Open in IMG/M |
| 3300023057|Ga0247797_1040900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 649 | Open in IMG/M |
| 3300024245|Ga0247677_1051398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 602 | Open in IMG/M |
| 3300025915|Ga0207693_10724108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 770 | Open in IMG/M |
| 3300025919|Ga0207657_10561878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 892 | Open in IMG/M |
| 3300025921|Ga0207652_11901909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
| 3300025929|Ga0207664_10925873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 782 | Open in IMG/M |
| 3300025934|Ga0207686_10556626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 897 | Open in IMG/M |
| 3300025935|Ga0207709_10543674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 912 | Open in IMG/M |
| 3300025935|Ga0207709_10875385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 729 | Open in IMG/M |
| 3300025938|Ga0207704_11517620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 575 | Open in IMG/M |
| 3300025972|Ga0207668_11136012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 701 | Open in IMG/M |
| 3300026023|Ga0207677_10831986 | Not Available | 828 | Open in IMG/M |
| 3300026075|Ga0207708_10034165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 3866 | Open in IMG/M |
| 3300026121|Ga0207683_10106444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 2508 | Open in IMG/M |
| 3300026121|Ga0207683_10430597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1215 | Open in IMG/M |
| 3300028379|Ga0268266_10644956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1019 | Open in IMG/M |
| 3300028592|Ga0247822_11355994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 597 | Open in IMG/M |
| 3300028711|Ga0307293_10227163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 594 | Open in IMG/M |
| 3300028715|Ga0307313_10084908 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300028744|Ga0307318_10260372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 605 | Open in IMG/M |
| 3300028784|Ga0307282_10671565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 502 | Open in IMG/M |
| 3300028787|Ga0307323_10279757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 600 | Open in IMG/M |
| 3300028787|Ga0307323_10300352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 577 | Open in IMG/M |
| 3300028793|Ga0307299_10087601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1160 | Open in IMG/M |
| 3300028807|Ga0307305_10098437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1352 | Open in IMG/M |
| 3300028807|Ga0307305_10366472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 653 | Open in IMG/M |
| 3300028819|Ga0307296_10208043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1062 | Open in IMG/M |
