NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F103632

Metagenome / Metatranscriptome Family F103632

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F103632
Family Type Metagenome / Metatranscriptome
Number of Sequences 101
Average Sequence Length 46 residues
Representative Sequence MREERLEVSVTFDERGYIGSAPELRQAVVALSLGGLRRKIEIAMLP
Number of Associated Samples 84
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 48.48 %
% of genes near scaffold ends (potentially truncated) 91.09 %
% of genes from short scaffolds (< 2000 bps) 94.06 %
Associated GOLD sequencing projects 79
AlphaFold2 3D model prediction Yes
3D model pTM-score0.71

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (53.465 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(25.743 % of family members)
Environment Ontology (ENVO) Unclassified
(32.673 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(38.614 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 18.92%    β-sheet: 17.57%    Coil/Unstructured: 63.51%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.71
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
d.304.1.1: TTHA1013-liked1wv8a11wv80.73918
d.50.1.1: Double-stranded RNA-binding domain (dsRBD)d2dixa12dix0.7145
e.3.1.0: automated matchesd5zqaa_5zqa0.70182
c.51.4.1: ITPase (Ham1)d1k7ka11k7k0.69214
d.204.1.0: automated matchesd3tqma_3tqm0.69099


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF04392ABC_sub_bind 17.82
PF03401TctC 1.98
PF00890FAD_binding_2 1.98
PF00027cNMP_binding 0.99
PF01266DAO 0.99
PF00816Histone_HNS 0.99
PF08495FIST 0.99
PF09584Phageshock_PspD 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 17.82
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 1.98
COG2916DNA-binding protein H-NSTranscription [K] 0.99
COG3287FIST domain protein MJ1623, contains FIST_N and FIST_C domainsSignal transduction mechanisms [T] 0.99
COG4398Small ligand-binding sensory domain FISTSignal transduction mechanisms [T] 0.99


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A53.47 %
All OrganismsrootAll Organisms46.53 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_110166535All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1651Open in IMG/M
3300005334|Ga0068869_100402794All Organisms → cellular organisms → Bacteria1126Open in IMG/M
3300005365|Ga0070688_101553013All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria539Open in IMG/M
3300005366|Ga0070659_100053995All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium3164Open in IMG/M
3300005366|Ga0070659_102116329Not Available506Open in IMG/M
3300005559|Ga0066700_10824527All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria623Open in IMG/M
3300005564|Ga0070664_102196346All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria524Open in IMG/M
3300005719|Ga0068861_100346378Not Available1302Open in IMG/M
3300006175|Ga0070712_101797414All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300007076|Ga0075435_101143883All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi681Open in IMG/M
3300009137|Ga0066709_100394860All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1917Open in IMG/M
3300009174|Ga0105241_12598621All Organisms → cellular organisms → Bacteria → Proteobacteria508Open in IMG/M
3300009553|Ga0105249_10397525Not Available1408Open in IMG/M
