| Basic Information | |
|---|---|
| Family ID | F103580 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MRLRTRLNLVVAGLTAVFVAVLIAAEIQSTRSSVREEIEAAN |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 33.66 % |
| % of genes near scaffold ends (potentially truncated) | 99.01 % |
| % of genes from short scaffolds (< 2000 bps) | 91.09 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.277 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (9.901 % of family members) |
| Environment Ontology (ENVO) | Unclassified (15.842 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.564 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 55.71% β-sheet: 0.00% Coil/Unstructured: 44.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF12706 | Lactamase_B_2 | 26.73 |
| PF08042 | PqqA | 15.84 |
| PF05402 | PqqD | 5.94 |
| PF07715 | Plug | 2.97 |
| PF04055 | Radical_SAM | 2.97 |
| PF03070 | TENA_THI-4 | 2.97 |
| PF00756 | Esterase | 0.99 |
| PF16491 | Peptidase_M48_N | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.28 % |
| Unclassified | root | N/A | 27.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001545|JGI12630J15595_10030463 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1117 | Open in IMG/M |
| 3300004091|Ga0062387_100031587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2345 | Open in IMG/M |
| 3300004092|Ga0062389_104082869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → Dechloromonas aromatica | 549 | Open in IMG/M |
| 3300005175|Ga0066673_10093003 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1606 | Open in IMG/M |
| 3300005337|Ga0070682_101059293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 677 | Open in IMG/M |
| 3300005345|Ga0070692_10147422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → unclassified Comamonadaceae → Comamonadaceae bacterium URHA0028 | 1337 | Open in IMG/M |
| 3300005434|Ga0070709_10825177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 729 | Open in IMG/M |
| 3300005530|Ga0070679_101718068 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
| 3300005533|Ga0070734_10217775 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1098 | Open in IMG/M |
| 3300005537|Ga0070730_11051347 | Not Available | 506 | Open in IMG/M |
| 3300005578|Ga0068854_100585449 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 951 | Open in IMG/M |
| 3300005614|Ga0068856_101300536 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 742 | Open in IMG/M |
| 3300005842|Ga0068858_101852009 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
| 3300006176|Ga0070765_101969739 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 547 | Open in IMG/M |
| 3300006237|Ga0097621_100875408 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 835 | Open in IMG/M |
| 3300006903|Ga0075426_10928812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 657 | Open in IMG/M |
| 3300009095|Ga0079224_102252300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 775 | Open in IMG/M |
| 3300009627|Ga0116109_1044898 | Not Available | 828 | Open in IMG/M |
| 3300009632|Ga0116102_1196650 | Not Available | 543 | Open in IMG/M |
| 3300009644|Ga0116121_1218381 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 608 | Open in IMG/M |
| 3300009650|Ga0105857_1132726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → Ideonella sakaiensis | 688 | Open in IMG/M |
