| Basic Information | |
|---|---|
| Family ID | F103615 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MGKRREPRKEIRVPVRIFGTDSSGQIFSEKVFTVNVSQQ |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 93.07 % |
| % of genes near scaffold ends (potentially truncated) | 99.01 % |
| % of genes from short scaffolds (< 2000 bps) | 87.13 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.218 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.871 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.743 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.426 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 20.90% Coil/Unstructured: 79.10% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF00483 | NTP_transferase | 15.84 |
| PF11746 | DUF3303 | 5.94 |
| PF07238 | PilZ | 2.97 |
| PF03461 | TRCF | 1.98 |
| PF00990 | GGDEF | 1.98 |
| PF16576 | HlyD_D23 | 0.99 |
| PF03144 | GTP_EFTU_D2 | 0.99 |
| PF00383 | dCMP_cyt_deam_1 | 0.99 |
| PF12706 | Lactamase_B_2 | 0.99 |
| PF02082 | Rrf2 | 0.99 |
| PF12680 | SnoaL_2 | 0.99 |
| PF01869 | BcrAD_BadFG | 0.99 |
| PF14698 | ASL_C2 | 0.99 |
| PF11737 | DUF3300 | 0.99 |
| PF07690 | MFS_1 | 0.99 |
| PF00072 | Response_reg | 0.99 |
| PF00248 | Aldo_ket_red | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG1197 | Transcription-repair coupling factor (superfamily II helicase) | Transcription [K] | 3.96 |
| COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 0.99 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.99 |
| COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 0.99 |
| COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 0.99 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.99 |
| COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.99 |
| COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 0.99 |
| COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.21 % |
| Unclassified | root | N/A | 20.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_101605279 | Not Available | 548 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10107837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1111 | Open in IMG/M |
| 3300004092|Ga0062389_102863174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300004152|Ga0062386_100492564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 995 | Open in IMG/M |
| 3300004635|Ga0062388_101135263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 769 | Open in IMG/M |
| 3300005187|Ga0066675_11408714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 511 | Open in IMG/M |
| 3300005602|Ga0070762_10118382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1553 | Open in IMG/M |
| 3300006176|Ga0070765_100238904 | All Organisms → cellular organisms → Bacteria | 1662 | Open in IMG/M |
| 3300009521|Ga0116222_1017639 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3261 | Open in IMG/M |
| 3300009523|Ga0116221_1070867 | All Organisms → cellular organisms → Bacteria | 1575 | Open in IMG/M |
| 3300009631|Ga0116115_1089334 | Not Available | 794 | Open in IMG/M |
| 3300009638|Ga0116113_1149829 | Not Available | 584 | Open in IMG/M |
| 3300009641|Ga0116120_1114982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 881 | Open in IMG/M |
