| Basic Information | |
|---|---|
| Family ID | F103633 |
| Family Type | Metagenome |
| Number of Sequences | 101 |
| Average Sequence Length | 49 residues |
| Representative Sequence | IDQTKSQSGNAVGNSNFREDVNVDGFIDSADIGLVKSKSGTALP |
| Number of Associated Samples | 70 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.00 % |
| % of genes near scaffold ends (potentially truncated) | 92.08 % |
| % of genes from short scaffolds (< 2000 bps) | 92.08 % |
| Associated GOLD sequencing projects | 65 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.267 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (22.772 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.693 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.525 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.28% β-sheet: 2.78% Coil/Unstructured: 81.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF00404 | Dockerin_1 | 9.90 |
| PF13462 | Thioredoxin_4 | 3.96 |
| PF00072 | Response_reg | 1.98 |
| PF03548 | LolA | 1.98 |
| PF01978 | TrmB | 1.98 |
| PF01345 | DUF11 | 1.98 |
| PF01380 | SIS | 1.98 |
| PF04963 | Sigma54_CBD | 0.99 |
| PF04185 | Phosphoesterase | 0.99 |
| PF14765 | PS-DH | 0.99 |
| PF05157 | T2SSE_N | 0.99 |
| PF04321 | RmlD_sub_bind | 0.99 |
| PF01923 | Cob_adeno_trans | 0.99 |
| PF06739 | SBBP | 0.99 |
| PF13520 | AA_permease_2 | 0.99 |
| PF13450 | NAD_binding_8 | 0.99 |
| PF00082 | Peptidase_S8 | 0.99 |
| PF01053 | Cys_Met_Meta_PP | 0.99 |
| PF07589 | PEP-CTERM | 0.99 |
| PF05013 | FGase | 0.99 |
| PF13522 | GATase_6 | 0.99 |
| PF02668 | TauD | 0.99 |
| PF01936 | NYN | 0.99 |
| PF00486 | Trans_reg_C | 0.99 |
| PF00027 | cNMP_binding | 0.99 |
| PF00127 | Copper-bind | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG0451 | Nucleoside-diphosphate-sugar epimerase | Cell wall/membrane/envelope biogenesis [M] | 1.98 |
| COG0702 | Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domains | General function prediction only [R] | 1.98 |
| COG1086 | NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsC | Cell wall/membrane/envelope biogenesis [M] | 1.98 |
| COG2834 | Outer membrane lipoprotein-sorting protein | Cell wall/membrane/envelope biogenesis [M] | 1.98 |
| COG1091 | dTDP-4-dehydrorhamnose reductase | Cell wall/membrane/envelope biogenesis [M] | 0.99 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.99 |
| COG3931 | Predicted N-formylglutamate amidohydrolase | Amino acid transport and metabolism [E] | 0.99 |
| COG3741 | N-formylglutamate amidohydrolase | Amino acid transport and metabolism [E] | 0.99 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.99 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.99 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.99 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.99 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.99 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.99 |
| COG1508 | DNA-directed RNA polymerase specialized sigma subunit, sigma54 homolog | Transcription [K] | 0.99 |
| COG1432 | NYN domain, predicted PIN-related RNAse, tRNA/rRNA maturation | General function prediction only [R] | 0.99 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.99 |
| COG1090 | NAD dependent epimerase/dehydratase family enzyme | General function prediction only [R] | 0.99 |
| COG1089 | GDP-D-mannose dehydratase | Cell wall/membrane/envelope biogenesis [M] | 0.99 |
| COG1088 | dTDP-D-glucose 4,6-dehydratase | Cell wall/membrane/envelope biogenesis [M] | 0.99 |