| 3300009709|Ga0116227_10825372 | Not Available | 699 | Open in IMG/M |
| 3300010046|Ga0126384_12469018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 504 | Open in IMG/M |
| 3300010371|Ga0134125_11154739 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 847 | Open in IMG/M |
| 3300010399|Ga0134127_11915407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 670 | Open in IMG/M |
| 3300010880|Ga0126350_10248494 | Not Available | 1281 | Open in IMG/M |
| 3300012205|Ga0137362_10320116 | Not Available | 1343 | Open in IMG/M |
| 3300012476|Ga0157344_1034249 | Not Available | 501 | Open in IMG/M |
| 3300012685|Ga0137397_10406422 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1014 | Open in IMG/M |
| 3300012927|Ga0137416_11445844 | Not Available | 623 | Open in IMG/M |
| 3300013832|Ga0120132_1049138 | Not Available | 813 | Open in IMG/M |
| 3300014201|Ga0181537_10176498 | Not Available | 1468 | Open in IMG/M |
| 3300014259|Ga0075311_1172624 | Not Available | 507 | Open in IMG/M |
| 3300014495|Ga0182015_10753370 | Not Available | 613 | Open in IMG/M |
| 3300014884|Ga0180104_1221171 | Not Available | 565 | Open in IMG/M |
| 3300015242|Ga0137412_10085625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 2564 | Open in IMG/M |
| 3300017972|Ga0187781_11434131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300018034|Ga0187863_10070961 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1967 | Open in IMG/M |
| 3300018062|Ga0187784_10793836 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 756 | Open in IMG/M |
| 3300018062|Ga0187784_10942410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → Ideonella sakaiensis | 687 | Open in IMG/M |
| 3300018062|Ga0187784_11244314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 590 | Open in IMG/M |
| 3300018079|Ga0184627_10085226 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1660 | Open in IMG/M |
| 3300019284|Ga0187797_1085748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 618 | Open in IMG/M |
| 3300019377|Ga0190264_11224193 | Not Available | 626 | Open in IMG/M |
| 3300019487|Ga0187893_10556878 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 735 | Open in IMG/M |
| 3300020021|Ga0193726_1331307 | Not Available | 571 | Open in IMG/M |
| 3300021086|Ga0179596_10027465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 2152 | Open in IMG/M |
| 3300021178|Ga0210408_10084573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 2490 | Open in IMG/M |
| 3300021403|Ga0210397_11322641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300021404|Ga0210389_11028165 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 638 | Open in IMG/M |
| 3300022506|Ga0242648_1062790 | Not Available | 588 | Open in IMG/M |
| 3300023264|Ga0247772_1049588 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 877 | Open in IMG/M |
| 3300025505|Ga0207929_1075268 | Not Available | 637 | Open in IMG/M |
| 3300025904|Ga0207647_10176540 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1243 | Open in IMG/M |
| 3300025944|Ga0207661_11880545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Hydrocarboniphaga → Hydrocarboniphaga effusa → Hydrocarboniphaga effusa AP103 | 544 | Open in IMG/M |
| 3300025972|Ga0207668_11342473 | Not Available | 644 | Open in IMG/M |
| 3300026075|Ga0207708_10043667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 3415 | Open in IMG/M |
