| Basic Information | |
|---|---|
| Family ID | F103503 |
| Family Type | Metagenome |
| Number of Sequences | 101 |
| Average Sequence Length | 50 residues |
| Representative Sequence | TERSSKHGLGWIEPELMQKTMDITFATAKPDKPMALADVFTNEYSSRIKP |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.07 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.267 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil (13.861 % of family members) |
| Environment Ontology (ENVO) | Unclassified (56.436 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (53.465 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF07759 | DUF1615 | 26.73 |
| PF13560 | HTH_31 | 24.75 |
| PF01042 | Ribonuc_L-PSP | 4.95 |
| PF00106 | adh_short | 2.97 |
| PF02780 | Transketolase_C | 1.98 |
| PF13343 | SBP_bac_6 | 1.98 |
| PF00561 | Abhydrolase_1 | 0.99 |
| PF03009 | GDPD | 0.99 |
| PF01261 | AP_endonuc_2 | 0.99 |
| PF01970 | TctA | 0.99 |
| PF01638 | HxlR | 0.99 |
| PF07969 | Amidohydro_3 | 0.99 |
| PF08668 | HDOD | 0.99 |
| PF07908 | Obsolete Pfam Family | 0.99 |
| PF13280 | WYL | 0.99 |
| PF00135 | COesterase | 0.99 |
| PF00440 | TetR_N | 0.99 |
| PF00793 | DAHP_synth_1 | 0.99 |
| PF07287 | AtuA | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 4.95 |
| COG0584 | Glycerophosphoryl diester phosphodiesterase | Lipid transport and metabolism [I] | 0.99 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.99 |
| COG1784 | TctA family transporter | General function prediction only [R] | 0.99 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.99 |
| COG3333 | TctA family transporter | General function prediction only [R] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.27 % |
| Unclassified | root | N/A | 26.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_107948032 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300000956|JGI10216J12902_109459406 | Not Available | 777 | Open in IMG/M |
| 3300003991|Ga0055461_10145224 | Not Available | 622 | Open in IMG/M |
| 3300004282|Ga0066599_100778946 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300005328|Ga0070676_11340093 | Not Available | 548 | Open in IMG/M |
| 3300005330|Ga0070690_100877002 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 700 | Open in IMG/M |
| 3300005331|Ga0070670_100140692 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2086 | Open in IMG/M |
| 3300005331|Ga0070670_101973561 | Not Available | 538 | Open in IMG/M |
| 3300005333|Ga0070677_10029134 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2091 | Open in IMG/M |
| 3300005333|Ga0070677_10769533 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 547 | Open in IMG/M |
| 3300005334|Ga0068869_101902631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 533 | Open in IMG/M |
| 3300005338|Ga0068868_102155213 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
| 3300005356|Ga0070674_101006241 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 732 | Open in IMG/M |
| 3300005455|Ga0070663_101003979 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 726 | Open in IMG/M |
| 3300005456|Ga0070678_100469074 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1106 | Open in IMG/M |
| 3300005456|Ga0070678_100900881 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 808 | Open in IMG/M |
| 3300005456|Ga0070678_102153477 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
| 3300005457|Ga0070662_101886629 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
| 3300005459|Ga0068867_101018885 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 752 | Open in IMG/M |