| 3300009645|Ga0116106_1046846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1449 | Open in IMG/M |
| 3300009672|Ga0116215_1538678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300010339|Ga0074046_10159362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1436 | Open in IMG/M |
| 3300010339|Ga0074046_10388119 | Not Available | 845 | Open in IMG/M |
| 3300010343|Ga0074044_10700382 | Not Available | 661 | Open in IMG/M |
| 3300010379|Ga0136449_100008519 | All Organisms → cellular organisms → Bacteria | 28941 | Open in IMG/M |
| 3300014159|Ga0181530_10013800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6699 | Open in IMG/M |
| 3300014159|Ga0181530_10064515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2316 | Open in IMG/M |
| 3300014199|Ga0181535_10487738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 714 | Open in IMG/M |
| 3300014199|Ga0181535_10833953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 521 | Open in IMG/M |
| 3300014654|Ga0181525_10210930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1060 | Open in IMG/M |
| 3300016319|Ga0182033_11861891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300016341|Ga0182035_10597003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 954 | Open in IMG/M |
| 3300017928|Ga0187806_1285342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300017940|Ga0187853_10546006 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300017947|Ga0187785_10059688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1449 | Open in IMG/M |
| 3300017955|Ga0187817_10301145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1022 | Open in IMG/M |
| 3300017972|Ga0187781_10919211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300018012|Ga0187810_10098466 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300018024|Ga0187881_10007000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7979 | Open in IMG/M |
| 3300018030|Ga0187869_10478125 | Not Available | 592 | Open in IMG/M |
| 3300018046|Ga0187851_10737908 | Not Available | 554 | Open in IMG/M |
| 3300018047|Ga0187859_10002901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 10579 | Open in IMG/M |
| 3300018047|Ga0187859_10111969 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1438 | Open in IMG/M |
| 3300018047|Ga0187859_10555025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 644 | Open in IMG/M |
| 3300018482|Ga0066669_12027668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300019785|Ga0182022_1298522 | All Organisms → cellular organisms → Bacteria | 1961 | Open in IMG/M |
| 3300019879|Ga0193723_1049154 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1241 | Open in IMG/M |
| 3300020582|Ga0210395_10385998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1054 | Open in IMG/M |
| 3300020583|Ga0210401_10495707 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1084 | Open in IMG/M |
| 3300020583|Ga0210401_10874857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300021180|Ga0210396_10044067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4100 | Open in IMG/M |
| 3300021180|Ga0210396_10209604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1739 | Open in IMG/M |
