 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F103471 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 39 residues |
| Representative Sequence | LILVRLLLFLALAAIGVAAILYLYKRDRRYLRFIGQVI |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 43.56 % |
| % of genes near scaffold ends (potentially truncated) | 98.02 % |
| % of genes from short scaffolds (< 2000 bps) | 95.05 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (72.277 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere (6.931 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.604 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.535 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.52% β-sheet: 0.00% Coil/Unstructured: 48.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF03331 | LpxC | 94.06 |
| PF12327 | FtsZ_C | 4.95 |
| PF07517 | SecA_DEAD | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG0774 | UDP-3-O-acyl-N-acetylglucosamine deacetylase | Cell wall/membrane/envelope biogenesis [M] | 94.06 |
| COG0653 | Preprotein translocase subunit SecA (ATPase, RNA helicase) | Intracellular trafficking, secretion, and vesicular transport [U] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 72.28 % |
| All Organisms | root | All Organisms | 27.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 6.93% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.94% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.97% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.97% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.97% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.98% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.98% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.98% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.98% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.98% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.99% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.99% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.99% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.99% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.99% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.99% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.99% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.99% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.99% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.99% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005956 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_23-Sept-14 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010347 | AD_JPHGca | Engineered | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010412 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10 | Environmental | Open in IMG/M |
| 3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012885 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 | Environmental | Open in IMG/M |
| 3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014305 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D1 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026477 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PR5 | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300028770 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_4 | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062594_1013979391 | 3300005093 | Soil | MIIVRLLLFAALAAVGAAVLLWLVKRDPRYLRFIGLTLKFTVLLLLA |