| 3300005539|Ga0068853_100753640 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 931 | Open in IMG/M |
| 3300005543|Ga0070672_100172259 | All Organisms → cellular organisms → Bacteria | 1800 | Open in IMG/M |
| 3300005548|Ga0070665_102051883 | Not Available | 577 | Open in IMG/M |
| 3300005617|Ga0068859_102288474 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
| 3300005618|Ga0068864_100036594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4184 | Open in IMG/M |
| 3300005660|Ga0073904_10241527 | Not Available | 1042 | Open in IMG/M |
| 3300006224|Ga0079037_102386899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 528 | Open in IMG/M |
| 3300006237|Ga0097621_101635718 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300006755|Ga0079222_12537401 | Not Available | 515 | Open in IMG/M |
| 3300009078|Ga0105106_11043903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 581 | Open in IMG/M |
| 3300009098|Ga0105245_10036022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4393 | Open in IMG/M |
| 3300009177|Ga0105248_10232571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2075 | Open in IMG/M |
| 3300009177|Ga0105248_11843333 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 686 | Open in IMG/M |
| 3300011119|Ga0105246_10835680 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300012043|Ga0136631_10489899 | Not Available | 504 | Open in IMG/M |
| 3300012046|Ga0136634_10435274 | Not Available | 551 | Open in IMG/M |
| 3300012511|Ga0157332_1070288 | Not Available | 544 | Open in IMG/M |
| 3300012526|Ga0136637_1115378 | Not Available | 929 | Open in IMG/M |
| 3300012684|Ga0136614_10804822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 656 | Open in IMG/M |
| 3300012958|Ga0164299_10284366 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1007 | Open in IMG/M |
| 3300012958|Ga0164299_10833677 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300014325|Ga0163163_10482432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1301 | Open in IMG/M |
| 3300014326|Ga0157380_11769639 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 677 | Open in IMG/M |
| 3300014745|Ga0157377_10941044 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 649 | Open in IMG/M |
| 3300014866|Ga0180090_1083437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 571 | Open in IMG/M |
| 3300014969|Ga0157376_11057066 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300015373|Ga0132257_102230476 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 709 | Open in IMG/M |
| 3300015374|Ga0132255_105728280 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300017695|Ga0180121_10429010 | Not Available | 516 | Open in IMG/M |
| 3300017787|Ga0183260_10617296 | Not Available | 694 | Open in IMG/M |
| 3300017792|Ga0163161_10882435 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300017965|Ga0190266_10278040 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300018476|Ga0190274_11499871 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300018920|Ga0190273_11629937 | Not Available | 578 | Open in IMG/M |
| 3300019142|Ga0193597_1151703 | Not Available | 690 | Open in IMG/M |
| 3300020157|Ga0194049_1028278 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1448 | Open in IMG/M |
| 3300020192|Ga0163147_10493924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 580 | Open in IMG/M |
| 3300021601|Ga0194061_1152437 | Not Available | 689 | Open in IMG/M |
| 3300022204|Ga0224496_10107910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1210 | Open in IMG/M |
