NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F103509

Metagenome / Metatranscriptome Family F103509

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F103509
Family Type Metagenome / Metatranscriptome
Number of Sequences 101
Average Sequence Length 94 residues
Representative Sequence MKKLVVISALFVLSACASMHSPYDLHDWCLRMGSTRLTSIGSKAQDPATCGNELEEDLADPTPRILYAPRDVAMSPVIAARGVWVLLGMTRPPF
Number of Associated Samples 93
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 86.14 %
% of genes near scaffold ends (potentially truncated) 20.79 %
% of genes from short scaffolds (< 2000 bps) 78.22 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.63

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.010 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(21.782 % of family members)
Environment Ontology (ENVO) Unclassified
(27.723 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(40.594 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 50.82%    β-sheet: 0.00%    Coil/Unstructured: 49.18%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.63
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF00702Hydrolase 5.94
PF13714PEP_mutase 3.96
PF01476LysM 2.97
PF07693KAP_NTPase 2.97
PF12464Mac 1.98
PF00291PALP 1.98
PF04191PEMT 1.98
PF09084NMT1 1.98
PF02771Acyl-CoA_dh_N 1.98
PF00912Transgly 1.98
PF00072Response_reg 1.98
PF02515CoA_transf_3 0.99
PF00483NTP_transferase 0.99
PF04014MazE_antitoxin 0.99
PF02308MgtC 0.99
PF00441Acyl-CoA_dh_1 0.99
PF02082Rrf2 0.99
PF13751DDE_Tnp_1_6 0.99
PF02776TPP_enzyme_N 0.99
PF02265S1-P1_nuclease 0.99
PF02586SRAP 0.99
PF16868NMT1_3 0.99
PF01522Polysacc_deac_1 0.99
PF13432TPR_16 0.99
PF07452CHRD 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG4928Predicted P-loop ATPase, KAP-likeGeneral function prediction only [R] 2.97
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 2.97
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 1.98
COG5009Membrane carboxypeptidase/penicillin-binding proteinCell wall/membrane/envelope biogenesis [M] 1.98
COG4953Membrane carboxypeptidase/penicillin-binding protein PbpCCell wall/membrane/envelope biogenesis [M] 1.98
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 1.98
COG0744Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidaseCell wall/membrane/envelope biogenesis [M] 1.98
COG1725DNA-binding transcriptional regulator YhcF, GntR familyTranscription [K] 0.99
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 0.99
COG1959DNA-binding transcriptional regulator, IscR familyTranscription [K] 0.99
COG1414DNA-binding transcriptional regulator, IclR familyTranscription [K] 0.99
COG2135ssDNA abasic site-binding protein YedK/HMCES, SRAP familyReplication, recombination and repair [L] 0.99
COG2186DNA-binding transcriptional regulator, FadR familyTranscription [K] 0.99
COG2188DNA-binding transcriptional regulator, GntR familyTranscription [K] 0.99
COG2378Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domainsTranscription [K] 0.99
COG2524Predicted transcriptional regulator, contains C-terminal CBS domainsTranscription [K] 0.99
COG3174Membrane component of predicted Mg2+ transport system, contains DUF4010 domainInorganic ion transport and metabolism [P] 0.99
COG1285Magnesium uptake protein YhiD/SapB, involved in acid resistanceInorganic ion transport and metabolism [P] 0.99
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 0.99
COG0640DNA-binding transcriptional regulator, ArsR familyTranscription [K] 0.99


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.01 %
UnclassifiedrootN/A0.99 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908045|KansclcFeb2_ConsensusfromContig1000349All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium975Open in IMG/M