| 3300021401|Ga0210393_11572629 | Not Available | 522 | Open in IMG/M |
| 3300021402|Ga0210385_10236327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1339 | Open in IMG/M |
| 3300021406|Ga0210386_10760001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
| 3300021407|Ga0210383_10427458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1143 | Open in IMG/M |
| 3300021432|Ga0210384_10479989 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1119 | Open in IMG/M |
| 3300021475|Ga0210392_10733706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300021478|Ga0210402_10762628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 892 | Open in IMG/M |
| 3300022724|Ga0242665_10093281 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300025460|Ga0208562_1051272 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300025507|Ga0208188_1064104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 889 | Open in IMG/M |
| 3300026296|Ga0209235_1146068 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 950 | Open in IMG/M |
| 3300027072|Ga0208238_1010635 | Not Available | 775 | Open in IMG/M |
| 3300027565|Ga0209219_1085260 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
| 3300027635|Ga0209625_1153400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 514 | Open in IMG/M |
| 3300027652|Ga0209007_1178182 | Not Available | 523 | Open in IMG/M |
| 3300027692|Ga0209530_1054352 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha → Rhabditoidea → Rhabditidae → Rhabditidae incertae sedis → Diploscapter → Diploscapter pachys | 1168 | Open in IMG/M |
| 3300027696|Ga0208696_1074956 | Not Available | 1148 | Open in IMG/M |
| 3300027812|Ga0209656_10296658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
| 3300027853|Ga0209274_10579145 | Not Available | 581 | Open in IMG/M |
| 3300027867|Ga0209167_10515278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300027879|Ga0209169_10547090 | Not Available | 607 | Open in IMG/M |
| 3300028565|Ga0302145_10164440 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300028759|Ga0302224_10169066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 860 | Open in IMG/M |
| 3300028762|Ga0302202_10484714 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 561 | Open in IMG/M |
| 3300028784|Ga0307282_10485973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300028785|Ga0302201_10040300 | All Organisms → cellular organisms → Bacteria | 2402 | Open in IMG/M |
| 3300028808|Ga0302228_10017797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3708 | Open in IMG/M |
| 3300028906|Ga0308309_10151112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1868 | Open in IMG/M |
| 3300028906|Ga0308309_10842959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
| 3300029907|Ga0311329_10168542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1713 | Open in IMG/M |
| 3300029985|Ga0302280_1166058 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300030011|Ga0302270_10455685 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 674 | Open in IMG/M |
| 3300030041|Ga0302274_10346208 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 677 | Open in IMG/M |