| 3300025271|Ga0207666_1058254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300025321|Ga0207656_10711827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Collimonas → Collimonas fungivorans | 514 | Open in IMG/M |
| 3300025904|Ga0207647_10784273 | Not Available | 514 | Open in IMG/M |
| 3300025909|Ga0207705_10999931 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 646 | Open in IMG/M |
| 3300025920|Ga0207649_10487937 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 935 | Open in IMG/M |
| 3300025925|Ga0207650_11267562 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300025925|Ga0207650_11357462 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300025932|Ga0207690_10591194 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300025933|Ga0207706_10225263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1641 | Open in IMG/M |
| 3300025936|Ga0207670_10332575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → unclassified Ramlibacter → Ramlibacter sp. Leaf400 | 1198 | Open in IMG/M |
| 3300025937|Ga0207669_10751235 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 805 | Open in IMG/M |
| 3300025938|Ga0207704_11225783 | Not Available | 640 | Open in IMG/M |
| 3300025940|Ga0207691_10922423 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 730 | Open in IMG/M |
| 3300025940|Ga0207691_11167816 | Not Available | 639 | Open in IMG/M |
| 3300026023|Ga0207677_10915198 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300026023|Ga0207677_11842028 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 562 | Open in IMG/M |
| 3300026067|Ga0207678_11970613 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
| 3300027979|Ga0209705_10626134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 512 | Open in IMG/M |
| 3300028381|Ga0268264_11150357 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300028587|Ga0247828_10336785 | Not Available | 846 | Open in IMG/M |
| 3300028592|Ga0247822_11600122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Collimonas → Collimonas fungivorans | 552 | Open in IMG/M |
| 3300028596|Ga0247821_11269401 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300028597|Ga0247820_10702408 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300028608|Ga0247819_10625188 | Not Available | 651 | Open in IMG/M |
| 3300028812|Ga0247825_10739392 | Not Available | 709 | Open in IMG/M |
| 3300028812|Ga0247825_10764016 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 697 | Open in IMG/M |
| 3300028889|Ga0247827_11237209 | Not Available | 519 | Open in IMG/M |
| 3300030336|Ga0247826_10293982 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1161 | Open in IMG/M |
| 3300031538|Ga0310888_10214125 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300031548|Ga0307408_101452411 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 647 | Open in IMG/M |
| 3300031731|Ga0307405_10068184 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2276 | Open in IMG/M |
| 3300031731|Ga0307405_11087007 | Not Available | 687 | Open in IMG/M |
| 3300031740|Ga0307468_101062075 | Not Available | 718 | Open in IMG/M |
| 3300031852|Ga0307410_11211501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquincola → unclassified Aquincola → Aquincola sp. J276 | 658 | Open in IMG/M |
| 3300032002|Ga0307416_102368338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 631 | Open in IMG/M |
| 3300032012|Ga0310902_10287014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → unclassified Ramlibacter → Ramlibacter sp. Leaf400 | 1008 | Open in IMG/M |