| COG1087 | UDP-glucose 4-epimerase | Cell wall/membrane/envelope biogenesis [M] | 0.99 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.99 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.99 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.99 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.99 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.27 % |
| Unclassified | root | N/A | 26.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004081|Ga0063454_100899368 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300004479|Ga0062595_100222298 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300005167|Ga0066672_10422597 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 871 | Open in IMG/M |
| 3300005167|Ga0066672_10587210 | Not Available | 722 | Open in IMG/M |
| 3300005176|Ga0066679_11002559 | Not Available | 520 | Open in IMG/M |
| 3300005179|Ga0066684_11126376 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300005180|Ga0066685_10333075 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300005180|Ga0066685_10663447 | Not Available | 717 | Open in IMG/M |
| 3300005181|Ga0066678_10402482 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300005184|Ga0066671_10016285 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 3170 | Open in IMG/M |
| 3300005184|Ga0066671_10044301 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2203 | Open in IMG/M |
| 3300005184|Ga0066671_10360290 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 925 | Open in IMG/M |
| 3300005364|Ga0070673_101628009 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300005435|Ga0070714_101455193 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 669 | Open in IMG/M |
| 3300005445|Ga0070708_101428544 | Not Available | 645 | Open in IMG/M |
| 3300005467|Ga0070706_100297296 | All Organisms → cellular organisms → Bacteria | 1506 | Open in IMG/M |
| 3300005467|Ga0070706_100551512 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300005468|Ga0070707_101569074 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 625 | Open in IMG/M |
| 3300005468|Ga0070707_101800894 | Not Available | 579 | Open in IMG/M |
| 3300005471|Ga0070698_102118325 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 516 | Open in IMG/M |
| 3300005518|Ga0070699_102092606 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300005536|Ga0070697_100675417 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300005536|Ga0070697_100726877 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300005536|Ga0070697_100761194 | Not Available | 856 | Open in IMG/M |
| 3300005536|Ga0070697_100912514 | Not Available | 779 | Open in IMG/M |
| 3300005554|Ga0066661_10805910 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 549 | Open in IMG/M |
| 3300005559|Ga0066700_10977491 | Not Available | 558 | Open in IMG/M |
| 3300005560|Ga0066670_10161564 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300005566|Ga0066693_10330294 | Not Available | 612 | Open in IMG/M |
| 3300005569|Ga0066705_10330654 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300005575|Ga0066702_10291689 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300005586|Ga0066691_10786668 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300005587|Ga0066654_10498237 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 668 | Open in IMG/M |
| 3300005587|Ga0066654_10501692 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 666 | Open in IMG/M |
| 3300005985|Ga0081539_10423114 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300006034|Ga0066656_10735002 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300006175|Ga0070712_101771109 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 541 | Open in IMG/M |