| 3300028828|Ga0307312_11177482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 507 | Open in IMG/M |
| 3300028875|Ga0307289_10238675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 748 | Open in IMG/M |
| 3300028884|Ga0307308_10347285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 710 | Open in IMG/M |
| 3300030336|Ga0247826_10290466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1167 | Open in IMG/M |
| 3300031562|Ga0310886_10364325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 844 | Open in IMG/M |
| 3300031771|Ga0318546_11273070 | Not Available | 516 | Open in IMG/M |
| 3300031995|Ga0307409_101291323 | Not Available | 755 | Open in IMG/M |
| 3300032008|Ga0318562_10249719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1030 | Open in IMG/M |
| 3300033004|Ga0335084_11798088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 600 | Open in IMG/M |
| 3300033158|Ga0335077_11829739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 569 | Open in IMG/M |
| 3300033412|Ga0310810_11278479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 582 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 22.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 3.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.97% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.98% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.98% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.98% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.98% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.99% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.99% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.99% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.99% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.99% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.99% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.99% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.99% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.99% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001205 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011994 | Permafrost microbial communities from Nunavut, Canada - A7_65cm_12M | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Host-Associated | Open in IMG/M |
| 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Host-Associated | Open in IMG/M |
| 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Host-Associated | Open in IMG/M |
| 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Host-Associated | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014058 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300019873 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300023057 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6 | Environmental | Open in IMG/M |