| 3300032074|Ga0308173_12052665 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 539 | Open in IMG/M |
| 3300032126|Ga0307415_101405215 | Not Available | 665 | Open in IMG/M |
| 3300033413|Ga0316603_12112458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 532 | Open in IMG/M |
| 3300033483|Ga0316629_10048310 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2107 | Open in IMG/M |
| 3300033550|Ga0247829_10126448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → unclassified Ramlibacter → Ramlibacter sp. | 1963 | Open in IMG/M |
| 3300033551|Ga0247830_10659377 | Not Available | 830 | Open in IMG/M |
| 3300034128|Ga0370490_0331429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 507 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 13.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 7.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 6.93% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 5.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 5.94% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 5.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 2.97% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.98% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.98% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.98% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.99% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.99% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.99% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.99% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.99% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.99% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.99% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.99% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.99% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003991 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005660 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_precipitate | Engineered | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
| 3300012046 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06) | Environmental | Open in IMG/M |
| 3300012511 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10 | Environmental | Open in IMG/M |
| 3300012526 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ857 (21.06) | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014866 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT890_16_10D | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
| 3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019142 | Soil crust microbial communities from Colorado Plateau, Utah, USA - mid late stage, 3 min after wetting v1 | Environmental | Open in IMG/M |
| 3300020157 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L224-25m | Environmental | Open in IMG/M |
| 3300020192 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica- Oligotrophic Lake LV.19.MP6.G1 | Environmental | Open in IMG/M |
| 3300021601 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L224-21m | Environmental | Open in IMG/M |
| 3300022204 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034128 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1079480321 | 3300000956 | Soil | IEPELMQKTMDITFANAKPDKPIAVNEVFTNQFSSKVKP* |
| JGI10216J12902_1094594062 | 3300000956 | Soil | GWIEPELMQKTMDITFANAKPDKPVALNDVFTNQFSSKVKP* |
| Ga0055461_101452242 | 3300003991 | Natural And Restored Wetlands | LGWIEPELMQKTMDITFANNKPEKALAVNDVFTNQYSSRIKP* |
| Ga0066599_1007789462 | 3300004282 | Freshwater | LCVTERSSKHGLGWIEPELMQKTMDITFATTKPDKPMVLADVFTNEYSSRIKP* |