3300009553|Ga0105249_10408514Not Available1389Open in IMG/M
3300010397|Ga0134124_10235755All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1677Open in IMG/M
3300010399|Ga0134127_11853314Not Available680Open in IMG/M
3300012203|Ga0137399_11713918All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300012207|Ga0137381_11506840All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria564Open in IMG/M
3300012351|Ga0137386_10888210Not Available639Open in IMG/M
3300012355|Ga0137369_10399075Not Available992Open in IMG/M
3300012356|Ga0137371_10466355Not Available976Open in IMG/M
3300012469|Ga0150984_103041530All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300012469|Ga0150984_119656015All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300012469|Ga0150984_119945218All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2482Open in IMG/M
3300012517|Ga0157354_1059136Not Available572Open in IMG/M
3300012685|Ga0137397_10492965All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria913Open in IMG/M
3300012929|Ga0137404_10661590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria943Open in IMG/M
3300012988|Ga0164306_11014627All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium684Open in IMG/M
3300012989|Ga0164305_10804122Not Available780Open in IMG/M
3300013105|Ga0157369_11986561All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium590Open in IMG/M
3300013308|Ga0157375_13271229Not Available540Open in IMG/M
3300015374|Ga0132255_102934079Not Available729Open in IMG/M
3300016270|Ga0182036_10650168Not Available849Open in IMG/M
3300016319|Ga0182033_10939714All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300016341|Ga0182035_11649121Not Available579Open in IMG/M
3300016341|Ga0182035_12012161All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria525Open in IMG/M
3300016371|Ga0182034_10545353Not Available973Open in IMG/M
3300016422|Ga0182039_11674081Not Available582Open in IMG/M
3300016445|Ga0182038_10239174Not Available1453Open in IMG/M
3300018027|Ga0184605_10244278Not Available816Open in IMG/M
3300018028|Ga0184608_10153816Not Available992Open in IMG/M
3300018051|Ga0184620_10206367Not Available655Open in IMG/M
3300018067|Ga0184611_1051835Not Available1369Open in IMG/M
3300018078|Ga0184612_10354440All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium744Open in IMG/M
3300018433|Ga0066667_11059436All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300018469|Ga0190270_10702344All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1003Open in IMG/M
3300018469|Ga0190270_11575350Not Available708Open in IMG/M
3300018469|Ga0190270_11626041All Organisms → cellular organisms → Bacteria → Proteobacteria698Open in IMG/M
3300018476|Ga0190274_12454855Not Available618Open in IMG/M
3300019882|Ga0193713_1084117All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales894Open in IMG/M
3300019890|Ga0193728_1125501All Organisms → cellular organisms → Bacteria1158Open in IMG/M
3300020004|Ga0193755_1205783Not Available558Open in IMG/M
3300020005|Ga0193697_1152517Not Available511Open in IMG/M
3300020016|Ga0193696_1093234Not Available777Open in IMG/M
3300025932|Ga0207690_10639821Not Available871Open in IMG/M
3300025932|Ga0207690_10743530All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria808Open in IMG/M
3300026067|Ga0207678_10409604Not Available1175Open in IMG/M