| 3300024245 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18 | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| NODE_06779345 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | RADSLHHFKARFDPEGLLEAAVGKAIHDGEAYSRLGGGEASLDGFFPAYRRARQE* |
| JGI10216J12902_1199248412 | 3300000956 | Soil | GGKADSLHHFKARFDPEGLVEAAVGKAIHDEDAYRRLSGGETGFDGFFPTYRSRTPT* |
| C688J13580_10667461 | 3300001205 | Soil | HFKARFDPEGLVPAAIGKAIHDEAAYRELSGGETGFDGFFPAYRRSNG* |
| Ga0062590_1016127701 | 3300004157 | Soil | ALHHFKARFDPEGLVPAAVGKAIHDEDAYRELSGGEAGFDGFFPAYRRSSG* |
| Ga0062594_1033197931 | 3300005093 | Soil | PEGLVPAAIGKAIHDEAAYRELSGGEARYDGFFPAYRQPVE* |
| Ga0066671_110163892 | 3300005184 | Soil | KADALHHFKARFDPEGLVPAAIGKAIHDEAVYRELSGGRVGGFDGFFPAYRRPSG* |
| Ga0066388_1077525882 | 3300005332 | Tropical Forest Soil | RFDPEGLVDAAVGKAVHDEDAYRELSGGEAGYDGFFPAYRATVPA* |
| Ga0068868_1011716533 | 3300005338 | Miscanthus Rhizosphere | SLHHFKARFDPEGLVEAAVGKAIHDEDTYRRLSGGETGFDGFFPSYRRRTP* |
| Ga0070660_1004082941 | 3300005339 | Corn Rhizosphere | DSLHHFKARFDPEGLVEAALGKAIHDEDAYRELSGGDAGYDGFFPAYRRPSG* |
| Ga0070668_1013950672 | 3300005347 | Switchgrass Rhizosphere | EGLVEAAVGKAIHDEESYRELTGGETGYEGFFPSYRSRTPN* |
| Ga0070674_1011337831 | 3300005356 | Miscanthus Rhizosphere | DSLHEFKLRFDPGGEVEAAIGKAIHDEAAYRRLAGPGAGLDGFFPAYRRA* |
| Ga0070701_101037993 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | ARFDPEGLVEAAVGKAIHDEESYRELTGGETGYEGFFPSYRSRTPN* |
| Ga0070700_1014332751 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | HFKARFDPEGLVEAAVGKAIHDENTYRRLSGGETGFDGFFPAYRSRTP* |
| Ga0068867_1018042291 | 3300005459 | Miscanthus Rhizosphere | LHHFKARFDPEGLVPAAVGKAIHDEDAYRELSGGEVGYEGFFPAYRQRVE* |
| Ga0070704_1002291883 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | ARFDPEGLVEAAVGKAIHDEAAYRELSGGEAGYEGFFPAYRRPSG* |
| Ga0066654_105736582 | 3300005587 | Soil | ALHHFKARFDPEGLVPAAIGKAIHDEAAYRELSGGRVDGLDGFFPAYRRPTG* |
| Ga0068856_1001907111 | 3300005614 | Corn Rhizosphere | HFKARFDPDGLVPAAIGKAIHDEERYRELGGDGFDGFFPAYRHRASSVNACS* |
| Ga0070702_1003617363 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | GLGGKADSLHHFKARFDPEGLVEAAVGKAIHDEDTYRRLSGGETGFDGFFPAYRSRTP* |
| Ga0066903_1031950252 | 3300005764 | Tropical Forest Soil | DSLHRFKARFDPEGLVPAAVGKAIHDEAAYRELSGGDAVYDGFFPAYRRRAS* |
| Ga0066651_100342023 | 3300006031 | Soil | LGGGVGGADDSLLEFKLRFDPGGLIESAVGKAIHDDDAYRKLGGEGFDGFFPAYRRAA* |
| Ga0066651_101162741 | 3300006031 | Soil | LRFDEGGLIESAVGKAIHDEVRYRELGGEGYDGFFPAYRATVTA* |
| Ga0070712_1007776412 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | EDSLHHFKARFDPEGLVPAAVGKAIHDEDAYRRLSGGSEAVFEGFFPAYRRPSR* |
| Ga0070712_1012654842 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | EDSLHHFKARFDPEGLVPAAVGKAIHDEDAYRRLSGGEASYDGFFPAYRAASVARR* |