2124908045|KansclcFeb2_ConsensusfromContig179640All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium887Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c2365524All Organisms → cellular organisms → Bacteria2286Open in IMG/M
3300000550|F24TB_12014514All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium762Open in IMG/M
3300000559|F14TC_108326067All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium798Open in IMG/M
3300000787|JGI11643J11755_11393791All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1205Open in IMG/M
3300000956|JGI10216J12902_112571596All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium506Open in IMG/M
3300003993|Ga0055468_10003470All Organisms → cellular organisms → Bacteria2442Open in IMG/M
3300003993|Ga0055468_10221131All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium588Open in IMG/M
3300004156|Ga0062589_100920346All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium807Open in IMG/M
3300004463|Ga0063356_100479401All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1636Open in IMG/M
3300004643|Ga0062591_101617854All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium653Open in IMG/M
3300005166|Ga0066674_10015616All Organisms → cellular organisms → Bacteria3215Open in IMG/M
3300005167|Ga0066672_10182369All Organisms → cellular organisms → Bacteria → Proteobacteria1331Open in IMG/M
3300005172|Ga0066683_10090017All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1855Open in IMG/M
3300005174|Ga0066680_10004596All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria6488Open in IMG/M
3300005186|Ga0066676_10095800All Organisms → cellular organisms → Bacteria1791Open in IMG/M
3300005186|Ga0066676_10786119All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium645Open in IMG/M
3300005204|Ga0068997_10104096All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium616Open in IMG/M
3300005441|Ga0070700_101120318All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium653Open in IMG/M
3300005446|Ga0066686_10217366All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1284Open in IMG/M
3300005447|Ga0066689_10052386All Organisms → cellular organisms → Bacteria2194Open in IMG/M
3300005553|Ga0066695_10066982All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Levybacteria → Candidatus Levybacteria bacterium GW2011_GWA1_39_322163Open in IMG/M
3300005553|Ga0066695_10694181All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300005937|Ga0081455_10015611All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria7369Open in IMG/M
3300005981|Ga0081538_10066085All Organisms → cellular organisms → Bacteria → Proteobacteria2030Open in IMG/M
3300006049|Ga0075417_10040216All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1980Open in IMG/M
3300006224|Ga0079037_100252051All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1615Open in IMG/M
3300006791|Ga0066653_10302795All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium806Open in IMG/M
3300006797|Ga0066659_10358721Not Available1133Open in IMG/M
3300009087|Ga0105107_10560355All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium796Open in IMG/M
3300009137|Ga0066709_101893121All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium831Open in IMG/M
3300009147|Ga0114129_10054868All Organisms → cellular organisms → Bacteria5585Open in IMG/M
3300009147|Ga0114129_10432542All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1729Open in IMG/M
3300009157|Ga0105092_10134364All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1369Open in IMG/M
3300009162|Ga0075423_10181813All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2207Open in IMG/M
3300009167|Ga0113563_10614792All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1206Open in IMG/M