| 3300026328|Ga0209802_1259665 | Not Available | 589 | Open in IMG/M |
| 3300026557|Ga0179587_10436602 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 856 | Open in IMG/M |
| 3300027526|Ga0209968_1014472 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1242 | Open in IMG/M |
| 3300027590|Ga0209116_1049115 | Not Available | 910 | Open in IMG/M |
| 3300027610|Ga0209528_1090869 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 675 | Open in IMG/M |
| 3300027633|Ga0208988_1117868 | Not Available | 652 | Open in IMG/M |
| 3300027648|Ga0209420_1016141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2496 | Open in IMG/M |
| 3300027678|Ga0209011_1189075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300027895|Ga0209624_10740709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 647 | Open in IMG/M |
| 3300027903|Ga0209488_11025365 | Not Available | 569 | Open in IMG/M |
| 3300028047|Ga0209526_10066619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2533 | Open in IMG/M |
| 3300028047|Ga0209526_10575297 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 725 | Open in IMG/M |
| 3300028742|Ga0302220_10290617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Halieaceae → unclassified Halieaceae → marine gamma proteobacterium HTCC2080 | 596 | Open in IMG/M |
| 3300028748|Ga0302156_10177953 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1014 | Open in IMG/M |
| 3300028765|Ga0302198_10108019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1505 | Open in IMG/M |
| 3300028780|Ga0302225_10273752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → Ideonella sakaiensis | 803 | Open in IMG/M |
| 3300028803|Ga0307281_10085556 | Not Available | 1043 | Open in IMG/M |
| 3300029922|Ga0311363_11150966 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 660 | Open in IMG/M |
| 3300029939|Ga0311328_10680611 | Not Available | 699 | Open in IMG/M |
| 3300029951|Ga0311371_10194592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 3019 | Open in IMG/M |
| 3300029951|Ga0311371_12358985 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
| 3300029984|Ga0311332_11039143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 658 | Open in IMG/M |
| 3300030051|Ga0302195_10519281 | Not Available | 506 | Open in IMG/M |
| 3300030509|Ga0302183_10097633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1158 | Open in IMG/M |
| 3300030580|Ga0311355_10792005 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 871 | Open in IMG/M |
| 3300030737|Ga0302310_10730277 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300030946|Ga0075379_11133604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 634 | Open in IMG/M |
| 3300031122|Ga0170822_15349542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 633 | Open in IMG/M |
| 3300031446|Ga0170820_14754456 | Not Available | 676 | Open in IMG/M |
| 3300031525|Ga0302326_12703353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 616 | Open in IMG/M |
| 3300031538|Ga0310888_10676992 | Not Available | 631 | Open in IMG/M |
| 3300031546|Ga0318538_10389904 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 753 | Open in IMG/M |
| 3300031708|Ga0310686_116815274 | Not Available | 639 | Open in IMG/M |
| 3300031723|Ga0318493_10204124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1044 | Open in IMG/M |