| 3300030054|Ga0302182_10274436 | Not Available | 713 | Open in IMG/M |
| 3300030057|Ga0302176_10023704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2321 | Open in IMG/M |
| 3300030399|Ga0311353_10800525 | Not Available | 804 | Open in IMG/M |
| 3300030580|Ga0311355_11484240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 586 | Open in IMG/M |
| 3300030659|Ga0316363_10126585 | Not Available | 1112 | Open in IMG/M |
| 3300030760|Ga0265762_1138180 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300030878|Ga0265770_1148109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 513 | Open in IMG/M |
| 3300031234|Ga0302325_13374464 | Not Available | 504 | Open in IMG/M |
| 3300031236|Ga0302324_101125791 | Not Available | 1053 | Open in IMG/M |
| 3300031715|Ga0307476_10700452 | Not Available | 750 | Open in IMG/M |
| 3300031820|Ga0307473_10200102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1185 | Open in IMG/M |
| 3300031820|Ga0307473_10914560 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300031962|Ga0307479_11092970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 764 | Open in IMG/M |
| 3300031996|Ga0308176_10077203 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2844 | Open in IMG/M |
| 3300032160|Ga0311301_11136031 | Not Available | 1011 | Open in IMG/M |
| 3300032180|Ga0307471_101209048 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 920 | Open in IMG/M |
| 3300032770|Ga0335085_10162156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2789 | Open in IMG/M |
| 3300032770|Ga0335085_12565492 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300032782|Ga0335082_10828431 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300032783|Ga0335079_12104173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300032829|Ga0335070_10191944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2040 | Open in IMG/M |
| 3300034282|Ga0370492_0460123 | Not Available | 516 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.87% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.92% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 6.93% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.93% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.94% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 5.94% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 4.95% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.95% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.95% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.97% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.98% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.98% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.99% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.99% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.99% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019785 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025460 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027072 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300028565 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028762 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028785 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029985 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_1 | Environmental | Open in IMG/M |