| 3300006755|Ga0079222_11352409 | Not Available | 654 | Open in IMG/M |
| 3300006797|Ga0066659_11125078 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300006804|Ga0079221_10191514 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1112 | Open in IMG/M |
| 3300006804|Ga0079221_10477275 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300006806|Ga0079220_10309471 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 981 | Open in IMG/M |
| 3300006806|Ga0079220_11604289 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → unclassified Opitutaceae → Opitutaceae bacterium TAV1 | 564 | Open in IMG/M |
| 3300006871|Ga0075434_102192374 | Not Available | 556 | Open in IMG/M |
| 3300006903|Ga0075426_11043460 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300006903|Ga0075426_11506261 | Not Available | 511 | Open in IMG/M |
| 3300006954|Ga0079219_10508216 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 847 | Open in IMG/M |
| 3300006954|Ga0079219_11781919 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300006954|Ga0079219_12293165 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300006954|Ga0079219_12529668 | Not Available | 500 | Open in IMG/M |
| 3300009012|Ga0066710_100822742 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1425 | Open in IMG/M |
| 3300009012|Ga0066710_104154222 | Not Available | 541 | Open in IMG/M |
| 3300009088|Ga0099830_10361805 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1168 | Open in IMG/M |
| 3300009147|Ga0114129_13083106 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 545 | Open in IMG/M |
| 3300009545|Ga0105237_11738652 | Not Available | 631 | Open in IMG/M |
| 3300010325|Ga0134064_10227284 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 681 | Open in IMG/M |
| 3300010401|Ga0134121_10871979 | Not Available | 871 | Open in IMG/M |
| 3300010401|Ga0134121_11024216 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 812 | Open in IMG/M |
| 3300011271|Ga0137393_10514417 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1027 | Open in IMG/M |
| 3300012198|Ga0137364_10388009 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1044 | Open in IMG/M |
| 3300012200|Ga0137382_10713429 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 719 | Open in IMG/M |
| 3300012361|Ga0137360_11524577 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 573 | Open in IMG/M |
| 3300012361|Ga0137360_11527972 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 572 | Open in IMG/M |
| 3300012582|Ga0137358_10938112 | Not Available | 565 | Open in IMG/M |
| 3300012924|Ga0137413_11230600 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300012929|Ga0137404_10639644 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300013307|Ga0157372_10607286 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1275 | Open in IMG/M |
| 3300015162|Ga0167653_1077312 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 543 | Open in IMG/M |
| 3300015264|Ga0137403_10708254 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 867 | Open in IMG/M |
| 3300018468|Ga0066662_10779101 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300018468|Ga0066662_12231035 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 575 | Open in IMG/M |
| 3300018920|Ga0190273_10914280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 712 | Open in IMG/M |
| 3300019890|Ga0193728_1094441 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1390 | Open in IMG/M |