| Ga0074047_119643043 | 3300006576 | Soil | DDSLLEFKLRFDPGGLIESAVGKAIHDEQAYRELAGAGAGLDGFFPAYRRNQATVSA* |
| Ga0079222_125894902 | 3300006755 | Agricultural Soil | GGVGGARDSLYEFKLRFDPCGEVEAAIGKAIHDEKAYHRLAGPQAGLEGFFPAYRQAARAAT* |
| Ga0075425_1005101531 | 3300006854 | Populus Rhizosphere | GRGGKQDSLHHFKARFDPEGLVDAAVGKAIHDEDAYRELSGGEAGYDGFFPAYRAETIGTVAP* |
| Ga0075435_1010534951 | 3300007076 | Populus Rhizosphere | RRFDPGGLVDAAIGKAIHDENAYRRLAGGVASLDRYFPAYRRP* |
| Ga0105245_100734814 | 3300009098 | Miscanthus Rhizosphere | GGLGGKQDSLHHFKARFDPEGLVDAAVGKAIHDEDAYRELSGGEAGYDGFFPAYRAEAIGTVAP* |
| Ga0105243_106558221 | 3300009148 | Miscanthus Rhizosphere | LGGKADSLHHFKARFDPEGLVKAAVGKAIHDEDAYRELSGGEAGYDGFFPAYRRASG* |
| Ga0105241_107751252 | 3300009174 | Corn Rhizosphere | FDPEGLVPAAVGKAIHDADAYRELSGGETGYEGFFPAYRQRVE* |
| Ga0126313_103469083 | 3300009840 | Serpentine Soil | DPGGGLEAAVGKAIHDEDGYRRLAGPGAGLEGFFPAYRAA* |
| Ga0126311_100288591 | 3300010045 | Serpentine Soil | RRFDPGGLVDAAVGKAVHDEDAYARLTGGDASLEGFFPAYRATVAP* |
| Ga0134063_103210882 | 3300010335 | Grasslands Soil | ADDSLLQFKLRFDEGGLIASAVGKAIHDEARCRELGGEGYDGFFPAYRATVTA* |
| Ga0134127_131769131 | 3300010399 | Terrestrial Soil | DDSLLEFKLRFDEGGLIESAVGKAVHDEDAYRALGGQGFDGFFPAYRRAA* |
| Ga0120157_10561562 | 3300011994 | Permafrost | LRFNPGGELEMAVGKAIHDEEAYARLVGPEAGLDGFFPAYRATVRA* |
| Ga0150985_1059500252 | 3300012212 | Avena Fatua Rhizosphere | LGGGVGGREDSLHELKRRFDPGGLVEAAVGKAVHDERAYRRLSGAEGLVGFFPAYRRPDTVAT* |
| Ga0137372_100991124 | 3300012350 | Vadose Zone Soil | GVGGRRDSLYEFKLRFDPGGELEAAIGKAIHDEQAYRALAGPQAGLDGFFPAYRAPVAKAT* |
| Ga0137386_112902902 | 3300012351 | Vadose Zone Soil | QRFDPGGVLEAAVGKAVHDEAAYRALAGGDAGLEGYFPAYRAPASTVRA* |
| Ga0137367_103125631 | 3300012353 | Vadose Zone Soil | RRDSLYEFKLRFDPGGELEAAIGKAIHDEQAYRALAGPQAGLDGFFPAYRAPAAKAT* |
| Ga0157329_10109801 | 3300012491 | Arabidopsis Rhizosphere | HFKARFDPEGLVEAAVGKAIHDEAAYRDLSGGEAGYDGFFPAYRAASR* |
| Ga0157319_10023531 | 3300012497 | Arabidopsis Rhizosphere | LYEFKLRFDPCGEVEAAIGKAIHDEEAYHRLAGPQAGLDGFFPAYRQGARAAT* |
| Ga0157315_10118232 | 3300012508 | Arabidopsis Rhizosphere | DSLHHFKARFDPEGLVPAAVGKAIHDEAAYRDLSGGEAGYHGFFPAYRAASR* |
| Ga0157327_10237352 | 3300012512 | Arabidopsis Rhizosphere | ADSLHHFKARFDPEGLVPAAVGKAIHDEDAYRELSGGEAGYEGFFPAYRRPSR* |
| Ga0157352_10942442 | 3300012519 | Unplanted Soil | GGGLGGKEDSLHHFKARFDPEGLVEAAVGKAIHDEAAYRDLSGGEAGYDGFFPAYRAASR |
| Ga0157306_100053661 | 3300012912 | Soil | HHFKARFDPEGLVDAAVGKAIHDEDAYRELSGGEAGYDGFFPAYRAEAIGTVAP* |
| Ga0164300_109713731 | 3300012951 | Soil | EFKLRFDPGGVLEMAVGKVIHDEDGYRALGGAGTEGFFPAYRRAASTVRA* |
| Ga0164299_113160221 | 3300012958 | Soil | DSLHHFKARFDPEGLVEAAVGKAIHDEAAYRELSGGEAGYEGFFPAYRRSSG* |
| Ga0164301_112501692 | 3300012960 | Soil | LVPAAVGKALHDEDAYRELSGGRFAGYAGFFPAYRHRVE* |