3300028704|Ga0307321_1108238Not Available569Open in IMG/M
3300028708|Ga0307295_10143788Not Available660Open in IMG/M
3300028711|Ga0307293_10126229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia813Open in IMG/M
3300028712|Ga0307285_10125117All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae692Open in IMG/M
3300028712|Ga0307285_10129508Not Available682Open in IMG/M
3300028715|Ga0307313_10004737All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3198Open in IMG/M
3300028715|Ga0307313_10022497All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1725Open in IMG/M
3300028718|Ga0307307_10176017Not Available673Open in IMG/M
3300028720|Ga0307317_10126582All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300028722|Ga0307319_10041379All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1438Open in IMG/M
3300028771|Ga0307320_10075924All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi1260Open in IMG/M
3300028791|Ga0307290_10222847All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria691Open in IMG/M
3300028793|Ga0307299_10077098All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi1238Open in IMG/M
3300028884|Ga0307308_10006222All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium5170Open in IMG/M
3300031091|Ga0308201_10310652All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7565Open in IMG/M
3300031546|Ga0318538_10480152Not Available673Open in IMG/M
3300031720|Ga0307469_11576058All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium630Open in IMG/M
3300031744|Ga0306918_11200937Not Available585Open in IMG/M
3300031744|Ga0306918_11493435Not Available516Open in IMG/M
3300031763|Ga0318537_10119137Not Available980Open in IMG/M
3300031768|Ga0318509_10197533Not Available1118Open in IMG/M
3300031780|Ga0318508_1091047Not Available841Open in IMG/M
3300031780|Ga0318508_1205267Not Available565Open in IMG/M
3300031845|Ga0318511_10489814Not Available568Open in IMG/M
3300031847|Ga0310907_10739087Not Available547Open in IMG/M
3300031890|Ga0306925_10757117All Organisms → cellular organisms → Bacteria1011Open in IMG/M
3300031890|Ga0306925_10820407All Organisms → cellular organisms → Bacteria963Open in IMG/M
3300031890|Ga0306925_11546273All Organisms → cellular organisms → Bacteria → Proteobacteria647Open in IMG/M
3300031910|Ga0306923_10625702All Organisms → cellular organisms → Bacteria1205Open in IMG/M
3300031942|Ga0310916_11505377Not Available548Open in IMG/M
3300031945|Ga0310913_11026244Not Available577Open in IMG/M
3300031946|Ga0310910_10821210Not Available731Open in IMG/M
3300031947|Ga0310909_10574688Not Available942Open in IMG/M
3300032025|Ga0318507_10366812Not Available627Open in IMG/M
3300032039|Ga0318559_10395451All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300032060|Ga0318505_10230867Not Available869Open in IMG/M
3300032060|Ga0318505_10509830Not Available567Open in IMG/M
3300032065|Ga0318513_10114021Not Available1272Open in IMG/M
3300032076|Ga0306924_11589709Not Available689Open in IMG/M
3300032261|Ga0306920_101936665Not Available827Open in IMG/M
3300032261|Ga0306920_102958070All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria642Open in IMG/M