| 3300021478|Ga0210402_11976143 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 509 | Open in IMG/M |
| 3300021559|Ga0210409_11244594 | Not Available | 620 | Open in IMG/M |
| 3300025910|Ga0207684_10324969 | Not Available | 1326 | Open in IMG/M |
| 3300025910|Ga0207684_10884853 | Not Available | 751 | Open in IMG/M |
| 3300025927|Ga0207687_10050941 | All Organisms → cellular organisms → Bacteria | 2884 | Open in IMG/M |
| 3300025929|Ga0207664_10042766 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 3539 | Open in IMG/M |
| 3300025929|Ga0207664_10544894 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1041 | Open in IMG/M |
| 3300025939|Ga0207665_10613639 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 850 | Open in IMG/M |
| 3300025939|Ga0207665_11599293 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 517 | Open in IMG/M |
| 3300025939|Ga0207665_11641726 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300026301|Ga0209238_1220556 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 558 | Open in IMG/M |
| 3300026316|Ga0209155_1053702 | All Organisms → cellular organisms → Bacteria | 1559 | Open in IMG/M |
| 3300026540|Ga0209376_1241218 | Not Available | 781 | Open in IMG/M |
| 3300026551|Ga0209648_10469771 | Not Available | 762 | Open in IMG/M |
| 3300026552|Ga0209577_10394835 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 998 | Open in IMG/M |
| 3300027903|Ga0209488_10288540 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1226 | Open in IMG/M |
| 3300027908|Ga0209006_10622998 | Not Available | 889 | Open in IMG/M |
| 3300031823|Ga0307478_10026779 | All Organisms → cellular organisms → Bacteria | 4118 | Open in IMG/M |
| 3300031823|Ga0307478_10033360 | All Organisms → cellular organisms → Bacteria | 3729 | Open in IMG/M |
| 3300031823|Ga0307478_10112485 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2123 | Open in IMG/M |
| 3300031823|Ga0307478_10295096 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300031823|Ga0307478_10464473 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1053 | Open in IMG/M |
| 3300031962|Ga0307479_11870557 | Not Available | 551 | Open in IMG/M |
| 3300031962|Ga0307479_11999253 | Not Available | 529 | Open in IMG/M |
| 3300031962|Ga0307479_12145416 | Not Available | 506 | Open in IMG/M |
| 3300032180|Ga0307471_101607161 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 806 | Open in IMG/M |
| 3300032180|Ga0307471_102396334 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 22.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 16.83% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 9.90% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 8.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.94% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.97% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.98% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.98% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.99% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.99% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.99% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015162 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4c, rock/ice/stream interface) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0063454_1008993682 | 3300004081 | Soil | GDTNADGSVNSGDIGQVKSESGNPVTGTNFREDVTVDGLINSGDVGQTKAASGTSLP* |
| Ga0062595_1002222982 | 3300004479 | Soil | VSQTKSQSGNAVTSSNFREDVNVDGFIDAVDTSLVKSKSGTALP* |
| Ga0066672_104225971 | 3300005167 | Soil | DIGQTKSQSGNPVTSANFREDLNVDGFLDSADIGLVKSKSGTALP* |
| Ga0066672_105872101 | 3300005167 | Soil | IAQTKSQSGKAVANSNFREDLNVDGFLDSADIAFVKSKSGTALP* |