3300009171|Ga0105101_10659160All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium521Open in IMG/M
3300009789|Ga0126307_10493445All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium988Open in IMG/M
3300010037|Ga0126304_10280588All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1100Open in IMG/M
3300010400|Ga0134122_11302060All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium734Open in IMG/M
3300011333|Ga0127502_10084979All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium713Open in IMG/M
3300012201|Ga0137365_10467912All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium927Open in IMG/M
3300012206|Ga0137380_10038280All Organisms → cellular organisms → Bacteria → Proteobacteria4422Open in IMG/M
3300012208|Ga0137376_10619143All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium936Open in IMG/M
3300012356|Ga0137371_10156844All Organisms → cellular organisms → Bacteria1785Open in IMG/M
3300012360|Ga0137375_10071575All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3660Open in IMG/M
3300012685|Ga0137397_10260718All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1292Open in IMG/M
3300012922|Ga0137394_10066546All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2996Open in IMG/M
3300012923|Ga0137359_10455249All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1132Open in IMG/M
3300012931|Ga0153915_10065265All Organisms → cellular organisms → Bacteria3775Open in IMG/M
3300012931|Ga0153915_10323567All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1728Open in IMG/M
3300013306|Ga0163162_10701805All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1133Open in IMG/M
3300017930|Ga0187825_10096031All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1023Open in IMG/M
3300017936|Ga0187821_10271114All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium668Open in IMG/M
3300017997|Ga0184610_1156798All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium749Open in IMG/M
3300018000|Ga0184604_10045310All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1192Open in IMG/M
3300018028|Ga0184608_10064686All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1471Open in IMG/M
3300018032|Ga0187788_10041244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca1545Open in IMG/M
3300018054|Ga0184621_10056130All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1326Open in IMG/M
3300018066|Ga0184617_1164505All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium655Open in IMG/M
3300018071|Ga0184618_10024576All Organisms → cellular organisms → Bacteria2013Open in IMG/M
3300018071|Ga0184618_10447177All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium544Open in IMG/M
3300018075|Ga0184632_10235994All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium801Open in IMG/M
3300018089|Ga0187774_10073588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Kouleothrix → Kouleothrix aurantiaca1602Open in IMG/M
3300018431|Ga0066655_11361286All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium513Open in IMG/M
3300018433|Ga0066667_10171658All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1558Open in IMG/M
3300018476|Ga0190274_11613026All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium742Open in IMG/M
3300019789|Ga0137408_1396878All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1534Open in IMG/M
3300023266|Ga0247789_1059535All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium715Open in IMG/M
3300025930|Ga0207701_10603317All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium935Open in IMG/M
3300025955|Ga0210071_1021066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_64_32802Open in IMG/M
3300026296|Ga0209235_1286162All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium504Open in IMG/M