| Ga0070676_113400932 | 3300005328 | Miscanthus Rhizosphere | SKHGLGWIEPELMQKTMDITFATAKPDKPMALADVFTNEYSSRIKP* |
| Ga0070690_1008770022 | 3300005330 | Switchgrass Rhizosphere | TERSSKYGLGWIEPELMQKTMDITFATAKPDKPMALADVFTNDYNSRIKP* |
| Ga0070670_1001406924 | 3300005331 | Switchgrass Rhizosphere | VTERSSKHGLGWIEPELMQKTMDITFATAKPDKPMVLADVFTNEYNSRIKP* |
| Ga0070670_1019735612 | 3300005331 | Switchgrass Rhizosphere | GLGWIEPELMQKTMDITFATAKPDKPMALADVFTNEYSSRIKP* |
| Ga0070677_100291341 | 3300005333 | Miscanthus Rhizosphere | ATMPAILDLCVTERSSKHGLGWIEPELMQKTMDITFATAKPDKPMALADVFTNEYSSRIKP* |
| Ga0070677_107695331 | 3300005333 | Miscanthus Rhizosphere | ATMPAILDLCVTERSSKHGLGWIEPELMQKTMDITFATAKSDKPMVLADVFTNEYSSRIKP* |
| Ga0068869_1019026311 | 3300005334 | Miscanthus Rhizosphere | RSAKHGMGWIEPELMQKTMDITFANAKPDKPVAVNDVFTNQFSSKVKP* |
| Ga0068868_1021552132 | 3300005338 | Miscanthus Rhizosphere | GLGWIEPELMQKTMDITFATAKPDKPMALADVFTNDYSSRIKP* |
| Ga0070674_1010062411 | 3300005356 | Miscanthus Rhizosphere | YGLGWMEPELMQKTMEITFATAKPDKPIVLSEVFTNEYSSRIKP* |
| Ga0070663_1010039792 | 3300005455 | Corn Rhizosphere | EPELMQKTMDITFATAKPDKPMALADVFTNDYSSRIAVIAALP* |
| Ga0070678_1004690742 | 3300005456 | Miscanthus Rhizosphere | MPAILDLCVTERSSKHGLGWIEPELMQKTMDITFATAKPDKPMVLADVFTNEYNSRIKP* |
| Ga0070678_1009008811 | 3300005456 | Miscanthus Rhizosphere | VTERSSKHGLGWIEPELMQKTMDITFANAKPDRPMVLADVFTNEYSSRVKP* |
| Ga0070678_1021534771 | 3300005456 | Miscanthus Rhizosphere | LCVTERSAKNGLGWIETDLMQKTMDITFATAKPEKPLAVADVFTNQFSSKIKP* |
| Ga0070662_1018866291 | 3300005457 | Corn Rhizosphere | LDLCVTERSSKYGLGWMEPELMQKTMEITFATAKPDKPIVLSEVFTNEYSSRIKP* |
| Ga0068867_1010188851 | 3300005459 | Miscanthus Rhizosphere | KNGLGWIETDLMQKTMDITFASAKPEKPLAVADVFTNQFSSQVKP* |
| Ga0068853_1007536402 | 3300005539 | Corn Rhizosphere | IEPELMQKTIDITFATTKPDKPMVLADVFTNDYNSRIKP* |
| Ga0070672_1001722591 | 3300005543 | Miscanthus Rhizosphere | TERSSKHGLGWIEPELMQKTMDITFATAKPDKPMVLADVFTNEYSSRIKP* |
| Ga0070665_1020518832 | 3300005548 | Switchgrass Rhizosphere | YGLGWIEPELMQKTMDITFATAKPDKPMVLADVFTNEYSSRIKP* |
| Ga0068859_1022884742 | 3300005617 | Switchgrass Rhizosphere | GLGWIEPELMQKTIDITFATTKPDKPMVLADVFTNDYNSRIKP* |
| Ga0068864_1000365941 | 3300005618 | Switchgrass Rhizosphere | MQKTMDITFATAKPDKPMVLADVFTNEYSSRIKP* |
| Ga0073904_102415272 | 3300005660 | Activated Sludge | AKHGLGWIEPELMQKTMEITFANAKPDKAFAAADAFTNEFSSRIKP* |
| Ga0079037_1023868991 | 3300006224 | Freshwater Wetlands | TLLATMPQILDLCVTERSAKNGLGWIEPELMQKTMEITFANAKPDKAFAAADAFTNQFSSRIKP* |
| Ga0097621_1016357181 | 3300006237 | Miscanthus Rhizosphere | CVTERSSKYGLGWIEPELMQKTMDITFATAKPDKPMALADVFTNEYSSRIKP* |
| Ga0079222_125374011 | 3300006755 | Agricultural Soil | ELMQKTMDITFASNKPERPVELKDVFTNEFNSRIKP* |
| Ga0105106_110439031 | 3300009078 | Freshwater Sediment | GLGWIEPELMQKTMDITFANTKPDKAFAAADAFTNQFNSRIKP* |
| Ga0105245_100360221 | 3300009098 | Miscanthus Rhizosphere | LGWIEPELMQKTMDITFATAKPDKPMALADVFTNEYSSRIKP* |
| Ga0105248_102325711 | 3300009177 | Switchgrass Rhizosphere | TERSSKYGLGWIEPELMQKTMDITFATAKPDKPMALADVFTNEYSSRIKP* |
| Ga0105248_118433332 | 3300009177 | Switchgrass Rhizosphere | DLCVTERSSKYGLGWIEPELMQKTMDITFATAKPDKPMALADVFTNDYNSRIKP* |
| Ga0105246_108356801 | 3300011119 | Miscanthus Rhizosphere | MPAILDLCVTERSSKYGLGWIEPELMQKTMDITFATAKPDKPMALADVFTNEYSSRIKP* |
| Ga0136631_104898992 | 3300012043 | Polar Desert Sand | CVTERSAKHGLGWIEPELMQKTMDITFSNAKPEKPLAVADVFTNQFSSRIKP* |
| Ga0136634_104352741 | 3300012046 | Polar Desert Sand | TMPQILDLTVTDRSRKHGLGWMEPELMQKTIDITFGSNKPERPLNVADVFTNEFSSKIKP |