| 3300031823|Ga0307478_10074953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 2568 | Open in IMG/M |
| 3300031854|Ga0310904_10892292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Halieaceae → unclassified Halieaceae → marine gamma proteobacterium HTCC2080 | 627 | Open in IMG/M |
| 3300031941|Ga0310912_10322563 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1197 | Open in IMG/M |
| 3300031962|Ga0307479_12162767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 503 | Open in IMG/M |
| 3300032044|Ga0318558_10577252 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 562 | Open in IMG/M |
| 3300032068|Ga0318553_10330914 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 797 | Open in IMG/M |
| 3300032179|Ga0310889_10089044 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1292 | Open in IMG/M |
| 3300032829|Ga0335070_10795001 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 880 | Open in IMG/M |
| 3300033755|Ga0371489_0499564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → Ideonella sakaiensis | 539 | Open in IMG/M |
| 3300034199|Ga0370514_084161 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 808 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.91% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.92% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.96% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.96% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.96% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.97% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.97% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.97% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.98% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.98% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.98% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.98% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.98% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.99% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.99% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.99% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.99% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.99% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 0.99% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.99% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.99% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.99% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.99% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.99% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.99% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.99% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.99% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.99% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.99% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.99% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.99% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009095 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015 | Environmental | Open in IMG/M |
| 3300009627 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_10 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009650 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061 | Environmental | Open in IMG/M |