| 3300030011 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1016052791 | 3300002245 | Forest Soil | MGRRREPRKEVQAPVRIFXTDSSGRVFSAKAMAVNISRHGVELSGVESQL |
| JGIcombinedJ51221_101078373 | 3300003505 | Forest Soil | MGKRREPRKDIRVAVRIFGTDRSGQLFSEKVFTVNVSQQGVELSG |
| Ga0062389_1028631742 | 3300004092 | Bog Forest Soil | MGKRREPRKEIRVPVRIFGTDSGGQIFSEKAFTVDVSQQGLQLSGVQA |
| Ga0062386_1004925643 | 3300004152 | Bog Forest Soil | MGKRSQPRKDIEVPVRIFGTDSDGRVFSEKVSTVNISRSGVELAGV |
| Ga0062388_1011352631 | 3300004635 | Bog Forest Soil | MGRRSQPRNNIAVAVRIFGTDSHGQIFSEKVSTVNVSRKGAQLAGVR |
| Ga0066675_114087141 | 3300005187 | Soil | MGQRREPRKEVKVPVRIFGTDVNGKTFSENLFTVNVSRQGAK |
| Ga0070762_101183821 | 3300005602 | Soil | MGKRSQPRKEVKVPVRIFGTDSHGQIFSERVLTVNISRSGAEIIDVH |
| Ga0070765_1002389041 | 3300006176 | Soil | MGKRIEPRLDVQVPVRIFGTDRTGAVFSEKVVTVNISRLG |
| Ga0116222_10176391 | 3300009521 | Peatlands Soil | MGKRREPRKEVKVPVRIFGTDRSGQIFSEKVFTVNVSLQGVEL |
| Ga0116221_10708671 | 3300009523 | Peatlands Soil | MGRRREPRKEIQVPVRVFGTNRSGQVFSEKASTVNVSLQGAELSG |
| Ga0116115_10893341 | 3300009631 | Peatland | MGRRSQPRKQVEVPVRIFGTDSAGKVFSEKVLTVNIGRTG |
| Ga0116113_11498292 | 3300009638 | Peatland | MGRRREPRKEIQAQVRIFGTDSSGKVFSDKAVTVNVSRNGAELSGV |
| Ga0116120_11149821 | 3300009641 | Peatland | MGRRREPRKEIQAPVRVFGTDSSGQVFSEKAVTVNISQ |
| Ga0116106_10468461 | 3300009645 | Peatland | MGRRREPRKEIQAPVRIFGTDCSGQVFSEKAVTVNISQ |
| Ga0116215_15386782 | 3300009672 | Peatlands Soil | MGKRREPRKEIKVPVRIFGTDSGGQIFSEKVFTGDV |
| Ga0074046_101593622 | 3300010339 | Bog Forest Soil | MGRRREPRKEMQVPMRIFGTDSSGQVCSAKAVTVNVSQQG |
| Ga0074046_103881191 | 3300010339 | Bog Forest Soil | MGKRREPRKEIQAQVRIFGTSSSGQVFSEKAVTVNVSQQGVEL |
| Ga0074044_107003822 | 3300010343 | Bog Forest Soil | MGRRSQPRKQIAVPVRIFGTDNRGQVFSEKVLTANISRNGTDLADV |
| Ga0136449_10000851928 | 3300010379 | Peatlands Soil | MGKRREPRKEIKVPVRIFGTDSGGQIFSEKVFTGDVS |
| Ga0181530_100138001 | 3300014159 | Bog | MGRRREPRKEMQTPVRIFGTNSSGQVFSEKAVTVNISQ |
| Ga0181530_100645155 | 3300014159 | Bog | MGRRREPRKEIQAPVRIFGTDCSGQVFSEKAVTVN |
| Ga0181535_104877382 | 3300014199 | Bog | MGRRREPRKEIQVPVRIFGTNSSGQVFSDMAVTANVSQQG |
| Ga0181535_108339531 | 3300014199 | Bog | MGKRREPRKEIRVPVRIFGTDSAGEIFSEKVFTLNVSQHGLE |
| Ga0181525_102109301 | 3300014654 | Bog | MGKRSQPRKEVKVPVRIFGTDSHGQVFSEKVLTVNISRSGAEIIDV |
| Ga0182033_118618911 | 3300016319 | Soil | MGNRRQTRNETRVPVRIFGTDRDGQIFSEKAFTVNVSQQGVEL |
| Ga0182035_105970032 | 3300016341 | Soil | MGNRRQTRNETRVPVRIFGTDRDGQIFSEKAFTVNVSQQ |
| Ga0187806_12853422 | 3300017928 | Freshwater Sediment | MGKRREPRKDIKVPVRIFGTDRNGQIFSEKVFTAN |
| Ga0187853_105460061 | 3300017940 | Peatland | MGRRREPRKEIQAPVRIFGTDCSGQVFSEKAVTVNISQQGIELSGVQAK |
| Ga0187785_100596883 | 3300017947 | Tropical Peatland | VTVVGKRKEPRKDIAVPVRIFGTDSGGQIFSEKACTVN |
| Ga0187817_103011451 | 3300017955 | Freshwater Sediment | MGKRREPRKDIRVPVRLFGTDRGGRVFSEKVFTVNVSQHGVELSG |
| Ga0187781_109192111 | 3300017972 | Tropical Peatland | VSKRREPRKELQTAVRIFGTDSGGQVFSEKVSTVNISQHG |
| Ga0187810_100984661 | 3300018012 | Freshwater Sediment | MGRRSEPRKEIQAQVRIFGTDSSGRVFSEKAVTVNISQHGAEL |