3300032261|Ga0306920_103151546Not Available618Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil25.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil16.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.84%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere5.94%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.95%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere2.97%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.98%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.98%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.99%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.99%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.99%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.99%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.99%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.99%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.99%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.99%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012517Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610EnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028704Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379EnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300031091Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_11016653543300000956SoilDRLEVSVSFDEGRGYVATAAELRQPVMALSLGGLRRKIEIALLQRRDKAL*
Ga0068869_10040279413300005334Miscanthus RhizosphereMPDDRLEVSVTFDERGYIGSAPELRQAVVALSLGLRRKIEIAMLPDDVRVVL
Ga0070688_10155301313300005365Switchgrass RhizosphereMREERLEVSVTFDERGYIGSAPELRQAVVALSLGGLRRKIEIAMLP
Ga0070659_10005399543300005366Corn RhizosphereMREERLEVSVTFDERHGYIASEPERRSAVVALSLGGLRRKIEI
Ga0070659_10211632923300005366Corn RhizosphereVVMSGDRLEVNVTCDERGYVGSAPELRSAVVALSLGGLRR
Ga0066700_1082452723300005559SoilMRDERLEVSVTFVPAKGYVASAPELRQPVVAVSLGGLRRRIEALMLPDSV
Ga0070664_10219634623300005564Corn RhizosphereMREERLEVSVTFDERHGYIASEPELRSAVVALSLGGLRRKIEIAMLPD
Ga0068861_10034637833300005719Switchgrass RhizosphereMSGDRLEVNVTCDERGYVGSAPELRSAVVALSLGGLRRKIEIAMLPDDV
Ga0081455_1006473043300005937Tabebuia Heterophylla RhizosphereMRDERLEVSVTFDERRGYVGTAPDLRAPVVALSLGGCGARSRR*
Ga0070712_10179741423300006175Corn, Switchgrass And Miscanthus RhizosphereMREERLEVSVTFDPAKGYIGTAAELRQPVTALSLGGLRRRIEGLMLPDEV
Ga0075435_10114388313300007076Populus RhizosphereMREERLEVSVTFDARHGYVASAPELRSAVVALSLGGLRRKIEIAM
Ga0066709_10039486013300009137Grasslands SoilMRDERLEVSVTFVPAKGYVASAPELRQPVVAVSLGGLRRR
Ga0105241_1259862113300009174Corn RhizosphereMREERFEVSVTFDERHGYVASAPELRSAVVALSLGGLRRKIEIAMLPDDVRVVLQL
Ga0105249_1039752513300009553Switchgrass RhizosphereMSGDRLEVNVTFDERGYIGSAPELRQAVVALSLGGLRRKIEIAMLPDDVR
Ga0105249_1040851433300009553Switchgrass RhizosphereLERLEESVTFDERHGYVASAPELRSPVMALSPGGLRRKIEVLMVPR*
Ga0134124_1023575533300010397Terrestrial SoilMPDERLEVSVTFDERGYIGSAPELRQAVVALSLGGL
Ga0134127_1185331423300010399Terrestrial SoilMSGDRLEVNVTFDERGYIGSAPELRQAVVALSLGGLR
Ga0137399_1171391823300012203Vadose Zone SoilMRDERFEVTVTFDERRGYIGSAPELRSPVVALSLGGMRRRIEALM
Ga0137381_1150684013300012207Vadose Zone SoilMRDERLEVSVTFDERRGYVATAPELRAPVTALSLGGLR
Ga0137386_1088821023300012351Vadose Zone SoilMSGDRLEVSVSFDERCGYFGSHPELRSPVVALSLGGLRRKIETLMLPDDVHVVLHLD
Ga0137369_1039907513300012355Vadose Zone SoilVSVTFDPAKGYAATAPEQREPVLALSLGGVRRRVEALLLPDDLHVVLQLDV
Ga0137371_1046635513300012356Vadose Zone SoilMSGDRLEVSVTFDAERGYIGSAPELRTPVTALSLGGLRRRIEALMIPDDV
Ga0150984_10304153023300012469Avena Fatua RhizosphereMPDKRLEVSVTFDQRGYIGSAPELRSAVVALSLGGLRRKIEALLLPAEV