3300026315|Ga0209686_1024690All Organisms → cellular organisms → Bacteria → Proteobacteria2357Open in IMG/M
3300026323|Ga0209472_1009904All Organisms → cellular organisms → Bacteria4883Open in IMG/M
3300026326|Ga0209801_1013856All Organisms → cellular organisms → Bacteria4085Open in IMG/M
3300026329|Ga0209375_1019645All Organisms → cellular organisms → Bacteria3905Open in IMG/M
3300026343|Ga0209159_1243707All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium548Open in IMG/M
3300026550|Ga0209474_10423972All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium683Open in IMG/M
3300028814|Ga0307302_10527190All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium587Open in IMG/M
3300030006|Ga0299907_10068307All Organisms → cellular organisms → Bacteria2868Open in IMG/M
3300030619|Ga0268386_10545251All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300031226|Ga0307497_10071623All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1279Open in IMG/M
3300031538|Ga0310888_10902719All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium551Open in IMG/M
3300031858|Ga0310892_11377691All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium506Open in IMG/M
3300031901|Ga0307406_11951070All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium524Open in IMG/M
3300031908|Ga0310900_11587363All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium553Open in IMG/M
3300031911|Ga0307412_10070345All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria2385Open in IMG/M
3300031949|Ga0214473_10902900All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium942Open in IMG/M
3300031995|Ga0307409_100452790All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1239Open in IMG/M
3300032144|Ga0315910_10202116All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1492Open in IMG/M
3300032157|Ga0315912_10397941All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1091Open in IMG/M
3300032829|Ga0335070_11215844All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium691Open in IMG/M
3300033408|Ga0316605_10693757All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium960Open in IMG/M
3300033414|Ga0316619_12184322All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium506Open in IMG/M
3300033433|Ga0326726_10225291All Organisms → cellular organisms → Bacteria1738Open in IMG/M
3300033433|Ga0326726_11084155All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium778Open in IMG/M
3300033482|Ga0316627_102720102All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium525Open in IMG/M
3300033485|Ga0316626_10046423All Organisms → cellular organisms → Bacteria2935Open in IMG/M
3300033486|Ga0316624_10413456All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1131Open in IMG/M
3300034149|Ga0364929_0080434All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1013Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil21.78%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.91%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment7.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.93%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.94%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands3.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.96%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.96%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.97%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.97%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.97%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.98%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.98%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.98%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.98%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.98%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.98%