| Ga0066673_107065161 | 3300005175 | Soil | MAVLLGDTNADAAVNSSDIGQTKSQSFHTVVQGNFREDVNVDGSINSSDIGLVKSKSFTALPP* |
| Ga0066679_110025592 | 3300005176 | Soil | GDGSVNSVDINQTKSQIGLAVGPGNFREDVIADNSINGKDLSLVKSQSGTALP* |
| Ga0066684_111263762 | 3300005179 | Soil | ADHFVDSADIAQTKSKSGQAVSASNFREDLNTDGFLDSADIGLVKSKSGTTLP* |
| Ga0066685_103330752 | 3300005180 | Soil | NSADISQTKSQSGHVVTSSNFREDVTADGSLNSADISLVKSKSGTVLP* |
| Ga0066685_106634471 | 3300005180 | Soil | ADISQTKAQSGHVVGSGNFREDVTVDGSLNSADISTVKSKSGTALPTAP* |
| Ga0066678_104024821 | 3300005181 | Soil | ISQTKSQSGHAVTSSNFREDVTADGSINSADISLVKSKSGTALP* |
| Ga0066671_100162851 | 3300005184 | Soil | IDQTKSQSGNAVGNSNFREDVNVDGFIDSADIGLVKSKSGTALP* |
| Ga0066671_100443015 | 3300005184 | Soil | VDSADISQVKSQSGNPVNSTNFREDLNLDGFLDSADIGLVKSKSGSSLP* |
| Ga0066671_103602901 | 3300005184 | Soil | VNADNFREDVTADRFVDSADIGQTKSQSGKAVTSSNFREDLNSDGLVDSADISFAKSKSGTALH* |
| Ga0070673_1016280092 | 3300005364 | Switchgrass Rhizosphere | SVDASDIAQTKSQSGQPVTSSNLREDLNGDGFIDSSDIGLVKSKSGTALPPAP* |
| Ga0070714_1014551931 | 3300005435 | Agricultural Soil | DRFCDAVDVSQTKSQSGNPVGLNNFREDVNVDGFIDAVDTSLVKSKSGTALP* |
| Ga0070708_1014285442 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | FLLGDTNADRFTDAVDVSQTKSQSGNAVTNANFREDVNVDGFIDAVDTALVKSKSGTALP |
| Ga0070706_1002972962 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VIGDATEDGSVNVADLGQTESQSGHAVTSSNFREDVNVDGSINVADIGLMKSKSGTPLP* |
| Ga0070706_1005515123 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | DSADIAQTKSESGHAVDANNKREDLNVDGFIDSADIALVKSKSGTTLP* |
| Ga0070707_1015690742 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | ADISQTKAESGHAVTGSNFREDLNLDGFLDSADIGLVKSKSGTALP* |
| Ga0070707_1018008941 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | SADIGQTKSQSGHLVTTSNFREDVTVDGSINSADIGLVKSKSGTALPSLP* |
| Ga0070698_1021183251 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | ADIAQTKSQSGHAVTGSNFREDLNVDGFVDSADIALVKSKSGTALP* |
| Ga0070699_1020926061 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | ISQTKSQSGHVVTTSNFREDVTADGSINSADISLVKSKSGTALP* |
| Ga0070697_1006754171 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | TADGSVNSADIGQTKSQSGHAVTSSNFREDVTVDGSINSADIGLVKSKSGTALP* |
| Ga0070697_1007268773 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | SADIGQTKSQSGHAVTSSNFREDVTVDGSINSADIGLVKSKSGTALPP* |
| Ga0070697_1007611942 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VNSSDIGQTKSKSGVAVASSNFREDLNADGSTNSGDIALAKSRSATALP* |
| Ga0070697_1009125141 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | IGQTKSQSGHAVTTSNFREDVTVDGSINSADIGLVKSKSGTALPP* |
| Ga0066661_108059102 | 3300005554 | Soil | AQTKSKSGQAVSASNFREDLNTDGFLDSADIGLVKSKSGTTLP* |
| Ga0066700_109774911 | 3300005559 | Soil | SQTKSQSGHVVNSSNFREDVTADGSINSADISLVKSKSGTALP* |
| Ga0066670_101615643 | 3300005560 | Soil | SQTKSQSGNAVTNSNYREDVNVDGFIDAVDTSLVKSKSGTALPSQ* |
| Ga0066693_103302941 | 3300005566 | Soil | ADRFTDSVDVSQTKSQSGNAVINGNFREDVNADGFIDAVDVSLVKSKSGTALP* |
| Ga0066705_103306542 | 3300005569 | Soil | RFVDSGDIGQTKSQSGKSVTASNFREDINADGFIDSADIGFVKSKSGTALR* |
| Ga0066702_102916891 | 3300005575 | Soil | GDTNADRFVDSADIDQTKSQSGNAVGSSNFREDVNVDGFLDSADIALVKSKSGTALP* |
| Ga0066691_107866682 | 3300005586 | Soil | GQTKSQSFHPVVQGNFREDVNVDGSINSADIGLVKSKSFTALPP* |
| Ga0066654_104982372 | 3300005587 | Soil | DAVDVSQTKSQSGKAVSGSNFREDVNIDGFIDAVDSAFVKSKSGTSLP* |
| Ga0066654_105016921 | 3300005587 | Soil | IKSQSGKALTISNFREDVNADGFIDAVDTALAKSKSGTAVP* |
| Ga0081539_104231142 | 3300005985 | Tabebuia Heterophylla Rhizosphere | KSQSGAGLTNTNFRADVSVDGNINSVDILYVKSRSGTALP* |