| 3300009709 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014259 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023264 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L151-409C-6 | Environmental | Open in IMG/M |
| 3300025505 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028765 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300030051 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030946 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| 3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12630J15595_100304632 | 3300001545 | Forest Soil | MKLRTRLNLVLTGLMAVFLAVLLADQIRDTRSSVREEI |
| Ga0062387_1000315871 | 3300004091 | Bog Forest Soil | MQPMRLRTRLNLVVAGLSAAFLIVLIAAEVESSRASVREEIEAANR |
| Ga0062389_1040828691 | 3300004092 | Bog Forest Soil | MKLRTRLNLVLTGLTAVFIVVWAVDEIRATRSSIREEIEAANRV |
| Ga0066673_100930033 | 3300005175 | Soil | MKLRTRLNLVLIGLTAVSVGVLIVDELHDMRSSIREEIEAANRVAA |
| Ga0070682_1010592932 | 3300005337 | Corn Rhizosphere | MKLRTRVNLIVAGLTAMFVAVLILAEIYDTRSSINEEVEAANRV |
| Ga0070692_101474221 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLRTRLNIIVAGLTAAFVVVLIAAQLENARASVREEIHAAN |
| Ga0070709_108251772 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLRTRLNLVVTGLTAVFAAVLITSEIRDTRASVREESEA |
| Ga0070679_1017180682 | 3300005530 | Corn Rhizosphere | MKLRTRLNLVVTGLTAVFMGVLIASEIRDMRSSIREEIEAANQVAS |
| Ga0070734_102177752 | 3300005533 | Surface Soil | MRLRTRLNLVVAGLSAAFVAVLIAVEVQSTRASVREE |
| Ga0070730_110513473 | 3300005537 | Surface Soil | MKLRTRLNLVVAGLTAAFVIVLILGEFQATKSSIREE |
| Ga0068854_1005854493 | 3300005578 | Corn Rhizosphere | MKLRTRVNLIVAGLTAMFVAVLILAEIYDTRSSINEEVEAANRVGSQ |
| Ga0068856_1013005361 | 3300005614 | Corn Rhizosphere | MKLRTRLNLVVAGLTVTFTAVLIGEEIRSTRLSLREEIAAGNR |
| Ga0068858_1018520092 | 3300005842 | Switchgrass Rhizosphere | MKLRTRLNLIVAGLTAAFVAVLISAELLNVQASVREEVDAANRVAS |
| Ga0070765_1019697391 | 3300006176 | Soil | MKLRTRLNLVVAGLTAMFIIVLTFAEIEDTRSSVNEEVEAANRVGS |
| Ga0097621_1008754081 | 3300006237 | Miscanthus Rhizosphere | MKLRTRVNLIVAGLTAMFVAVLILAEIYDTRSSINEEV |
| Ga0075426_109288122 | 3300006903 | Populus Rhizosphere | MKLRTRLYLVLTGVTTVFVAVLIADEVRDARSSVREEIEAANRVAA |
| Ga0079224_1022523001 | 3300009095 | Agricultural Soil | MTLRMHLNLVVASLSAAFVVVLLIAEVQSARASIREEITAANR |
| Ga0116109_10448981 | 3300009627 | Peatland | MKLRTRLNLVVAGLTAVFVAVLLFEEIQNTRSSVRE |
| Ga0116102_11966503 | 3300009632 | Peatland | MRLRTRLNLVVAGLSATFMVVLIAAEIQSNRASVR |
| Ga0116121_12183811 | 3300009644 | Peatland | MKLRTQLNLVISALSAAFVIVLIAAEVQSTQESVREEI |
| Ga0105857_11327261 | 3300009650 | Permafrost Soil | MGAANIEPLMKLRTRLNLVVAGLTAAFVIVLISAEVQATRSSIREEIEAANRVA |
| Ga0116227_108253721 | 3300009709 | Host-Associated | MRLRTRLNLVVAALSAAFVLVLIAAEVQSTKTSVREEIEAANRV |
| Ga0126384_124690181 | 3300010046 | Tropical Forest Soil | MKLLTRLNLIVAGLTATFVIVLIFAEIANTRSSVNEEVEAANR |
| Ga0134125_111547391 | 3300010371 | Terrestrial Soil | MKLRTRLNLVVTGLTAVFMGVLIASEIRDMRSSIREEIEAANQ |
| Ga0134127_119154073 | 3300010399 | Terrestrial Soil | MKLRTRLNLVVAGLTATFVIVLIAGEITTARDSVREEIEAANRA |
| Ga0126350_102484941 | 3300010880 | Boreal Forest Soil | MKLRSRLNLVVAALSAAFVIVLIAAEIQSARTSVREEI |
| Ga0137362_103201162 | 3300012205 | Vadose Zone Soil | MRLRTRLNLVVAGLSAAFVIVLIAAEVQSTRNSVREEIEAANRV |
| Ga0157344_10342491 | 3300012476 | Arabidopsis Rhizosphere | MKLRTRLNLVVAGLTATFVIVLFAGEIVTARDSVRE |
| Ga0137397_104064223 | 3300012685 | Vadose Zone Soil | MKLRTRLNLIVAGLTATFIGVLIVAEIENTRSSVNEE |