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.99%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.99%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.99%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.99%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.99%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.99%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.99%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300003993Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005204Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2EnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009171Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011333Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300023266Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025955Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026315Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033485Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_AEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300034149Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KansclcFeb2_043664902124908045SoilMKKFLLVGVLSLVAGGCASVHSPYDRYTWCLEMGSGRLTSIGAKAHDPATCDKELDEDLADRTPKILYVPRDLAMTPVLTARGLWVLLGMTVPPF
KansclcFeb2_101866802124908045SoilMIKFIVISAVFLLCGCASMHSPYDLNKWCRQMGSTRLTSIGPEAQDPATCERELDEDLADRTPRILYVPRDVVMSPVIAARAVWVFLGMTRPPF
ICChiseqgaiiDRAFT_236552433300000033SoilMTKLFVVALILFLTAGCATLHSPYDLHTWCLEMGSARLTSIGAKAHDPANCDKELEEDLADRTPRILYVVRDVAMSPVLSARGLWVILGMTEPPF*
F24TB_1201451423300000550SoilMHSPYDLNKWCRQMGSTRLTSIGPEAQDPATCERELDEDLADRTPRILYVPRDVVMSPVIAARAVWVFLGMTRPPF*
F14TC_10832606723300000559SoilMKKLLLVVGLISLVSAGCSSMHSPYDLHTWCLQMGSSRLTSIGAKAHDQANCDKELDEDLADRTPKILYVPRDLAMAPVLGARGLWILLGMTEPPF*
JGI11643J11755_1139379123300000787SoilMTKLLVVALLLFLTAGCATLHSPYDLHTWCLEMGSARLTSIGAKAHDPANCDKELEEDLADRTPRILYVVRDVAMSPVLSARGLWVILGMTEPPF*
JGI10216J12902_11257159613300000956SoilMKKLLLVGVLSLVAGGCASVHSPYDRYTWCLEMGSGRLTSIGAKAHDPATCDKELDEDLADRTPKILYVPRDLAMTPVLTARGLWVLLGMTVPPF*
Ga0055468_1000347013300003993Natural And Restored WetlandsMQRLIAIGCLFFFPGCASMLSPYDLYDWCAHMGSSRLTSIGATAHDPANCEKELEEDLADPTPRILYVPRDV
Ga0055468_1022113113300003993Natural And Restored WetlandsMKRLIAIAWLVLASGCASMHSPYDLYDWCVDMGSPRLTSLGPAAHDPATCASEFKEDLADRTPRILYVPRDVIMSPVIAARTVWGVIGLTEPPF*
Ga0062589_10092034613300004156SoilMTKLFVVALLLFFNAGCATLHSPYDLHTWCLEMGSARLTSIGAKAHDPANCDKELEEDLADRTPRILYVVRDVAMSPVLSARGLWVILGMTEPPF*
Ga0063356_10047940113300004463Arabidopsis Thaliana RhizosphereMKNLLLLVGLISLVSAGCSSMHSPYDLHTWCLQMGSSRLTSIGAKAHDQANCDKELDEDLADRTPKILYVPRDLAMAPVLGARGLWILLGMTEPPF*
Ga0062591_10161785413300004643SoilAGCATVHSPYDLHTWCLQMGSTRLTSIGAKAHDPANCDKELEEDLADRTPKILYVPRDVVMSPVLAARGVWVLLGMTEPPF*
Ga0066674_1001561643300005166SoilMKKLVVISALFFLSACASMHSPYDLHDWCLRMGSTRLTSIGSKAQDPVTCGNELEEDLADPTPRILYAPRDVAMSPVIAARGVWVLLGMTRPPF*
Ga0066672_1018236923300005167SoilMKKLVVISALFVLSACASMHSPYDLHDWCLRMGSTRLTSIGSKAQDPATCGNELEEDLADPTPRILYAPRDVAMSPVIAARGVWVLLGMTRPPF*
Ga0066683_1009001723300005172SoilMRDSFRPDLKGIAVLIKFIVISAVFLLCGCASMHSPYDLNKWCRQMGSTRLTSIGPEAQDPATCERELDEDLADRTPRILYVPRDVVMSPVIAARAVWVFLGMTRPPF*
Ga0066680_1000459613300005174SoilMKKLVVISALFVLSACASMHSPYDLHDWCLRMGSTRLTSIGSKAQDPATCGNELEEDLADPTPRILYAPRDVAMSPV
Ga0066676_1009580013300005186SoilMKKLVVISALFFLSACASMHSPYDLHDWCLRMGSTRLTSIGPKAQDPVTCGNELEEDLADPTPRILYAPRDVAMSPVIAARGVWVLLGMTRPPF*
Ga0066676_1078611913300005186SoilMKKLVVISALFVLSACASMHSPYDLHDWCLRMGSTRLTSIGSKAQDPATCGNELEEDLADPTPRILYAPRDVAMSPVIAARGVWVLLGMTRPPLDIRHETARRHPTARRKQNRQS
Ga0068997_1010409623300005204Natural And Restored WetlandsMKGLIGVALLVVVSGCASMHSPHDLYDWCVTMGSPRLGSIGPTAQNPTNCDKELKEDLADGTPRILYVPRDVLMSPVVAARGLWVALGMTRPPF*
Ga0070700_10112031823300005441Corn, Switchgrass And Miscanthus RhizosphereMKKIILVSSLLLFCGCAAVHSPYDLYTWCQNMGSSRLSSIGAKAQDPATCNTELDEDLADRTPRILYIPRDVAMSPVIAARVIWVALGMTEPP