| Ga0070680_1012301321 | 3300005336 | Corn Rhizosphere | MVIVRLLLFLALAAIGVALLLWFVQRDRRYLRFIGLTLKF |
| Ga0070669_1009173881 | 3300005353 | Switchgrass Rhizosphere | LVLVRMLLFLALAAIAGAGAAYLFKRDRRYLRFIWRVVQYT |
| Ga0070675_1008879642 | 3300005354 | Miscanthus Rhizosphere | VLIVRLLLFLSIGTIVIAGLFYLFKRDRRYLRFIVQVAKFTIFI |
| Ga0070708_1010517741 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VVLVRLLLFLALAAIAGAAALYLVKRDRRYLRFIGLVVVYTLLLS |
| Ga0070663_1015831112 | 3300005455 | Corn Rhizosphere | VIIVRLLLSLALAAIAVALLLYFLKRDRRYLRFIWQVAKFTFFVLLAT |
| Ga0070665_1011465421 | 3300005548 | Switchgrass Rhizosphere | MVIVRLLLFLALATVGVALLLYVFKRDRRYLRFIWQVAKFTLLVL |
| Ga0070665_1016723991 | 3300005548 | Switchgrass Rhizosphere | MLIVRLVLFLALGTIVVAALFYLFKRDRRYLRFIVLVAKFTVALL |
| Ga0068857_1002382601 | 3300005577 | Corn Rhizosphere | MIIVRLLLFAALAAVGAAVLLWLVKRDPRYLRFIGLTLKFTVL |
| Ga0068859_1012778102 | 3300005617 | Switchgrass Rhizosphere | VILVRLLLFLALAAIAVAAVMYIFSRDRRYLRFIWQ |
| Ga0068859_1026834481 | 3300005617 | Switchgrass Rhizosphere | VILVRLLLFLALAAIAVSALMYLYSKDRRYLRFIWQVL |
| Ga0068851_102244731 | 3300005834 | Corn Rhizosphere | VLIVRLLLFLSIGTIVVAGLFYLFKRDRRYLRFIV |
| Ga0068858_1018012791 | 3300005842 | Switchgrass Rhizosphere | VVLVRLLFFLAVAAIAVSGLLYLYKRDRRYLRFIGQVIKF |
| Ga0068860_1009372851 | 3300005843 | Switchgrass Rhizosphere | MVIVRLLLFLALATVGVALLLYVFKRDRRYLRFIWQ |
| Ga0073920_10264362 | 3300005956 | Sand | MVLVRLLLFFALATIAVAGFLYLIKRDRRYLRFIGQVV |
| Ga0097621_1003946752 | 3300006237 | Miscanthus Rhizosphere | VLIVRLLLFLSIGTIVVAGLFYLFNRDRRYLRFIVQVAKFTIFILV |
| Ga0068871_1012632321 | 3300006358 | Miscanthus Rhizosphere | VILVRLLLFLSLAAIGVSTLLYLYSKDRRYLRFIGQVL |
| Ga0079222_118633652 | 3300006755 | Agricultural Soil | VILVRLLLFAALATIGVAVLMWLVKRDPRYLRFIGLTLKF |
| Ga0066659_109187932 | 3300006797 | Soil | LVLVRLLLFFAFAAIAGAAVGYLVKRDRRYLRFIG |
| Ga0075434_1001660833 | 3300006871 | Populus Rhizosphere | LVLVRLLLFFAFAAIAGAAVLYLVKRDRRYLRFIGQV |
| Ga0079218_100778531 | 3300007004 | Agricultural Soil | LVIVRLLLFLSLAAIGGSLALYLFTRNRRYLTFVVQVLKFTL |
| Ga0075423_107625901 | 3300009162 | Populus Rhizosphere | VALVRLLLFSALAVIGVAGVLYLVKRDRRYLRFIGQIVKYTLLLLL |
| Ga0105248_132067421 | 3300009177 | Switchgrass Rhizosphere | VVLVRLLFFLALSAIAVSGLLYLYSKDRRYLRFIG |
| Ga0105238_111735701 | 3300009551 | Corn Rhizosphere | MILVRLLLFAALATMGAAVLMWLVKRDPRYLRFIGLTLKFTL |
| Ga0116238_107047411 | 3300010347 | Anaerobic Digestor Sludge | MAIVRLLLILGLALVAVALLLYAFTRDRRYLRFIRRVA |
| Ga0134125_106464961 | 3300010371 | Terrestrial Soil | LVLVRLLLFLALAAIAGAGVAYLFKRDRRYLRFIGRVIK |
| Ga0134126_120824231 | 3300010396 | Terrestrial Soil | MILVRLLLFLALAAIAVSLFLYMIKRDPRYLRFIWQVAKFTLL |
| Ga0134127_112699871 | 3300010399 | Terrestrial Soil | VILVRLLLFAALATIGVAVLMWLVKRDPRYLRFIGLTLK |
| Ga0134121_126142631 | 3300010401 | Terrestrial Soil | VILVRLLLFLALAAIAVAAVMYIFSRDRRYLRFIW |
| Ga0134121_128116632 | 3300010401 | Terrestrial Soil | MILVRLLLFAALATMGAAVLMWLVKRDPRYLRFIGLTLKFTLLVL |