| Ga0137416_114458441 | 3300012927 | Vadose Zone Soil | MKLRTRLNLVVAGLTAVFVAVLLTEEIENTRSSVREE |
| Ga0120132_10491381 | 3300013832 | Permafrost | LNLVVAGLSAAFVIVLIAAELESARTSVREEIEAAN |
| Ga0181537_101764983 | 3300014201 | Bog | MRLRTRLSLVVAALSAAFVVVLIAAEIQATRESVR* |
| Ga0075311_11726242 | 3300014259 | Natural And Restored Wetlands | MKLRTRLNLVVAGLTATFVIVLLAVEVQTARVAVREETEAANRAAAKLLGRL |
| Ga0182015_107533703 | 3300014495 | Palsa | MKLRTRLNLVVAGLTAAFVIVLISAEIQATRSSIREEIE |
| Ga0180104_12211711 | 3300014884 | Soil | MKLRTRLNLVVAGLTATFVIVLLSIEIQTARASVREETEAAN |
| Ga0137412_100856255 | 3300015242 | Vadose Zone Soil | MGKMRLRTRLNLVVAGLSATFVIVLIAAEIQSTRASI |
| Ga0187781_114341311 | 3300017972 | Tropical Peatland | MKLRTRLNLVLTAVTLVFIAVLVAREVGDTRASVREE |
| Ga0187863_100709613 | 3300018034 | Peatland | MKLRTRLNLVLTGLTAVFIVVLVLDEIRATRSSIREEIEAANRVAA |
| Ga0187784_107938362 | 3300018062 | Tropical Peatland | MKLRTRLNLVLTAVTAVFVAALVADEIRDTRSSIREEIEAAN |
| Ga0187784_109424102 | 3300018062 | Tropical Peatland | MKLRTRLNLVVAGLTAAFVVVLIMVEIQTTRSSIREEIEAANR |
| Ga0187784_112443142 | 3300018062 | Tropical Peatland | MKLQTRLNLVLTGVTVVFVAVLTAREIRNARASVREEIE |
| Ga0184627_100852261 | 3300018079 | Groundwater Sediment | MKLRTRLNLVATGLTATFVIVLISAEILTARISVREEIEA |
| Ga0187797_10857481 | 3300019284 | Peatland | MKLRTRLNLVLTAVTAVFVAALIADEIRDTRSSIREEIE |
| Ga0190264_112241932 | 3300019377 | Soil | MKLRTRLNLVVAGLTALFVAVLLTAEVRGTRDSVREE |
| Ga0187893_105568781 | 3300019487 | Microbial Mat On Rocks | MKLRTRLNLVVTGLTATFVIVLLSAEVLTVRTSVREEIEA |
| Ga0193726_13313071 | 3300020021 | Soil | MQPMRLRTRLNLVVTGLSAAFLIVLIAAEIQSMRGSVREEIEA |
| Ga0179596_100274653 | 3300021086 | Vadose Zone Soil | MRLRTRLNLVVAGLSATFLIVLIAAEIQSTRASIREEIEA |
| Ga0210408_100845735 | 3300021178 | Soil | MKLRTRLNLVLTGVTAVFVAVLLADEIRDARSSVREEIEAANRV |
| Ga0210397_113226411 | 3300021403 | Soil | MKLRTRLNLVLTGLTGVFIIVLAADELRATRSSIRE |
| Ga0210389_110281651 | 3300021404 | Soil | MKLRTRLNLVVAGLTAVFVAVLLTEEIQSPRSSVREEIEAAN |
| Ga0242648_10627901 | 3300022506 | Soil | MKLRTRLNLVVAGLTAVFVAVLLTEEIQNTRSSVREEI |
| Ga0247772_10495881 | 3300023264 | Plant Litter | LKLRTRLNLVVAGLTALFVAVLCAAEIQSTRSSVREEIEAAN |
| Ga0207929_10752681 | 3300025505 | Arctic Peat Soil | MGAANIEPLMKLRTRLNLVVAGLTAAFVIVLISAEVQATRSSIREEIEAAIG |
| Ga0207647_101765401 | 3300025904 | Corn Rhizosphere | MKLRTRLNLIVAGLTAMFVAVLIFAEIENTRSSVAEEVE |
| Ga0207661_118805451 | 3300025944 | Corn Rhizosphere | MKLRTRLNLVVTGLTAVFMGVLIASEIRDMRSSIREEIEAANQV |
| Ga0207668_113424732 | 3300025972 | Switchgrass Rhizosphere | MKLRTRLNLVVTGLTVTFVAALILSEFQSTRISVREEIEAANRVA |
| Ga0207708_100436677 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLRTRLNIIVAGLTAAFVVVLIAAQLENARASVREEIHPANRV |
| Ga0209802_12596651 | 3300026328 | Soil | MKLRTRLNLVLIGLTAVSVGVLIVDELHDMRSSIR |
| Ga0179587_104366021 | 3300026557 | Vadose Zone Soil | MRLRTRLNLVVAGLSATFLIVLIAAEVQSTRASVREEIEAAN |
| Ga0209968_10144721 | 3300027526 | Arabidopsis Thaliana Rhizosphere | MKLRTRLNLVVTGLTATFMIVLIAAEILTARTSVREE |
| Ga0209116_10491151 | 3300027590 | Forest Soil | MQPMRLRTRLNLVVTGLSAAFLLVLIAAEIQSMRGSVREEI |
| Ga0209528_10908692 | 3300027610 | Forest Soil | MKLRTRLNLVLTGLMAVFLAVLLADQIRDTRSSVRE |
| Ga0208988_11178681 | 3300027633 | Forest Soil | MGEMRLRTRLNLVVAGLSATFVIVLIAAEIQSTRASIREEI |
| Ga0209420_10161416 | 3300027648 | Forest Soil | MRLRTRLNLVVAGLSAAFVIVLIAAEIQSTRESVREEIEAANRVAS |