Ga0150984_11965601523300012469Avena Fatua RhizosphereMPDERLEVSVTFDERGYIGSAPELRQAVVALSLGGLRRKIEIAMLPDDVRVVLQL
Ga0150984_11994521813300012469Avena Fatua RhizosphereMREERLEVSVTFDERHGYIGSAPELRSAMVALSLGG
Ga0157354_105913613300012517Unplanted SoilMREELLEVSVTFDERGYIGSAPELRQAVVALGLGVLRRKIEIAMFA*
Ga0137397_1049296523300012685Vadose Zone SoilVEVSVTFDERGYIGSAPELRSAVVALSLGGLRRKIEIALLLPAEVGIVL
Ga0137404_1066159013300012929Vadose Zone SoilMMGADRFEVSVTFDQRRGGYVGTAPELKAPVVALSLGGLRRRIE
Ga0164306_1101462713300012988SoilMREARLEVSVTFDERHGYVGSAAELRSPVMALSLGGLRRKIEVL
Ga0164305_1080412223300012989SoilMAITVRGGDVNVTLDERGYIGSAPELRQPVVALSLGGLRHKIEALLLP
Ga0157369_1198656123300013105Corn RhizosphereMREERLEVGVTFDERGYIGSAPELRQAVVALSLGGLRR
Ga0157375_1327122913300013308Miscanthus RhizosphereLAKLDVTVTYDARHGYIATALELRQPVVALSLGGLRRRIEALMV
Ga0132255_10293407913300015374Arabidopsis RhizosphereMSGDRLEVNVTFDERGYVGSAPELRSAVVALSLGGLRRKIEIAMLPDDVR
Ga0182036_1065016813300016270SoilSVTFDAAKGYVATAAELRQPVVALSLGGLRRRIGDAA
Ga0182033_1093971413300016319SoilLLRRWPQRGSIMASEDRLTVAVTYDESRGYVGSAPELRQPVVALSLGGLRRKVEIAMLPD
Ga0182035_1164912123300016341SoilMASEDRLTVGVTYDESRGYVGSAPELRQPVVALSLGG
Ga0182035_1201216113300016341SoilMASEDRLTVAVTYDESRGYVGSAPELRQPVVALSLGGLR
Ga0182034_1054535343300016371SoilMASEDRLTVAVTYDESRGYVGSAPELRQPVVALSLGGLRRKVEIAMLPDEVVVLL
Ga0182039_1167408113300016422SoilMASEDRLTVAVTYDESRGYVGSAPELRQPVVALSLGGLRRKVEIAMLPDEVV
Ga0182038_1023917413300016445SoilMRLDVTVTYAAERGYVASAPELRQPIVALSLGGLRRRIEIALLPDDVDVQL
Ga0184605_1024427823300018027Groundwater SedimentMSGDRFEVNVTFDAAHGYVASAPELRQPVVALSLGGLRRRIEI
Ga0184608_1015381643300018028Groundwater SedimentMSADRLDVTVTYDASCGYIGSVPGLNAPVVALSLGG
Ga0184620_1020636713300018051Groundwater SedimentMTDAACGVTVTYEAGHGYITTALELRQPVVALSLGGLRRRIEA
Ga0184611_105183513300018067Groundwater SedimentSVTFDERHGYVASAPELRTAVVALSLGGLRRKIEALLEEEEPVPVLSELGPP
Ga0184612_1035444013300018078Groundwater SedimentMPDERLEVSVTFDERGYIGSAPELRSSVVALSLGGLRRKIE
Ga0066667_1105943623300018433Grasslands SoilMRDERLEVSVTFVPAKGYVASAPELRQPVVAVSLGGLRR
Ga0190270_1070234423300018469SoilMPDGRLEVSVTFDERGYIGSAPELRQAVVALSLGGLRRKIEIAML
Ga0190270_1157535023300018469SoilMTRLSVDVSFDPAHGYVGTAPELRTAVRALSLNGLRKQIEDHPPSVA
Ga0190270_1162604123300018469SoilMSGDRLEVNVTFDERGYIGSAPELRWPVMALSLGGLRRKIE
Ga0190274_1245485513300018476SoilMSGDKLEIKVTFEERGYIGSAPELRQAVVALSLGGLRRKIEIAMLPDDV
Ga0193713_108411713300019882SoilMREERLEVSVTFDERHGYVASAPELRWPVVALSLGGLRRKI
Ga0193728_112550123300019890SoilMREERLEVSVTFDERHGYVASAPELRTAVVALSLGGLRRKIEALLLP
Ga0193755_120578313300020004SoilMSGDRLEVNVTFDERGYIGSAPELRQLVVALSLGGLRRKIEALMVPD
Ga0193697_115251723300020005SoilMPEERLEVSVTFDARHGYVASAPELRSVVVALSLGGLRRKIEIAMLPDDVRVVLQL
Ga0193696_109323423300020016SoilMSGDRLEVNVTFDERGYIGSAPELRWPVMALSLGGLRRKIEALMMPDEVRVMLQL
Ga0207690_1063982113300025932Corn RhizosphereMSGNRLDVTVTYDAQHGYIASAPELRQPVVALSLGGLRRRIE
Ga0207690_1074353033300025932Corn RhizosphereMREERLEVSVTFDERGYIGSAPELRWPVTALSLGGLRRKIEIAMLPDDVRVV
Ga0207678_1040960423300026067Corn RhizosphereMSGDRLEVNVTCDERGYVGSAPELRSAVVALSLGGLRRKIEIAMLPDDVRVVLQLD
Ga0307321_110823823300028704SoilMSGDRLEVNVTFDERGYIGSAPELRSSAMALSLGGLRRKIEIAMLPDDVRV
Ga0307295_1014378823300028708SoilMSGDRLEVNVTFDERGYIGSAPELRQAVVALSLGGLRR
Ga0307293_1012622923300028711SoilMSGDRLEVNVTFDERGYIGSAPELRSSAMALSLGGLRRKIEIAM