Ga0066686_1021736623300005446SoilMRDSFRPDLKGIAVLIKFIVISAVFLLCGCASMHSPYDLNKWCRQMGSTRLTSIGPEAQDPATCERELDEDLADRTPRILYVPRDVVMSRL*
Ga0066689_1005238623300005447SoilMKKLVVISALFVLSACASMHSPYDLHDWCLRMGSTRLTSIGSKAQDPATCGNELEEDLADPTPRILYAPRDVAMSPVIAVRGVWVLLGMTRPPF*
Ga0066695_1006698223300005553SoilMKKLVVISALFFLSACASIHSPYDLHDWCLRMGSTRLTSIGSKAQDPVTCGNELEEDLADPTPRILYAPRDVAMSPVIAARGVWVLLGMTRPPF*
Ga0066695_1069418123300005553SoilMKKLVVISALFFLSACASMHSPYDLHEWCLRMGSPRLTSIGSKAQDPVTCGKELEEDLADPTPRILYAPRDVAMSPVIAARGVWVLLYDAAAVLDIRHE
Ga0081455_1001561153300005937Tabebuia Heterophylla RhizosphereMRIQILNEGENMKTLIAIGCLFFVCGCASLHSPYDLHEWCVIMGSTRLASVGPKAQDPMNCHRQLDEDLADSTPRILYAPRDVVMIPVITARALWTVLGRTQPPF*
Ga0081538_1006608533300005981Tabebuia Heterophylla RhizosphereMNRLIAISSLLFISGCASIHSPYDLYEWCVDVGSSRLTSIGRAAHNPATCERELEEDLNDQTPRLLYVPRDVIMTPVTAARLTWGLLALTRPPF*
Ga0075417_1004021633300006049Populus RhizosphereMIKFIVISAVFLLCGCASMHSPYDLNKWCRQMGSTRLTSIGPEAQDPATCERELDEDLADRTPRILYVPRDVVMSPVIAARAVWVFLGMTRPPF*
Ga0079037_10025205123300006224Freshwater WetlandsMKGLIGVALLVVVSGCASMHSPHDRYDWCVTMGSPRLGSIGPRAQNPANCEKELNEDLADGTPRILYVPRDVLMSPVIAARGLWVALGMTRPPF*
Ga0066653_1030279513300006791SoilNMKKLVVISALFFLSACASMHSPYDLHDWCLRMGSPRLTSIGSKAQDPANCGKELEEDLADPTPRILYAPRDVAMSPVIAARGVWVLLGMTRPPF*
Ga0066659_1035872113300006797SoilMKKLVVISALFVLSACASMHSPYDLHDWCLRMGSTRLTSIGSKAQDPATCGNELEEDLADPTPRILYAPRDVTMSPVMQPEVYGFYSV*
Ga0105107_1056035523300009087Freshwater SedimentMMKEAMKRLLVAGLLLVTAGCATVHSPYDLHTWCHQMGSTRLASMGAKAHDPANCDKELEGDLADRTPRILYVPRDVAMSPVLAARGLWVLLGMTKPPF*
Ga0066709_10189312123300009137Grasslands SoilMKKLVVISWLFLSACASMHSPYDLHEWCLRMGSPRLTSIGSKAQDPANCGKELEEDLADPTPRILYAPRDVAMSPVIAARGVWVLLGMTRPPF*
Ga0114129_1005486833300009147Populus RhizosphereMKKLIVIGLLLSVFAGCASIHSPYDLYTWCLQMGSARLTSIGEKAHDPANCDKELEEDLADRTPRILYAPRDVVMSPVVAARGVWALLGMTEPPF*
Ga0114129_1043254233300009147Populus RhizosphereVISAVFLLCGCASMHSPYDLNKWCRQMGSTRLTSIGPEAQDPATCERELDEDLADRTPRILYVPRDVVMSPVIAARAVWVFLGMTRPPF*
Ga0105092_1013436413300009157Freshwater SedimentISCLFFFSGCASLHSPYDLHDWCVLMGSPRLASIGPEAQDPKNCSKELDEDLADSTPRILYAPRDIAMSPVIAARALWTLLGRTQPPF*
Ga0075423_1018181313300009162Populus RhizosphereMKKLIVIGLLLSVSAGCASIHSPYDLYTWCLQMGSARLTSIGEKAHDPANCDKELEEDLADRTPRILYAPRDIVMSPVVAARGVWALLGMTEPPF*
Ga0113563_1061479223300009167Freshwater WetlandsMTKLVVVSILLLVTGGCASVHSPYDLHTWCLQMGSARLTSIGAKAHDPVNCDKELEEDLADRTPRILYVPRDVVMSPVIGARGFWALLGLTEPPF*
Ga0105101_1065916013300009171Freshwater SedimentMMKEAMKRLLVAGLLLVTAGCATVHSPYDLHTWCHQMGSTRLASMGAKAHDPANCDKELEEDLADPTPRILYVPRDVAMSPVLAARGLWVLLGMTKPPF*
Ga0126307_1049344523300009789Serpentine SoilSMHSPYDLHTWCLQMGSSRLTSIGAKAHDQANCDKELDEDLADRTPKILYVPRDLAMAPVLGARGLWILLGMTEPPF*
Ga0126304_1028058823300010037Serpentine SoilMKKLLLVVGLISLVSAGCSSMHSPYDLHTWCLQMGSSRLTSIGAKAHDQANCDKELDEDLADRTPKILYVPRDLAMAPVLGARGLWVLLGMTEPPF*
Ga0134122_1130206013300010400Terrestrial SoilMKDAMKRFVFVVGLLLFVTAGCATVHSPYDLHTWCLEMGSSRLTSIGAKAHDPANCDRELEEDLADRTPRILYVPRDVVMSPVLGARGLWVLLGMTDPPF*
Ga0127502_1008497913300011333SoilMKKLIAIGWLVFASGCASMHSPYDLYDWCAHMGSPRLASLGPAAHDPTTCAREFEEDLADRTPRILYVPRDVVMSPVIAARAVWGLIGLTEPPF*
Ga0137365_1046791223300012201Vadose Zone SoilMKKLVVISALFFLSACASMHSPYDLHDWCLRMGSTRLTSIGSKAQDPVTCGKELEEDLADPTPRILYAPRDVAMSPVIAVRGVWVLLGMTRLPF*
Ga0137380_1003828023300012206Vadose Zone SoilMKKPVVISALFVLSACASMHSPYDLHDWCLRMGSTRLTSIGPKAQDPVTCGNELEEDLADPTPRILYAPRDVAMSPVIAARGVWVLLGMTRPPF*
Ga0137376_1061914313300012208Vadose Zone SoilMKKLVVISWLFFLSACASIHSPYDLHDWCLRMGSPRLTSIGSKAQDPVTCGNELEEDLADPTPRILYAPRDVAMSPVIAARGVWVLLGMTRPPF*
Ga0137371_1015684413300012356Vadose Zone SoilMKKLVVISALFFLSACASIHSPYDLHDWCLRMGSTRLTSIGSKAQDPVTCGKELEEDLADPTPRILYAPRDVAMSPVIAARGVWVLLGMTRPPF*