| Ga0164304_115623221 | 3300012986 | Soil | LGGKEDSLHHFKARFDPEGLVPAAVGKAIHDEDAYRRLSGGSEVVFEGFFPAYRRPSR* |
| Ga0164306_102910782 | 3300012988 | Soil | LGGGLGGKADSLHHFKARFDPDGLVPAAVGKAIHDEDAYRRLSGGSEVAFEGFFPAYRRPSR* |
| Ga0164306_111518692 | 3300012988 | Soil | GGGVGGADDSLLQFKLRFDEGGLIESAVGKAIHDDNAYRRLGGKGFEGFFPAYRRATDA* |
| Ga0164305_115041072 | 3300012989 | Soil | GLGGKADSLHHFKARFDPEGLVEAAVGKAIHDEDAYRELSGGEAGYEGFFPAYRRSSG* |
| Ga0157378_103535931 | 3300013297 | Miscanthus Rhizosphere | HFKARFDPEGQVGAAVGKAIHDENTYRRLSGGETGFDGFFPAYRSHSRTP* |
| Ga0157372_102457894 | 3300013307 | Corn Rhizosphere | HHFKARFDPEGLVEAAVGKAIHDEDTYRRLSGGETGFDGFFPAYRSRTP* |
| Ga0120149_10847401 | 3300014058 | Permafrost | EFKLRFDPGGELEMAVGKAIHDEEAYARLAGPEAGLDGFFPAYRATVRA* |
| Ga0134078_106827162 | 3300014157 | Grasslands Soil | LLQFKFRFDEGGLLESTVGKGIQDEQAHRALGGEGFDGYFPAYRRSP* |
| Ga0157377_108321391 | 3300014745 | Miscanthus Rhizosphere | FDPEGLVPAAVGKAIHDEDAYRELSGGEVGYEGFFPAYRQRVE* |
| Ga0132258_123862431 | 3300015371 | Arabidopsis Rhizosphere | ARDSLYEFKLRFDPGGEVEAAIGKAIHDEEAYRRLAGPQAGLAGFFPAYRQAARTAT* |
| Ga0187786_101784873 | 3300017944 | Tropical Peatland | ADDSLLEFKLRFDEGGLIESAVGKAIHDEACYRDLGGEGFEGFFPAYRAAS |
| Ga0187788_102351461 | 3300018032 | Tropical Peatland | DDSLLEFKLRFDEGGLIESAVGKAIHDEACYRDLGGEGSEGFFPAYRAAS |
| Ga0184617_10631193 | 3300018066 | Groundwater Sediment | KRDSLLEFKLRFDPGGELEMAVGKAIHDEKAYVELAGPKPGLEGFFPAYRAAGSRDDR |
| Ga0193700_10694451 | 3300019873 | Soil | LRFDPGGELEMAVGKAIHDEDAYRELAGRPAGLDGFFPAYRAGSRTTAEGRPGSGS |
| Ga0222622_100920331 | 3300022756 | Groundwater Sediment | FKLRFDPGGELEMAVGKAIHDEEAYRGLAGADAGVDGFFPAYRATVRA |
| Ga0247797_10409001 | 3300023057 | Soil | GKQDSLHHFKARFDPEGLVDAAVGKAIHDEDAYRELSGGEAGYDGFFPAYRAEAIGTVAP |
| Ga0247677_10513981 | 3300024245 | Soil | LGGKEDSLHHFKARFDPEGLVPAAVGKAIHDEDAYRRLSGAEASFAGFFPAYRRVRHN |
| Ga0207693_107241081 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | KARFDPEGLVPAAVGKAIHDEDAYRRLSGGEASYDGFFPAYRAASVARR |
| Ga0207657_105618782 | 3300025919 | Corn Rhizosphere | KARFDPEGLVPAAVGKAIHDEDAYRELSGGEVGYEGFFPAYRQRVE |
| Ga0207652_119019092 | 3300025921 | Corn Rhizosphere | RFDPEGLVPAAVGKAIHDEDAYRELSGGEAGYEGFFPAYRQRVE |
| Ga0207664_109258731 | 3300025929 | Agricultural Soil | GLVPAAVGKAIHDEDAYRRLSGGSEVAFEGFFPAYRRPSR |
| Ga0207686_105566261 | 3300025934 | Miscanthus Rhizosphere | HHFKARFDPEGLVEAAVGKAIHDEDTYRRLSGGETGFDGFFPAYRSRTP |
| Ga0207709_105436742 | 3300025935 | Miscanthus Rhizosphere | LGGGLGGKADSLHHFKSRFDPEGLVEAAVGKAIHDEDAYRELSGEADYEGFFPAYRRPSG |
| Ga0207709_108753853 | 3300025935 | Miscanthus Rhizosphere | GGKADSLHHFKARFDPEGLVEAAVGKAIHDEESYRELTGGETGYEGFFPSYRSRTPN |
| Ga0207704_115176202 | 3300025938 | Miscanthus Rhizosphere | SLHHFKTRFDPEGLVEAAVGKAIHDEDTYRRLSGGETGFDGFFPSYRSRTP |
| Ga0207668_111360123 | 3300025972 | Switchgrass Rhizosphere | GGLGVKADSLHHFKARFDPEGLVEAAVGKAIHDEDTYRRLSGGETGFDGFFPAYRSRTP |