| Ga0187881_100070007 | 3300018024 | Peatland | MGRRREPRKEIQAPVRVFGTDSSGQVFSEKAVTVNISQQGAELSGVQAK |
| Ga0187869_104781251 | 3300018030 | Peatland | MGRRREPRKEMQAPVRIFGTNSSGEVFSEKVLTVNISQQGAE |
| Ga0187851_107379081 | 3300018046 | Peatland | MGRRHEPRKEIQVPVRTFGMNSKGQVFSEKAVTLNISQQGVKLSG |
| Ga0187859_100029019 | 3300018047 | Peatland | MGRRREPRKEIQAQVRIFGTDSSGKVFSDKAVTVN |
| Ga0187859_101119694 | 3300018047 | Peatland | MGRRREPRKEIQAPVRIFGTDCSGQVFSEKAVTVNISQQ |
| Ga0187859_105550252 | 3300018047 | Peatland | MGRRREPRKDIQLPVRIFGTDSSGQVFSEKAITVNVSHQGA |
| Ga0066669_120276682 | 3300018482 | Grasslands Soil | MGQRREPRKEVKVPVRIFGTDVNGKTFSENLFTVNVSR |
| Ga0182022_12985221 | 3300019785 | Fen | MGKRREPRKEIQAPVRIFGTNRSGQVFSEKAVTVNVTSRGRS |
| Ga0193723_10491543 | 3300019879 | Soil | MGQRREPRKELKVPVRIFGTDVHGKTFSENLFTVNV |
| Ga0210395_103859981 | 3300020582 | Soil | MGKRREPRKEIKVPVRIFGTDSSGQIFSEKVMTENVS |
| Ga0210401_104957073 | 3300020583 | Soil | MGKRREPRKEIRVPVRIFGTDAGGQIFSEKVFTVNVSKNGLEL |
| Ga0210401_108748572 | 3300020583 | Soil | MGKRREPRVDKAVPVRIFGTDTNGQIFSEKLTTLNVSRHGAEL |
| Ga0210396_100440673 | 3300021180 | Soil | MGKRREPRKEIKVPVRIFGTDSEGKIFSEKVLTVNVSQQ |
| Ga0210396_102096041 | 3300021180 | Soil | MGKRREPRKEIKVPVRIFGTDSSGQIFSEKVMTEN |
| Ga0210393_115726291 | 3300021401 | Soil | MGRRREPRKAIEVPVRIFGTSSSGQVFSEKAVTVNVSHQGVELSGVQVK |
| Ga0210385_102363271 | 3300021402 | Soil | MGRRREPRKAIEVPVRIFGTSSSGQVFSEKAVTVNV |
| Ga0210386_107600011 | 3300021406 | Soil | MVTRREPRKDIRVPVRIFGTDVSGKPFNENVHTVNVSR |
| Ga0210383_104274582 | 3300021407 | Soil | MGKRREPRKEIQVPVRIFGTTSSGQTFSEKAVTVNVSQLGAELSGVQP |
| Ga0210384_104799891 | 3300021432 | Soil | MGKRREPRKEIKVPVRIFGTDSGGRVFSEKVFTVNV |
| Ga0210392_107337061 | 3300021475 | Soil | VIGKRREPRKEIKVPVRIFGTDKSGQTFSEKVMTVDVSR |
| Ga0210402_107626281 | 3300021478 | Soil | MGRRREPRKEIQVPVRIFGTDSSGQVFSAKAVTVNVSQQ |
| Ga0242665_100932811 | 3300022724 | Soil | MGERREPRKEIQVPVRIFGTDSKGKMFSANALTVNVSHQGLELS |
| Ga0208562_10512722 | 3300025460 | Peatland | MGRRREPRKEIQVPVRIFGTDSSGQVFSAKAVTVNVSQQG |
| Ga0208188_10641043 | 3300025507 | Peatland | MGRRREPRKEIQAPVRIFGTDCSGQVFSEKAVTVNI |
| Ga0209235_11460682 | 3300026296 | Grasslands Soil | MGQRREPRKEVKVPVRIFGTDVNGKTFSENLFTVNVSREGAKLEGVR |
| Ga0208238_10106352 | 3300027072 | Forest Soil | MGRRSQQRKQTEVPVRIFGTDRHGQVFSEKVSTVNVSRTG |
| Ga0209219_10852601 | 3300027565 | Forest Soil | MGKRREPRKEIKVPVRIFGTDSGGQIFSEKVFTLNVSQQGV |
| Ga0209625_11534001 | 3300027635 | Forest Soil | MGRRREPRKEVQAPVRIFGTDSSGRVFSAKAMAVNIS |
| Ga0209007_11781821 | 3300027652 | Forest Soil | MGRRSQPRKQIAVPVRIFGTDSHGQIFSGKAVTVSVSSQGAELAEVRPD |
| Ga0209530_10543522 | 3300027692 | Forest Soil | MGKRNHLRQKIEVPVRIFGTDIHGQVFSEKVVTVDISRAGAELAG |
| Ga0208696_10749561 | 3300027696 | Peatlands Soil | MGKRREPRKEIRVPVRIFGTDSGGQIFSEKVFTVDVSQ |
| Ga0209656_102966581 | 3300027812 | Bog Forest Soil | MGRRSQPRDNIAVPVRIFGTDSHGQVFSEKVPTVNVSRQGAQLAGVR |
| Ga0209274_105791452 | 3300027853 | Soil | MGRRSQPRNNIAVPVRIFGTDSHGQVFSEKVSTVNVSRKGAQLAGVRPDLGL |
| Ga0209167_105152781 | 3300027867 | Surface Soil | MGKRREPRKEIKVPVRIFGTDSSGQIFSEKVMTENVSQHEI |