| Ga0157332_10702881 | 3300012511 | Soil | LATMPAILDLCVTERSSKHGLGWIEPELMQKTMDITFATAKPDKPMALADVFTNEYSSRIKP* |
| Ga0136637_11153781 | 3300012526 | Polar Desert Sand | TLLATMPQILDLTVTERSAKHGLGWIEPELMQKTMDITFATNKPDKPLVLNDTFTNQFSSKIKP* |
| Ga0136614_108048221 | 3300012684 | Polar Desert Sand | LDLTVTDRSRKHGLGWMEPELMQKTIDITFAGNKPERPMNVADVFTNEFSSKIKPTK* |
| Ga0164299_102843661 | 3300012958 | Soil | TMPAILDLCVTERSSKYGLGWIEPELMQKTIDITFATAKPDKPMVLADVFTNEYSSRIKP |
| Ga0164299_108336771 | 3300012958 | Soil | TLLATMPAILDLCVTERSSKYGLGWIEPELMQKTMDITFATAKPDKPMVLADVFTNEYSSRIKP* |
| Ga0163163_104824323 | 3300014325 | Switchgrass Rhizosphere | YGLGWIEPELMQKTMDITFATARPDKPMVLADVFSNEYSSRIKP* |
| Ga0157380_117696391 | 3300014326 | Switchgrass Rhizosphere | LGWIEPELMQKTMDITFATAKPDKQMVLADEFTKEYSSRIKP* |
| Ga0157377_109410441 | 3300014745 | Miscanthus Rhizosphere | CVTERSSKYGLGWMEPELMQKTMEITFATAKPDKPIVLSEVFTNEYSSRIKP* |
| Ga0180090_10834371 | 3300014866 | Soil | ELMQKTMDITFASAKPEKPLAVADVFTNQFSSKIRP* |
| Ga0157376_110570661 | 3300014969 | Miscanthus Rhizosphere | TERSSKHGLGWIEPELMQKTMDITFATAKPDKPMALADVFTNEYSSRIKP* |
| Ga0132257_1022304762 | 3300015373 | Arabidopsis Rhizosphere | GLGWIEPELMQKTMDITFATAKPDKPMALSEVFTNDYNSRIKP* |
| Ga0132255_1057282802 | 3300015374 | Arabidopsis Rhizosphere | CVTERSSKYGLGWIEPELMQKTMDVTFATAKPDKPMVLVDVFTNDYNSRIKP* |
| Ga0180121_104290102 | 3300017695 | Polar Desert Sand | LTVTDRSRKHGLGWMEAELMQKTMDITFASNKPERPMNVADVFTNEFSSKIKPTK |
| Ga0183260_106172962 | 3300017787 | Polar Desert Sand | LGWIEPELMQKTMDITFGNNNPDKPMVLNDVFTNEFNSRIKP |
| Ga0163161_108824352 | 3300017792 | Switchgrass Rhizosphere | WIEPELMQKTMDITFATAKPDKPMVLADVFTNDYSSRIKP |
| Ga0190266_102780402 | 3300017965 | Soil | SSKHGLGWIEPELMQKTMDITFATAKPDKPMVLADVFSNEYSSRIKP |
| Ga0190274_114998712 | 3300018476 | Soil | CVTERSSKHGLGWIEPELMQKTMDITFATNKPDKPLVLSEVFTNEYSSRIKP |
| Ga0190273_116299371 | 3300018920 | Soil | TMPQILDLCVTERSSRHGMGWIEPELMQKTMEITFASSKPEKPVALEDVFTNDFSSRIRP |
| Ga0193597_11517031 | 3300019142 | Soil | TTLLATMPQILDLCVTERSTKHGLGWIEPELMQKTMDITFATNKPDKALAVNDVFTNQFSSKIKP |
| Ga0194049_10282783 | 3300020157 | Anoxic Zone Freshwater | RSRKHGIGWIEPELMAKTLEITFANTKPDKPVKSEDVFTNAYNSRIKPLK |
| Ga0163147_104939242 | 3300020192 | Freshwater Microbial Mat | GWIETELMQKTMDITFASAKPEKPLAVADVFTNQFSSKIKP |
| Ga0194061_11524372 | 3300021601 | Anoxic Zone Freshwater | LATMPQILDLCITDRSRKHGIGWIEPELMAKTLEITFANTKPDKPVKSEDVFTNAYNSRIKPLK |
| Ga0224496_101079101 | 3300022204 | Sediment | LGWIEPELMQKTMDITFANAKPEKPLSVADVFTNEFSSRIKP |
| Ga0207666_10582541 | 3300025271 | Corn, Switchgrass And Miscanthus Rhizosphere | MPAILDLCVTERSSKHGLGWIEPELMQKTMDITFATAKPDKPMVLADVFTND |
| Ga0207656_107118272 | 3300025321 | Corn Rhizosphere | PTLLATMPQILDLCVTERSTKNGLGWIETDLMQKTMDITFATAKPEKPLAVADVFTNQFSSKIKP |
| Ga0207647_107842732 | 3300025904 | Corn Rhizosphere | GLGWIEPELMQKTMDITFATAKPDKPMALADVFTNEYSSRIKP |
| Ga0207705_109999312 | 3300025909 | Corn Rhizosphere | ATLLATMPAILDLCVTERSAKHGLGWIEPELMQKTIDITFATTKPDKPMVLADVFTNDYNSRIKP |
| Ga0207649_104879372 | 3300025920 | Corn Rhizosphere | PELMQKTIDITFATAKPDKPLALADVFTNEYSSRIKP |
| Ga0207650_112675621 | 3300025925 | Switchgrass Rhizosphere | CVTERSSKHGLGWIEPELMQKTMDITFATAKPDKPMVLADVFTNEYNSRIKP |
| Ga0207650_113574621 | 3300025925 | Switchgrass Rhizosphere | LMQKTMDITFATAKPDKPMALADVFTNEYSSRIKP |
| Ga0207690_105911941 | 3300025932 | Corn Rhizosphere | TLLATMPAILDLCVTERSSKHGLGWIEPELMQKTMDITFATAKPDKPIVLSEVFTNEYSSRIKP |
| Ga0207706_102252633 | 3300025933 | Corn Rhizosphere | ILDLCVTERSSKHGLGWIEPELMQKTIDITFATTKPDKPMVLADVFTNDYNSRIKP |