Ga0307285_1012511713300028712SoilLEVSVTFDERHGYIASAPELRTAVVALSLGGLRRKTPWWR
Ga0307285_1012950823300028712SoilMSGKRLEVTVSYDAERGYVASAPELRQPVTALSLGDLRRRIEALMLPDDPVI
Ga0307313_1000473733300028715SoilMREERLEVSVTFDERHGYIASAPELRTAVVALSLGGLRRKTPWWR
Ga0307313_1002249733300028715SoilMPDERLEVSVTFDERGYIGSAPELRQAVVALSLGGLR
Ga0307307_1017601713300028718SoilMSGDRFEENVTFDAAHGYVASAPELRQPVVALSLGGLRRRIEI
Ga0307317_1012658213300028720SoilMREERLEVSVTFDERHGYVASAPELRTAVVALSLGGLRRKIEALLLPAEVE
Ga0307319_1004137933300028722SoilMRDERLEVSVTFDERRGYIGSAAELRSPVVALRLGGLRRKVEIALLP
Ga0307320_1007592423300028771SoilMREERLEVSVTFDERHGYIGSAPELRSAVVALSLGGLRR
Ga0307290_1022284723300028791SoilMREERLEVSVTFDERHGYVASAPELRSAVVALSLGGLRRRIEIAMLPDNVRVVLH
Ga0307299_1007709823300028793SoilMREERLEVSVTFDERHGYVASAPELRSAVVALSLG
Ga0307308_10006222103300028884SoilMSGDRLEVNVTFDERGYIGSAPELRQLVVALSLGGLRRKIEALMVPDEPIVVLQ
Ga0308201_1031065213300031091SoilMREERVEVSVTFDERHGYIGSAPELRSSVTALSLGGLRRKIE
Ga0318538_1048015213300031546SoilMASEDRLTVAVTYDESRGYVGSAPELRQPVVALSLGGLRRKVEIAMLPDEVVVL
Ga0307469_1157605823300031720Hardwood Forest SoilMPDERLEVSVTFDERGYIGSAPELRQAVVALSLGGLRRKIEI
Ga0306918_1120093713300031744SoilMASEDRLTVAVTYDESRGYVGSAPELRQPAVALSLGGLRRKVEIA
Ga0306918_1149343523300031744SoilMASEDRLTVAVTYDESRGYVGSAPELRQPVVALSLGGLRRKVEIAM
Ga0318537_1011913713300031763SoilMASEHRLTVAVTYDESRGYVGSAPELRQPVVALSLGGLRRKVEIAM
Ga0318509_1019753343300031768SoilMASEDRLTVAVTYDESRGYVGSAPELRQPVVALSLGGLRRKVDGVPRRGD
Ga0318521_1006813453300031770SoilMRLDVTVTYAAERGYVASAPELRQPIVALSLGGLRRRIEIALLPDDVDVQLLLDGH
Ga0318508_109104713300031780SoilMASEHRLTVAVTYDESRGYVGSAPELRQPVVALSLGGLRRKIEIAMLPDEVVVLLSLD
Ga0318508_120526723300031780SoilMSKGGRFEVAVTFEERRGYVGSAPELCQPVVALSLGGLRRKVEIAMLPDDVIVTLNL
Ga0318511_1048981413300031845SoilMASEDRLTVAVTYDESRGYVGSAPELRQPVVALSLGGLRRKVEIAMLPDEAVVLLSL
Ga0310907_1073908713300031847SoilMRDERLEVSVTFDERHGYIASAAELRRAVVALSLGGLRRKDRDRDAA
Ga0306925_1075711723300031890SoilMASEDRLTVAVTYDESRGYVGSASELRQPVVALSLGGLRRKVEIAMLPDEVVVLLSLDRTARLER
Ga0306925_1082040713300031890SoilMASEDRLTVAVTYDESRGYVGSAPELRQPAVALSLGGLRRKVEIAMLPD
Ga0306925_1154627323300031890SoilMASEDRLTVAVTYDESRGYVGSAPELRQPVVALSLGGLRRKVEIAML
Ga0306923_1062570233300031910SoilMASEDRLTVAVTYDESRGYVGSAPELRQPAVALSLGGLRRKVEIAMLP
Ga0310916_1150537733300031942SoilMASEDRLTVGVTYDESRGYVGSAPELRQPVVALSLGGLRRKVEIAMLPDE
Ga0310913_1102624413300031945SoilMASEDRLTVAVTYDESRGYVGSAPELRQPVVALSLGGLRRKVEIAMLPD
Ga0310910_1082121033300031946SoilMASEDRLTVAVTYDESRGYVGSAPELRQPAVALSLGGLRRKVEIAMLPDEVVVLLS
Ga0310909_1057468833300031947SoilMASEDRLTVAVTYDESRGYVGSAPELRQPVVALSLGGLRRKVEI
Ga0318507_1036681213300032025SoilMASEDRLTVAVTYDESRGYVGSAPELRQPVVALSL
Ga0318559_1039545113300032039SoilMASEDRLTVAVTYDESRGYVGSAPELRQPVVALSLGGLRR
Ga0318505_1023086713300032060SoilMASEDRLTVAVTYDESRGYVGSAPELRQPVVALSLGGL
Ga0318505_1050983013300032060SoilMSKGGRFEVAVTFEERRGYVGSAPALCQPVVALSLGGLRRKVEIAMLPDDVIVTL
Ga0318513_1011402113300032065SoilMASEHRLTVAVTYDESRGYVGSAPELRQPVVALSLGGLRRKIEIAMLPDEVVVLL
Ga0306924_1158970913300032076SoilMSKGGRFEVAVTFEERRGYVGSAPELCQPVVALSLGGLRRKVEIAMLRDDVIVTLNLDRA
Ga0306920_10193666513300032261SoilMASEDRLTVAVTYDESRGYVGSAPELRQPVVALSLGGLRRKVEIAMLPDE
Ga0306920_10295807033300032261SoilMASEHRLTVAVTYDESRGYVGSAPELRQPVVALSLG
Ga0306920_10315154633300032261SoilMASEDRLTVAVTYDESRGYVGSAPELRQPVVALSLGGLRRK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.