Ga0137375_1007157523300012360Vadose Zone SoilMKLIVISCLFLVCGCASMHSPHDLHRWFHLMGSTRLTSIGPQAQDPATCEREFEEDLADGTPRILYVPRDVVMSPVIAARTLWVSFGMTRPPF*
Ga0137397_1026071813300012685Vadose Zone SoilMKKLIVIGLLLSVSVGCASIHSPYDLYTWCLQMGSARLTSIGEKAHDPANCDKELEEDLADRTPRILYAPRDVVMSPVVAARGVWVLLGMTEPPF*
Ga0137394_1006654623300012922Vadose Zone SoilMKKLIVIGLLLSVSVGCASIHSPYDLYTWCLQMGSARLTSIGEKAHDPANCDKELEEDLADRTPRILYAPRDVVMSPVVAARGVWALLGMTEPPF*
Ga0137359_1045524913300012923Vadose Zone SoilMKKLIVIGLLLSVSAGCASIHSPYDLYTWCLQMGSARLTSIGEKAHDPANCDKELEEDLADRTPRILYAPRDVVMSPVVAARGVWALLGMTEPPF*
Ga0153915_1006526543300012931Freshwater WetlandsMKGLIGVALLVVISGCASMHSPHDLYDWCVTMGSPRLGSIGPTAQNPANCEKELKEDLADGTPRILYVPRDVVMSPVIAARGLWVALGMTRPPF*
Ga0153915_1032356723300012931Freshwater WetlandsMLKLIVIGLLLLLSGGCASILSPYDRHTWCLEGGSLRLESIGEKAHDPAQCDKELQEDLADRTPRILYVPRDIIMSPFIAARGVWTLLGMTEPPF*
Ga0163162_1070180523300013306Switchgrass RhizosphereMKKIILVSSLLLFCGCAAVHSPYDLYTWCQNMGSSRLSSIGAKAQDPATCNTELDEDLADRTPRILYIPRDVAMSPVIAARVIWVALGMTEPPF*
Ga0187825_1009603113300017930Freshwater SedimentMMKKIIVVASLFLLSSGCASLHSPYDLHTWCLQMGGSTRLTSIGEKAHDPATCDKELEEDLADRTPRILYVPRDIAMSPVLLARGVWALLGRTEPPF
Ga0187821_1027111413300017936Freshwater SedimentMMKKIIVVASLFLLSSGCASLHSPYDLYTWCLQMGGSTRLTSIGEKTRDPATCDKELEEDLADRTPRILYVPRDVAMSPVLLARGVWALLGRTEPPF
Ga0184610_115679823300017997Groundwater SedimentMKLIVISSLFLVCGCASMHSPHDLHRWCHLMGSTRLTSIGPQAQDPATCEKEFEEDLADGTPRILYVPRDVVMSPIIAARTLWVSFGMTRPPF
Ga0184604_1004531023300018000Groundwater SedimentMMKLIVFSSLFLVCGCASMHSPHDLHRWCHLMGSTRLTSIGPQAQDPTTCEREFEEDLADGTPRILYVPRDVVMSPVIAARTLWVSFGMTRPPF
Ga0184608_1006468623300018028Groundwater SedimentMKLIVISSLFLVCGCASMHSPHDLHRWCHLMGSTRLTSIGPQAQDPATCEREFEEDLADGTPRILYVPRDVVMSPVIAARTLWVSFGMTRPPF
Ga0187788_1004124423300018032Tropical PeatlandMKNLMMVASLLLVSSGCASIHSPYDLHTWCLRMGGSSRLTSIGEKAHDPANCEKELDEDLADNTPRILYVPRDVVMSPVILARGVWALLGKTQAPF
Ga0184621_1005613033300018054Groundwater SedimentMKLIVISSLFLVCGCASMHSPHDLHRWCHLMGSTRLTSIGPQAQDPATCEKEFEEDVADGTPRILYIPRDLVMSPVIAARAVWVSFGMTRPPF
Ga0184617_116450513300018066Groundwater SedimentMKLIVISSLFLVCGCASMHSPHDLHRWCHLMGSTRLTSIGPQAQDPTTCEREFEEDLADGTPKILYVPRDVVMSPVIAARTLWVSFGMTRPPF
Ga0184618_1002457643300018071Groundwater SedimentMMKLIVISSLFLLCGCASMHSPYDLHRWCHLMGSTRLTSIGPQAQDPATCEKEFEEDLADGTPRILYIPRDVVMSPVIAARVVWVSFGMTQPPF
Ga0184618_1044717713300018071Groundwater SedimentMVEVLKVPGRNIHMKKIILISSLLLFCGCAAVHSPYDLYTWCQDMGSSRLSSIGPKAQDPATCDRELDEDLADRTPRILYVPRDIAMSPVIGARAVWVFLGMTQPPF
Ga0184632_1023599423300018075Groundwater SedimentMKLIVISSLFLVCGCASMHSPHDLHRWCHLMGSTRLTSIGPQAQDPATCEREFEEDLADGTPRILYVPRDVVMSPVIAARTLWVSFGMTQPPF
Ga0187774_1007358833300018089Tropical PeatlandMKNLMMVASLLLVSSGCASIHSPYDLHTWCLRMGGSSRLTSIGEKAHDPANCEKELDEDLADNTPRILYVPRDVVMSPVILARGVWALLGKTQPPF
Ga0066655_1136128623300018431Grasslands SoilLLAMRDSFRPDLKGIAVLIKFIAISAVFLLCGCASMHSPYDLNKWCRQMGSTRLTSIGPEAQDPATCERELDEDLADRTPRILYVPRDVVMSPVIAARAVWVFLGMTRPPF
Ga0066667_1017165813300018433Grasslands SoilMKKLVVISALFVLSACASMHSPYDLHDWCLRMGSTRLTSIGSKAQDPATCGNELEEDLADPTPRILYAPRDVAMSPVIAVRGVWVLLGMKRPPF
Ga0190274_1161302623300018476SoilMKNLLLVGVLSLVAGGCASVHSPYDRYTWCLEMGSGRLTSIGAKAHDPATCDKELDEDLADRTPKILYVPRDLAMTPVLTARGLWVLLGMTVPPF
Ga0137408_139687813300019789Vadose Zone SoilMRDSFRPDLKGIAVLIKFIVISAVFLLCGCASMHSPYDLNKWCRQMGSTRLTSIGPEAQDPATCERELDEDLADRTPRILYVPRDVVMSPVIAARAVWVFLGMTRPPF
Ga0247789_105953523300023266SoilMKKLFVVGLLFVTAGCATVHSPYDLHTWCLQMGSTRLTSIGAKAHDPANCDKELEEDLADRTPKILYVPRDVAMSPVLGARGLWVLLGMTEPPF
Ga0207701_1060331713300025930Corn, Switchgrass And Miscanthus RhizosphereMKKIILVSSLLLFCGCAAVHSPYDLYTWCQNMGSSRLSSIGAKAQDPATCNTELDEDLADRTPRILYIPRDVAMSPVIAARVIWVALGMTEPPF
Ga0210071_102106623300025955Natural And Restored WetlandsMKGLIGVALLVVVSGCASMHSPHDLYDWCVTMGSPRLGSIGPTAQNPTNCDKELKEDLADGTPRILYVPRDVLMSPVVAARGLWVALGMTRPPF