| Ga0207670_103325753 | 3300025936 | Switchgrass Rhizosphere | KYGMGWIETELMQKTMDITFANAKPEKALAVADVFTNQFSSKVKP |
| Ga0207669_107512352 | 3300025937 | Miscanthus Rhizosphere | TMPAILDLCVTERSSKHGLGWIEPELMQKTMDITFATAKPDKPMVLADVFTNEYSSRIKP |
| Ga0207704_112257831 | 3300025938 | Miscanthus Rhizosphere | AILDLCVTERSSKHGLGWIEPELMQKTMDITFATAKPDKPMALADVFTNEYSSRIKP |
| Ga0207691_109224232 | 3300025940 | Miscanthus Rhizosphere | RSSKHGLGWIEPELMQKTMDITFATAKPDKPMVLADVFTNEYSSRIKP |
| Ga0207691_111678161 | 3300025940 | Miscanthus Rhizosphere | RSSKHGLGWIEPELMQKTMDITFATAKPDKPMALADVFTNEYSSRIKP |
| Ga0207677_109151981 | 3300026023 | Miscanthus Rhizosphere | WIEPELMQKTMDITFATAKPDKPMALADVFTNEYSSRIKP |
| Ga0207677_118420281 | 3300026023 | Miscanthus Rhizosphere | MPAILDLCVTERSAKHGLGWIEPELMQKTIDVTFATTKPEKPLTLADVFTNEFNSRIKP |
| Ga0207678_119706131 | 3300026067 | Corn Rhizosphere | PELMQKTMDITFATAKPDKPMALADVFTNDYSSRIKP |
| Ga0209705_106261341 | 3300027979 | Freshwater Sediment | RSAKHGLGWIEPELMQKTMDITFANTKPDKAFAAADAFTNQFNSRIKP |
| Ga0268264_111503571 | 3300028381 | Switchgrass Rhizosphere | EPELMQKTMDITFATAKPDKPMVLADVFTNEYSSRIKP |
| Ga0247828_103367852 | 3300028587 | Soil | LATMPAILDLCVTERSAKHGLGWIEPELMQKTMDITFATAKPEKPMVLADVFTNEYSSRIKP |
| Ga0247822_116001221 | 3300028592 | Soil | ETDLMQKTMDITFASAKPEKPLAVADVFTNQFSSQVKP |
| Ga0247821_112694011 | 3300028596 | Soil | IEPELMQKTMDITFATAKPDKPMVLADVFSNEYSSRIKP |
| Ga0247820_107024082 | 3300028597 | Soil | SKYGLGWIEPELMQKTMDITFATAKPDKPMALADVFTNEYSSRIKP |
| Ga0247819_106251882 | 3300028608 | Soil | MPQILDLCVTERSAKHGLGWIEPELMQKTMDITFASNKPERAVELKDVFTNDFNSRIKP |
| Ga0247825_107393921 | 3300028812 | Soil | TMPQILDLCVTERSAKHGLGWIEPELMQKTMDITFASNKPERPVDVKDVFTNEFNSRIKP |
| Ga0247825_107640162 | 3300028812 | Soil | GWIEPELMQKTIDVTFATTKPEKPLTLADVFTNEFNSRIKP |
| Ga0247827_112372092 | 3300028889 | Soil | TERSAKHGLGWIEPELMQKTMDITFASNKPERSVDVKDVFTNDFNSRIKP |
| Ga0247826_102939821 | 3300030336 | Soil | PELMQKTMDITFATAKPDKPMVLADVFTNEYSSRIKP |
| Ga0310888_102141252 | 3300031538 | Soil | ATMPQILDLCVTERSAKHGMGWIEPELMQKTMDITFANAKPDKPVAVNDVFTNQFSSKVK |
| Ga0307408_1014524112 | 3300031548 | Rhizosphere | ERSAKHGMGWIEPELMQKTMDITFATAKPDKPMTLADVFTNEYNSRIKP |
| Ga0307405_100681841 | 3300031731 | Rhizosphere | TERSAKHGLGWIEPELMQKTMDITFASAKPDKPLNVNDVFTNQFNSKIKP |
| Ga0307405_110870072 | 3300031731 | Rhizosphere | GLGWIEPELMQKTMDITFASNKPEKPLVLNDTFTNQFSSKIKP |
| Ga0307468_1010620752 | 3300031740 | Hardwood Forest Soil | ILDLCVTERSSKYGLGWIEPELMQKTMDITFATAKPDKPMVLADVFTNEYNSRIKP |
| Ga0307410_112115012 | 3300031852 | Rhizosphere | LCVTERSAKHGMGWIEPELMQKTMDITFANNKPEKPVAVNDVFTNQFSSKVKP |
| Ga0307416_1023683382 | 3300032002 | Rhizosphere | LATMPQILDLCVTERSAKHGLGWIEPELMQKTMDITFANAKPDKPLNVNDVFTNQFNSKIKP |
| Ga0310902_102870143 | 3300032012 | Soil | TERSAKNGLGWIEADLMQKTMDITFASAKPEKPLAVADVFTNQFSSKIRP |
| Ga0308173_120526652 | 3300032074 | Soil | KHGLGWIEPELMQKTIDITFATTKPDKPLVLADVFTNEYSSRIKP |
| Ga0307415_1014052151 | 3300032126 | Rhizosphere | ATLLATMPQILDLCVTERSAKHGLGWIDQELMQKTMDITFASNKPEKPLVLNDTFTNQFSSKIKP |
| Ga0316603_121124581 | 3300033413 | Soil | AKHGLGWIEPELMQKTMDITFANAKPDKAFAAADAFTNQFSSRIKP |
| Ga0316629_100483103 | 3300033483 | Soil | PELMQKTMDITFANAKPDKAFAVADAFTNQFSSRIKP |
| Ga0247829_101264481 | 3300033550 | Soil | LMQKTMDITFASAKPEKPLAVADVFTNQFSSQVKP |
| Ga0247830_106593771 | 3300033551 | Soil | ATLLATMPQILDLCVTERSAKHGMGWIEPELMQKTMDITFANAKPEKPVALNDVFTNQFSSKVKP |
| Ga0370490_0331429_2_175 | 3300034128 | Untreated Peat Soil | QILDLCVTERSAKHGLGWIEPELMQKTMDITFATNKPEKAVAVNDVFTNQYNSKIKP |
| ⦗Top⦘ |