| Ga0209011_11890751 | 3300027678 | Forest Soil | LNLVVAALSAAFVIVLIAAEVESTRNSVREEIEAANRVASQP |
| Ga0209624_107407092 | 3300027895 | Forest Soil | MRLRTRLNLVVAGLSATFVIVLIAAEIQSTRASIREEIEAANRV |
| Ga0209488_110253651 | 3300027903 | Vadose Zone Soil | MRLRTRLNLVLAALSAAFMVVLIAAEVQSTRNSVREEIEAAN |
| Ga0209526_100666191 | 3300028047 | Forest Soil | MKLRTRLNLIVAGLTATFIGVLIFAEIENTRSSVNEE |
| Ga0209526_105752971 | 3300028047 | Forest Soil | VVAALSAAFVIVLIAAEVESTRNSVREEIEAANRVA |
| Ga0302220_102906171 | 3300028742 | Palsa | MRLRTRLNLVVAALSAAFVIVLIAAEIEATRDSVREEIEAAN |
| Ga0302156_101779533 | 3300028748 | Bog | MRRMRLRTRLNLVVAGLSATFVVVLIAAEIQSTRASVREEI |
| Ga0302198_101080191 | 3300028765 | Bog | MPPMRLRTRLNLVVAGLSAAFVIVLIAAEIQSARSSVREEIEAA |
| Ga0302225_102737521 | 3300028780 | Palsa | MKLRTRLNLVVAGLTAAFVIVLLSAEIQATRSSIREEIEAA |
| Ga0307281_100855561 | 3300028803 | Soil | MKLRTRLNLVVAGLTATFAVVLIGEEFRSTRLSLH |
| Ga0311363_111509662 | 3300029922 | Fen | MPPMRLRTRLNLVVAGLSAAFVIVLIAAEIQSARS |
| Ga0311328_106806113 | 3300029939 | Bog | MRLRTRLNLVVAGLSASFVVVLLAAEIQSTRASVREET |
| Ga0311371_101945925 | 3300029951 | Palsa | MRLRTRLNLVVAGLSAAFVIVLIAAEIQSARSSVREEI |
| Ga0311371_123589852 | 3300029951 | Palsa | MKLRTRLNLVVAGLTAAFVIVLISAEIQGTRSSIREEIE |
| Ga0311332_110391431 | 3300029984 | Fen | MKLRTRPNSIVAGLTATFVMVLIFAEIEDTRSSISEEVEAANRV |
| Ga0302195_105192811 | 3300030051 | Bog | MQPMRLRTRLNLVVAALSAAFVIVLIAAEVQSTRTSVREEIEAAN |
| Ga0302183_100976331 | 3300030509 | Palsa | MKLRTRLNLVVAGLTAAFVIVLISAEIQATRSSIREEIEAANRVAS |
| Ga0311355_107920052 | 3300030580 | Palsa | MRLRTRLNLVVAALSAAFLIVLITAEVQSSRTSVR |
| Ga0302310_107302771 | 3300030737 | Palsa | MPRMRLRTRLNLVVAGLSAAFVIVLIAAEIQSARSSVREEI |
| Ga0075379_111336042 | 3300030946 | Soil | MNLRTRLNLVLTGLTAVFVLALVLDEIRATRSSVREEIEAA |
| Ga0170822_153495421 | 3300031122 | Forest Soil | MNLRTRLNLVLTGLTAVFVLALVLDEIRATRSSVREEIE |
| Ga0170820_147544562 | 3300031446 | Forest Soil | MRLRTRLNLVVAALSAAFLIVLIATEVESSRRSVRE |
| Ga0302326_127033531 | 3300031525 | Palsa | MKLRTRLNLVVAGLTAAFVIVLISAEIQASRSSIREEIEAANR |
| Ga0310888_106769921 | 3300031538 | Soil | MKLRTRLNLVVIGLTATFVIVLIAAEILTARTSVREEIEAA |
| Ga0318538_103899041 | 3300031546 | Soil | MKLRTRLNLVLTGVTTLFVAALVADEIRDARASVREE |
| Ga0310686_1168152741 | 3300031708 | Soil | MKLRTRLNLVLTGVTAIFLAVLVADEVRDARSSVREEIEAANRV |
| Ga0318493_102041241 | 3300031723 | Soil | MRLRTRLNLVVAGLTAVFVAVLIAAEIQSTRSSVREEIEAAN |
| Ga0307478_100749531 | 3300031823 | Hardwood Forest Soil | MKLRTRLNLVLTGLTGVFIIVLAADELRATRSSIR |
| Ga0310904_108922921 | 3300031854 | Soil | MKLRTRLNLIVAGLTAAFVAVLIAAELLNVRASVREE |
| Ga0310912_103225631 | 3300031941 | Soil | MKLRTRLNLVLTGVTTLFVAALVADEIRDARASVREEIE |
| Ga0307479_121627671 | 3300031962 | Hardwood Forest Soil | MKLRTRLNLVLTGVTAVFIALLVADQIRDTRSSVREE |
| Ga0318558_105772521 | 3300032044 | Soil | MNLRTRLNIVVGGLAALFVAVLIAEEIKDTRSSVREEI |
| Ga0318553_103309141 | 3300032068 | Soil | MKLRTRLNLVLTGVTTLFVAALVADEIRDARASVR |
| Ga0310889_100890441 | 3300032179 | Soil | MKLRTRLNLVVTGLTATFMIVLIAAEILTARTSVREEIEAA |
| Ga0335070_107950011 | 3300032829 | Soil | MNLRTRLNLVLTGLTAVFVLALLLDGLRATRSSVREEIEA |
| Ga0371489_0499564_2_121 | 3300033755 | Peat Soil | MKLRTRLNLVVAGLTASFFIALILLEFQATRDSIREESEA |
| Ga0370514_084161_2_139 | 3300034199 | Untreated Peat Soil | MKLRTQLNLVISALSAAFVVVLIAAEVQSTQQSVREEIEAANRVAS |
| ⦗Top⦘ |