| Ga0207677_108319862 | 3300026023 | Miscanthus Rhizosphere | SLHHFKARFDPEGLVEAAVGKAIHDEAAYRELSGGEAGYEGFFPAYRRPSG |
| Ga0207708_100341655 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | GGGLGGKADSLHHFKARFDPEGLVEAAVGKAIHDENTYRRLSGGETGFDGFFPAYRSRTP |
| Ga0207683_101064441 | 3300026121 | Miscanthus Rhizosphere | SLHHFKARFDPEGLVPAAVGKAIHDEDAYRELSGGEVGYEGFFPAYRQRVE |
| Ga0207683_104305973 | 3300026121 | Miscanthus Rhizosphere | HFKARFDPEGLVEAAVGKAIHDEDTYRRLSGGETGFDGFFPAYRSRTP |
| Ga0268266_106449562 | 3300028379 | Switchgrass Rhizosphere | LHHFKARFDPEGLVPAAVGKAIHDEDAYRELSGRAVGYEGFFPAYRQRVE |
| Ga0247822_113559941 | 3300028592 | Soil | LRFDPGGEVEAGIGKAIHDETAYRRLAGPGAGLDGFFPAYRRA |
| Ga0307293_102271632 | 3300028711 | Soil | PEGLVPAAVGKAIHDEDAYRELSGGDTAYEGFFPAYRRSNG |
| Ga0307313_100849081 | 3300028715 | Soil | KLRIDPGGEVEAAIGKAIHDREAYRRLAGPEAGVDGFFPAYRRP |
| Ga0307318_102603721 | 3300028744 | Soil | GGGLGGKEDSLHHFKARFDPEGLVDAAVGKAIHDEDAYRRLSGGKAGYDGFFPAYRDPSR |
| Ga0307282_106715651 | 3300028784 | Soil | GGSDDSLLQFKLRFDEGGLIESAVGKAIHDNERYRELGGAGFDGYFPSYRRAA |
| Ga0307323_102797571 | 3300028787 | Soil | GRRDSLFDFKLHFDPGGELEMAVGKAIHDEEAYRGLAGADAGVDGFFPAYRATVRA |
| Ga0307323_103003522 | 3300028787 | Soil | GGVGGADDSLLQFKLRFDEGGLIESAVGKAIHEEARYRELGGAGYEGFFPVYRAPR |
| Ga0307299_100876013 | 3300028793 | Soil | FDPGGELEMAVGKAIHDDSAYRALAGAQAGLEGFFPAYRAAGSRDDR |
| Ga0307305_100984372 | 3300028807 | Soil | GADDSLLQFKLRFDEGGLIESAVGKAIHDNERYRELGGSGFDGYFPSYRRAA |
| Ga0307305_103664722 | 3300028807 | Soil | PEGLVPAAVGKAIHDEDAYRELSGGEAGYDGFFPAYRRSNG |
| Ga0307296_102080433 | 3300028819 | Soil | DSLLQFKLRFDEGGLIESAVGKAIHDNERYRELGGEDFEGFFPAYRSRG |
| Ga0307312_111774821 | 3300028828 | Soil | GGGLGGKEDSLHHFKARFDPEGLVDAAVGKAIHDEDAYRSLSGGEAGLEGYFPAYRAPSG |
| Ga0307289_102386753 | 3300028875 | Soil | KLRFDPGGELEMAVGKAIHDDSAYRALAGAQAGLEGFFPAYRAAGSRDDR |
| Ga0307308_103472852 | 3300028884 | Soil | DSLFEFKLRFDPGGELEMAVGKAIHDDGAYRALAGPQAGLEGFFPAYRAAGSRDDR |
| Ga0247826_102904661 | 3300030336 | Soil | ARFDPEGLVEAAVGKAIHDEDAYRELSGGEAGYDGFFPAYRRPSG |
| Ga0310886_103643252 | 3300031562 | Soil | HFKARFDPEGLVDAAVGKAIHDEDAYRRLSGGSEVAFEGFFPAYRRPSR |
| Ga0318546_112730701 | 3300031771 | Soil | RRFDPGGLVEAAVGKAVHDEVAYGKLTGGAAGLGGFFPAYRR |
| Ga0307409_1012913231 | 3300031995 | Rhizosphere | FDPEGLLDAAVGKAIHDDAAYRELSGGEAGYDGFFPAYRAASL |
| Ga0318562_102497193 | 3300032008 | Soil | VGGASDSLHEYKRRFDPGGLVEAAVGKAVHDEVAYGKLTGGAAGLGGFFPAYRR |
| Ga0335084_117980881 | 3300033004 | Soil | GGGVGGADDSLLQFKLRFDEGGLIESAVGKTVHDETRYRDLGGAGFEGFFPAYRRPGRE |
| Ga0335077_118297391 | 3300033158 | Soil | VGGPHDSLLEFKLRFDPGGLIESAVGKAIHDEAAYRELAGPDAGLDGFFPAYRARQA |
| Ga0310810_112784792 | 3300033412 | Soil | DSLHHFKARFDPEGLVPAAVGKAIHDEDAYRELSGGATGYDGFFPAYRRPTG |
| ⦗Top⦘ |