| Ga0066656_107350022 | 3300006034 | Soil | IKSQSGAAVTTTNFREDANIDGFIDAVDVSLVKSKSGTALP* |
| Ga0070712_1017711091 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | DVSQTKSQSGNPVTNANFREDVNVDGFIDAVDTSLVKSKSGTALP* |
| Ga0079222_113524091 | 3300006755 | Agricultural Soil | SQTKSQSGKPVTSSNFREDVNFDGFIDATDTALVKSKSGTALP* |
| Ga0066659_111250783 | 3300006797 | Soil | FTDAIDVSQTKSQSGNAVTNSNFREDVNVDGFIDAIDTSLVKSKSGTALP* |
| Ga0079221_101915142 | 3300006804 | Agricultural Soil | DTSQTKSQSGVPVTNANFREDVNFDGFIDAADTSIVKGKSGTALP* |
| Ga0079221_104772751 | 3300006804 | Agricultural Soil | KSQSGRAVTYENFREDLNADGFIDAVDVSLAKSKSGTALP* |
| Ga0079220_103094711 | 3300006806 | Agricultural Soil | DAADTSQTKSQSGVPVTNANFREDVNFDGFIDAADTSIVKGKSGTALP* |
| Ga0079220_116042891 | 3300006806 | Agricultural Soil | NGDPAVDSADISQTKSQSGRPVTTANFREDLNVDGAIDSADISLVKSKSGSGLH* |
| Ga0075434_1021923741 | 3300006871 | Populus Rhizosphere | VDVAQTKSQSGNAIINTNFREDVNVDGFIDAVDAALVKSKSGTALP* |
| Ga0075426_110434601 | 3300006903 | Populus Rhizosphere | VNSADISQTKSQSGQPVSSTNFREDVNIDGFINSADISLVKSKSGTALP* |
| Ga0075426_115062611 | 3300006903 | Populus Rhizosphere | DTNADKFTDAVDVSQTKSQSGNAVTNSNFREDVNIDGFIDAIDVSLVKSKSGTALP* |
| Ga0079219_105082161 | 3300006954 | Agricultural Soil | SQTKSQSGVPVTNANFREDVNFDGFIDAADTSIVKGKSGTALP* |
| Ga0079219_117819191 | 3300006954 | Agricultural Soil | KSKSGQSVDITNFRNDVGVDDSLNSADIGLVKSKSGTALP* |
| Ga0079219_122931651 | 3300006954 | Agricultural Soil | AIDVSQTKSQSGNPLTNASFREDVNVDGFIDAIDVSLVKSKSGAALP* |
| Ga0079219_125296682 | 3300006954 | Agricultural Soil | DVSQTKSQSGNSLTNTNFREDVNVDGFIDAIDVALVKSKSGTALP* |
| Ga0066710_1008227421 | 3300009012 | Grasslands Soil | NSADIGQTKSQSFHTVVQGNFREDVNADGSINSSDIGLVKSKSFTALPP |
| Ga0066710_1041542222 | 3300009012 | Grasslands Soil | MLESDVRVREVHINSGDIAQTKAQAGAAVSNSNFREDVNADRLVNSADIALAKSKSGTAL |
| Ga0099830_103618052 | 3300009088 | Vadose Zone Soil | DVKQTTSQSGQAVTTSNFREDVTVDGQIDNSDIQKVKSQLGNKLP* |
| Ga0114129_130831061 | 3300009147 | Populus Rhizosphere | NADRFVDSADIAQTKSQSGHTVINDNFREDLNVDGFLDSADIALVKSKSGTALP* |
| Ga0105237_117386521 | 3300009545 | Corn Rhizosphere | DAVDVSQTKSQSGNAVTNSNFREDVNVDGFIDAIDVSLVKSKAGTALP* |
| Ga0134064_102272841 | 3300010325 | Grasslands Soil | TKAQTGIPVTQSNFREDVTVDGNINSSDISVVKSKTGTALPPQ* |
| Ga0134121_108719791 | 3300010401 | Terrestrial Soil | DAVDVSQIKSQSGKPITMPNNNFREDVNVDGFIDAVDASLAKSKSGTSLP* |
| Ga0134121_110242161 | 3300010401 | Terrestrial Soil | QTKSQSGNPVGLNNFREDVNVDGFIDAVDTSLVKSKSGTALP* |
| Ga0137393_105144171 | 3300011271 | Vadose Zone Soil | NKDVKQTTSQSGQAVTTSNFREDVTVDGQIDNSDIQKVKSQLGNKLP* |
| Ga0137364_103880091 | 3300012198 | Vadose Zone Soil | SGNRVTSSNFRKDLNADGFIDSADIGLVKSKSGTGLP* |
| Ga0137382_107134292 | 3300012200 | Vadose Zone Soil | IADTNADRFCDAVDVSQTKSQSGNAVTNANFREDVNVDGFIDAVDVSLVKSKSGTALP* |
| Ga0137360_115245772 | 3300012361 | Vadose Zone Soil | GDTNADRFCDAVDVSQTKSQSGNPVTNANFREDVNVDGFIDVVDTSLVKSKSGTALP* |
| Ga0137360_115279722 | 3300012361 | Vadose Zone Soil | DVSQTKSQSGNAVSNTNFREDVNVDGFTDAVDVSLVKSKSGTALPPMP* |
| Ga0137358_109381122 | 3300012582 | Vadose Zone Soil | DVSQTKSQSGHALATFNFREDLNADGFIDAVDVSLAKSKSGTALP* |
| Ga0137413_112306001 | 3300012924 | Vadose Zone Soil | DIAQTKSQSGKPVTSTNFREDLNVDGFLDSADIGFVKSKSGTALP* |
| Ga0137404_106396441 | 3300012929 | Vadose Zone Soil | LVSAKSQSGVAVASSNFAEELNADGSINSGDIALAKSTSATALS* |
| Ga0157372_106072863 | 3300013307 | Corn Rhizosphere | DSFTDAIDVSQTKSQSGNVVGNSNFREDVNVDGFIDAIDTSLVKSKSGTALP* |
| Ga0167653_10773121 | 3300015162 | Glacier Forefield Soil | GFVNSGDIAQTKSQSGVALTNENFREDLNADGSINSGDIALVKSKSGTALP* |