| Ga0209169_105470901 | 3300027879 | Soil | MGKRSQPRKPVKVPVRIFGTDSHGQVFSEKVLTVNISRSGA |
| Ga0302145_101644401 | 3300028565 | Bog | MGKRREPRKQIQVPVRIFGTDSSGNVFSEAVVTVNVGQ |
| Ga0302224_101690662 | 3300028759 | Palsa | MGRRSQPRNNTVVPVRIFGTDSHGQVFSEKVSTVNVSRKGAQ |
| Ga0302202_104847141 | 3300028762 | Bog | MGRRREPRKEIQLAVRLFGTDSSGKMFSENALTVNVGQSG |
| Ga0307282_104859731 | 3300028784 | Soil | MGQRREPRKELKVPVRIFGTDVHGKTFSENLFTVNVSRE |
| Ga0302201_100403003 | 3300028785 | Bog | MGKRREPRKQIQVPVRIFGTDSSGNVFSEAVVTVNVGQQG |
| Ga0302228_100177971 | 3300028808 | Palsa | MGRRSQPRNNTVVPVRIFGTDSHGQVFSEKVSTVNV |
| Ga0308309_101511121 | 3300028906 | Soil | MGKRREPRKEIKVPVRIFGTDSAGQIFSEKVLTVNVSLRGL |
| Ga0308309_108429592 | 3300028906 | Soil | LNTGKRCEPRKEVVVAVRIFGTDSSGRMFSDKASTVNVSRQGAAL |
| Ga0311329_101685421 | 3300029907 | Bog | MLLKPTGRRSQPRKQVEVPVRIFGTDSAGKVFSEKV |
| Ga0302280_11660582 | 3300029985 | Fen | MGKRREPRKQIQVPVRIFGTDSSGNVFSEAVVTVN |
| Ga0302270_104556852 | 3300030011 | Bog | MGKRREPRKEIQLPVRIFGTDSSGKMFSESAFTVNVGQNGAELSGVH |
| Ga0302274_103462083 | 3300030041 | Bog | MGRRREPRKEIQLAVRLFGTDSSGKMFSENALTVN |
| Ga0302182_102744362 | 3300030054 | Palsa | MGKRRELRKDIEVPVRIFGTNSSGQVFSEKAVTVNV |
| Ga0302176_100237041 | 3300030057 | Palsa | MGRRSQPRNNTVVPVRIFGTDSHGQVFSEKVSTVNVSRKGAQLAGVRP |
| Ga0311353_108005251 | 3300030399 | Palsa | MGRRSQPRKQVEVQVRIFGTDSDAHVFSEKVFTVNISRNGTELGGVQPEVG |
| Ga0311355_114842402 | 3300030580 | Palsa | MGRRSQPRKQVEVPVRIFGTDSAGQVFSEKVLTVSI |
| Ga0316363_101265852 | 3300030659 | Peatlands Soil | MGRRSQPRKPVEIPVRIFGTDSRGQVFSEKVSTVNVSRNGVEL |
| Ga0265762_11381801 | 3300030760 | Soil | MGRRSQPRKQIAVPVRIFGTDSHGQIFSGKAVTVSVSSQGAELAEVR |
| Ga0265770_11481091 | 3300030878 | Soil | MGNRREPRKEIRVPVRIFGTDSGGQIFSEKVSTINVSKNGLELE |
| Ga0302325_133744641 | 3300031234 | Palsa | MGKRRELRHDIEVPVRIFGTNSSGQVFSEKAVTVNVSREGVALR |
| Ga0302324_1011257912 | 3300031236 | Palsa | MGRRSQPRKQVEVQVRIFGTDSDAHVFSEKVFTVNISRN |
| Ga0307476_107004521 | 3300031715 | Hardwood Forest Soil | MGKRNEPRKEIQVPVRIFGTDSTGAVFSQKAVTVNI |
| Ga0307473_102001022 | 3300031820 | Hardwood Forest Soil | MVSRREPRKDVRVPVRIFGTDVAGKTFNENVFTVNVSRG |
| Ga0307473_109145602 | 3300031820 | Hardwood Forest Soil | MGQRREPRKEVRVPVRIFGTDVNGKTFSENLFTVNVSREGTKLEG |
| Ga0307479_110929701 | 3300031962 | Hardwood Forest Soil | MGRRRQPRKEVQLPVRIFGTDSSGRVFSAKAMTVNISQHGIELS |
| Ga0308176_100772031 | 3300031996 | Soil | MGKRREPRKAAQVPVRIFGSDVDGKVFSEKVTTATVSKNGVRLDSV |
| Ga0311301_111360311 | 3300032160 | Peatlands Soil | MGRRSQPRKPIEAPVRIFGTDSHGQVFSEKVSTVNVSRNGA |
| Ga0307471_1012090482 | 3300032180 | Hardwood Forest Soil | MGKRREPRKEIRVPVRIFGTDSSGQIFSEKVFTVNVSQQ |
| Ga0335085_101621561 | 3300032770 | Soil | MMGKRREPRKDIKVPVRIFGTNSSGQVFSEKVFTTNVSRH |
| Ga0335085_125654921 | 3300032770 | Soil | MGKRREPRKDIKVPVRIFGTDSSGQIFSEKVFTTNVSRHGAE |
| Ga0335082_108284312 | 3300032782 | Soil | MGQRREPRKDLQVPVRVFGTDADGRPFSENISTINVSREGAKLT |
| Ga0335079_121041731 | 3300032783 | Soil | MGKRREPRKDIRVAVRLFGTDRNGRVFSEKLSTVNVSRC |
| Ga0335070_101919441 | 3300032829 | Soil | VGQRREPRKNVKVSVRIFGTDAEGRPFSESVSTFNVSREGVGVSGV |
| Ga0370492_0460123_1_144 | 3300034282 | Untreated Peat Soil | MLLKPMGRRSQPRKQVEVPVRIFGTDSAGKVFSEKVLTVNIGRTGAEL |
| ⦗Top⦘ |