Ga0209235_128616213300026296Grasslands SoilMKKLVVISALFVLSACASMHSPYDLHDWCLRMGSTRLTSIGSKAQDPATCGNELEEDLADPTPRILYAPRDVAMSPVIAVRGVWVLLGMTRPPF
Ga0209686_102469013300026315SoilMKKLVVISALFVLSACASMHSPYDLHDWCLRMGSTRLTSIGSKAQDPATCGNELEEDLADPTPRILYAPRDVAMSPVIAARGVWVLL
Ga0209472_100990443300026323SoilMKKLVVISALFFLSACASMHSPYDLHDWCLRMGSTRLTSIGPKAQDPVTCGNELEEDLADPTPRILYAPRDVAMSPVIAARGVWVLLGMTRPPF
Ga0209801_101385643300026326SoilMKKLVVISALFVLSACASMHSPYDLHDWCLRMGSTRLTSIGSKAQDPATCGNELEEDLADPTPRILYAPRDVAMSPVIAARGVWVLLGMTRPPF
Ga0209375_101964523300026329SoilMKKLVVISALFFLSACASIHSPYDLHDWCLRMGSTRLTSIGSKAQDPVTCGNELEEDLADPTPRILYAPRDVAMSPVIAARGVWVLLGMTRPPF
Ga0209159_124370713300026343SoilMKKLVVISALFFLSACASMHSPYDLHDWCLRMGSTRLTSIGSKAQDPVTCGNELEEDLADPTPRILYAPRDVAMSPVIAARGVWVLLGMTRPPF
Ga0209474_1042397223300026550SoilMKKLVVISALFFLSACASMHSPYDLHDWCLRMGSTRLTSIGSKAQDPVTCGNELEEDLADPTPRILYAFRDVAMSPVIAARGVWVLLGMTRPPF
Ga0307302_1052719013300028814SoilMKLIVISSLFLVCGCASMHSPHDLHRWCHLMGSTRLTSIGPQAQDPATCEREFEEDLADGTPRILYVPRDVVMSPVIAARTLWVS
Ga0299907_1006830723300030006SoilMKRLIAIGCLFFFPGCASMHSPYDLYDWCAHMGSSRLTSIGATAHNPANCEKELEEDLADPTPRILYVPRDVAMSPVITARTLWAMLGRTRPPF
Ga0268386_1054525113300030619SoilMKRLIAIGCLIFFPGCASMHSPYDLYDWCAHMGSSRLTSIGATAHNPANCEKELEEDLADPTPRILYVPRDVAMSP
Ga0307497_1007162323300031226SoilLEERITDEMKKLFVVGLLFVTAGCATVHSPYDLHTWCLQMGSTRLTSIGAKAHDPANCDKELEEDLADRTPKILYVPRDVAMSPVLGARGLWVLLGMTEPPF
Ga0310888_1090271923300031538SoilMKNLLLLVGLISLVSAGCSSMHSPYDLHTWCLQMGSSRLTSIGAKAHDQANCDKELDEDLADRTPKILYVPRDLAMAPVL
Ga0310892_1137769113300031858SoilMKKLFFVVGLISLVSAGCSSMHSPYDLHTWCLQMGSSRLTSIGAKAHDQANCDKELDEDLADRTPKILYVPRDLAMAPVLGARGLWILLGMTEPPF
Ga0307406_1195107013300031901RhizosphereMKKFFFVVGLISLVSAGCSSMHSPYDLHTWCLQMGSSRLTSIGAKAHDQANCDKELDEDLADRTPKILYVPRDLAMAPVLGARGLWILLGMTEPPF
Ga0310900_1158736313300031908SoilVMKKLFFVVGLISLVSAGCSSMHSPYDLHTWCLQMGSSRLTSIGAKAHDQANCDKELDEDLADRTPKILYVPRDLAMAPVLGARGLWILLGMTEPPF
Ga0307412_1007034533300031911RhizosphereMHSPYDLHTWCLQMGSSRLTSIGAKAHDQANCDKELDEDLADRTPKILYVPRDLAMAPVLGARGLWILLGLTEPPF
Ga0214473_1090290013300031949SoilMKGLRAVALLVVVSGCASIHSPHDLYDWCVRMGSPRLGSIGPTAQNPANCEKELKEDLADGTPRILYVPRDVLMSPVIAARGLWVALGMTRPPF
Ga0307409_10045279023300031995RhizosphereMHSPYDLHTWCLQMGSSRLTSIGAKAHDQANCDKELDEDLADRTPKILYVPRDLAMAPVLGARGLWILLGMTEPPF
Ga0315910_1020211613300032144SoilLPEFQNGLRYMKFFAISSLVLLSGCASMHSPNDLHEWCQVMGSTRLTSIGPNAQDPANCDRELEEDLADRTPRILYVPKDVVMSPVIAARAVWVFLGMTRPPF
Ga0315912_1039794123300032157SoilVMKKLLLVVGLISLVSAGCSSMHSPYDLHTWCLQMGSSRLTSIGAKAHDQANCDKELDEDLADRTPKILYVPRDLAMAPVLGARGLWVLLGMTEPPF
Ga0335070_1121584413300032829SoilSGSLEKEKGMKKLLMIGLLSLVCGGCGAMYSPYDLHTWCLWMGSTRVTSVGPKAHDPATCDKELAEDLDDHTPRILYVPRDVIMAPVTTARSMWVLLGWTQPPF
Ga0316605_1069375713300033408SoilMTKLVVVSILLLVTGGCASVHSPYDLHTWCLQMGSARLTSIGAKAHDPVNCDKELEEDLADRTPRILYVPRDVVMSPVIGARGFWALLGLTEPPF
Ga0316619_1218432213300033414SoilVVSILLLVTGGCASVHSPYDLHTWCLQMGSARLTSIGAKAHDPVNCDKELEEDLADRTPRILYVPRDVVMSPVIGARGFWALLGLTEPPF
Ga0326726_1022529123300033433Peat SoilMKTLFVAGLLLFVTAGCATVHSPYDLHTWCLDMGSTRLTSIGAKAHDPANCDKELQEDLADNTPRILYVPRDVIMSPVLAARGVWVLLGMTEPPF
Ga0326726_1108415523300033433Peat SoilMKDAMKKLFVVGFLLFVTAGCATVHSPYDLHTWCLQMGSTRLTSIGAKAHDPANCDKELDEDLADRTPRILYVPRDVVMSPVLGARGLWVLLGMTDPPF
Ga0316627_10272010213300033482SoilMTKLVVVSILLFVTGGCASVHSPYDLHTWCLQMGSARLTSIGAKAHDPVNCDKELEEDLADRTPRILYVPRDVVMSPVIGARGFWALLGLTEPPF
Ga0316626_1004642333300033485SoilMKGLIGVALLVVVSGCASMHSPHDLYDWCVTMGSPRLGSIGPTAQNPANCEKELKEDLADGTPRILYVPRDVVMSPVIAARGLWVALGMTRPPF
Ga0316624_1041345623300033486SoilMMKKIIVVASLFLLSSGCASLHSPYDLHTWCLQMGGSTRLTSIGEKTHDPATCDKELEEDLADRTPRILYVPRDIAMSPVLLARGVWALLGRTEPPF
Ga0364929_0080434_89_4123300034149SedimentMSSKILAIGRNIHMKKIILVSSLLLFCGCAAVHSPYDLYTWCQNMGSSRLSSIGAKAQDPATCNTELDEDLADRTPRILYIPRDVAMSPVIAARVIWVALGMTEPPF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.