| Ga0137403_107082542 | 3300015264 | Vadose Zone Soil | FVDSADIAQTKSQSGHAVTNSNFREDVNEDGFLDSADIGLVKSKSGTALP* |
| Ga0066662_107791011 | 3300018468 | Grasslands Soil | SQTKSQSGNAITNSNFREDVNTDGFIDSIDVSLIKSKSGTALP |
| Ga0066662_122310351 | 3300018468 | Grasslands Soil | DRFTDAIDVSQTKSQSGNAVTNSNFREDVNVDGFIDAIDTSLVKSKSGTALP |
| Ga0190273_109142801 | 3300018920 | Soil | DKFVNSGDIAQTKSQSGIAITASNFREDIDADGSINSGDIALVKSKSGTALP |
| Ga0193728_10944411 | 3300019890 | Soil | SQSGSNTTVSNFREDLNEDGFLDSADIAFVKSKSGTALP |
| Ga0210402_119761431 | 3300021478 | Soil | NADRFCDAVDVSQTKSQSGNAVTASNFREDVNVDGFIDAVDASLVKSKSGTSLP |
| Ga0210409_112445941 | 3300021559 | Soil | TNHDGFVNSADISQTKSQSGQAVGLSNFREDVTADGFLNSADISLVKSKSGTALPSVP |
| Ga0207684_103249691 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | QTKSQSGKTFSLTNFREDINRDSFIDSADISFVKSKSGTALPESP |
| Ga0207684_108848531 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VIGDATEDGSVNVADLGQTESQSGHAVTSSNFREDVNVDGSINVADIGLMKSKSGTPLP |
| Ga0207687_100509414 | 3300025927 | Miscanthus Rhizosphere | VKSESGHVVGSANYREDLTTDGFLDSSDIGLVKSRSGNTLSAQTSTTA |
| Ga0207664_100427663 | 3300025929 | Agricultural Soil | DTNADGFVNSADIGETKSQSGSAIDSSNFREDLNTDGLLNSADIGLVKSKSGTALP |
| Ga0207664_105448942 | 3300025929 | Agricultural Soil | AQSGTAATGSNFREDLNTDGLVNSADITLVKSKSGTGLPEAP |
| Ga0207665_106136393 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | CDAIDVSQTKSQSGHAVTGSNFREDVNVDGFIDAVDTALVKSKSGTALP |
| Ga0207665_115992931 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LTGDTNADRFCDAVDVSQTKSQSGNAVTGSNFREDVNVDGFIDAVDTSVVKSKSGTALPS |
| Ga0207665_116417262 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | QSGQALSGLNFREDVNTDGFIDSADIVFVKSKSGTALP |
| Ga0209238_12205562 | 3300026301 | Grasslands Soil | ADRFVDSADIAQTKSQSGHAVTGSNFREDVNVDGFIDSADIALVKSKSGTALQ |
| Ga0209155_10537023 | 3300026316 | Soil | GDTSADHFVDSADIAQTKSKSGQGLTSANYREDLNFDGFLDSADISLVKSKSGTTLP |
| Ga0209376_12412181 | 3300026540 | Soil | SVNSADISQTKAQSGHVVGSGNFREDVTVDGSLNSADISTVKSKSGTALPTAP |
| Ga0209648_104697711 | 3300026551 | Grasslands Soil | ADISQTKSQSGQAVGGSNFREDVNTDGFLNSADISLVKSKSGTALP |
| Ga0209577_103948353 | 3300026552 | Soil | LGDTNADRFVDSADIGQTKSQSGNPVTSANFREDLNVDGFLDSADIGLVKSKSGTALP |
| Ga0209488_102885403 | 3300027903 | Vadose Zone Soil | FDHFVDSADISQTKSQSGKPVTASNYREDLNADGFIDSADIGLVKSKSGDTLP |
| Ga0209006_106229981 | 3300027908 | Forest Soil | VDVSQTKSQSGNALTTSNFREDVNVDGFIDAVDTSLVKSKSGTALP |
| Ga0307478_100267791 | 3300031823 | Hardwood Forest Soil | ADISQTKSQSGNVVTNSNFREDVNTDGFLNSGDISLVKSKSGTALP |
| Ga0307478_100333603 | 3300031823 | Hardwood Forest Soil | ADISQTKAQSGNTVTNSNFREDVNADGFHNSADISLTKAKSGVASLPGAP |
| Ga0307478_101124851 | 3300031823 | Hardwood Forest Soil | FVNSADISQTKSQSGQAVTSSNFREDVNADGFLNSADISLVKSQSGTALP |
| Ga0307478_102950961 | 3300031823 | Hardwood Forest Soil | DISQTKSQSGQAVTSSNFREDVNADGFLNSADISLVKSTSGTALP |
| Ga0307478_104644732 | 3300031823 | Hardwood Forest Soil | ISQTKAQSGQTVGASNFREDVNADGFLNSADISLTKSKSGTALPSTP |
| Ga0307479_118705571 | 3300031962 | Hardwood Forest Soil | MDADGHQHKSQTKSQSGQLAGARNFRQDVNADGFLDSADISLVKSKSGTALPTLP |
| Ga0307479_119992531 | 3300031962 | Hardwood Forest Soil | ISQTKSQSGNAVTNANFREDVNADGFINSADISLVKSKSGTGLP |
| Ga0307479_121454161 | 3300031962 | Hardwood Forest Soil | SADISQTKSQSGQTVRGSNFREDVNTDGFLNSADISLVKSKSGTALP |
| Ga0307471_1016071612 | 3300032180 | Hardwood Forest Soil | DRFCDAIDVSQTKSQSGKAVTNDNFREDVNVDGFIDAVDTALTKSKSGTALQ |
| Ga0307471_1023963342 | 3300032180 | Hardwood Forest Soil | KSQSGIAVSSSNFREDLNADGFIDSADITQAKSKSGTALP |
| ⦗Top⦘ |