| Ga0134123_132903152 | 3300010403 | Terrestrial Soil | VILVRLLLFLALAAIAVSALMYLFSKDRRYLRFIW |
| Ga0136852_114552841 | 3300010412 | Mangrove Sediment | MILVRFLLFLALAAIGVSAALYFFQRDRRYLVFIARVVKVTLVI |
| Ga0120114_10200751 | 3300011998 | Permafrost | LGLVRLLLFLALAAIAGAGAAYLVKRDPRYLRFIGRVIK |
| Ga0137380_102810913 | 3300012206 | Vadose Zone Soil | LALVRLLLVFAFATIAGAAALYLIKRDRRYLLFIGQVLKY |
| Ga0137378_100973342 | 3300012210 | Vadose Zone Soil | VVLVRLLLFLALAAVAAAAALYFVKRDRRYLRFIG* |
| Ga0157287_10912062 | 3300012885 | Soil | LILVRLLLFLSLAAIGVALLLWLVKRDRRYLRFIGLT |
| Ga0157309_101991791 | 3300012895 | Soil | LILVRLLLFLSLAAIGAALLMWLIKRDRRYLRFIGLTLK |
| Ga0137394_106045141 | 3300012922 | Vadose Zone Soil | LVVVRLLLFFAFAAIAGAAALYLMKRDRRYLRFIGQVVKYTL |
| Ga0164304_115375822 | 3300012986 | Soil | LILVRLLLFLSLAAIGAALLMWVIKRDRRYLRFIGLTLKF |
| Ga0157373_108621082 | 3300013100 | Corn Rhizosphere | LILVRLLLFLSLAAIAAALLMWLVKRDRRYLRFIW |
| Ga0163162_111963671 | 3300013306 | Switchgrass Rhizosphere | VLIVRLLLFLSIGTIVIAGLFYLFKRDRRYLRFIVQVAKFTIFIL |
| Ga0157375_127292711 | 3300013308 | Miscanthus Rhizosphere | VALVRLLFILAVAAIAVSALLYLFTKDRRYLRFIGLTVKL |
| Ga0075349_10455421 | 3300014305 | Natural And Restored Wetlands | MVIVRLLLFLSLATIAGSLLLYFLTRNRRYLQFIWQV |
| Ga0132258_122331061 | 3300015371 | Arabidopsis Rhizosphere | VILVRLLLFLALAAIAVAGVMYLFNKDRRYLRFIGQV |
| Ga0132257_1031984041 | 3300015373 | Arabidopsis Rhizosphere | LILVRLLLFLALAAIGAALLLWLVKRDRRYLRFIGLTLK |
| Ga0132255_1049384122 | 3300015374 | Arabidopsis Rhizosphere | VILVRLLLFLALAAIAVSAVMYLFTRDRRYLRFIW |
| Ga0132255_1055847141 | 3300015374 | Arabidopsis Rhizosphere | VVIVRLLLFLALATVAVALLLYVFSRDRRSLRFIWHVIKFTIIVLVCVLLL |
| Ga0182040_101379163 | 3300016387 | Soil | MPVVRLLLFLALISIGVALALYLIRRDRRYLRFVWQVVKFT |
| Ga0184626_102710861 | 3300018053 | Groundwater Sediment | LVLVRLLLFFAIAVIAGAAALYVVKRDRLYLRFIGQVVK |
| Ga0190270_134415231 | 3300018469 | Soil | MVIVRLLLFLALATIAVALLLYVFKRDRRYLRFIGQVIK |
| Ga0190271_118397451 | 3300018481 | Soil | VLIVRLLLFFSIATILVAALFYLFKRDRRYLRFIVQ |
| Ga0206356_102605501 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MIIVRLLLFAALAAVGAAVLLWLVKRDPRYLRFIGLTL |
| Ga0207656_104036392 | 3300025321 | Corn Rhizosphere | MLLFLALAAIAGAGVAYLFKRDRRYLRFIGRVIQYT |
| Ga0207656_105823741 | 3300025321 | Corn Rhizosphere | MILVRLLLFAALATMGAAVLMWLVKRDPRYLRFIGLTL |
| Ga0209584_101406582 | 3300025878 | Arctic Peat Soil | LILVRLLLFVALATIAGAGALYFYKRDRRYLRFIGQVIKFTILL |
| Ga0207692_102993901 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLFLALAAIAGAGAAYLFKRDRRYLRFIWRVVQYTILLL |
| Ga0207710_105715102 | 3300025900 | Switchgrass Rhizosphere | MVIVRLLLFLALATVGVALLLYVFKRDRRYLRGEAEDR |
| Ga0207680_109699792 | 3300025903 | Switchgrass Rhizosphere | MILVRLLLFLALATIGGALLLYLVKRDRRYLRFVW |
| Ga0207680_112905501 | 3300025903 | Switchgrass Rhizosphere | MLLFLALAAIAGAGAAYLFKRDRRYLRFIWRVVQYTILLLLGIL |
| Ga0207663_114607372 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VILVRLLLFAALATIGVAVLMWLVKRDPRYLRFIGLTLKFTVL |
| Ga0207660_109491372 | 3300025917 | Corn Rhizosphere | MVIVRLLLFLALAAIGVALLLWFVQRDRRYLRFIGLTLKFT |
| Ga0207700_104002182 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLFLALAAIAGAGAAYLFKRDRRYLRFIWRVVQYTILLLLA |
| Ga0207691_105676722 | 3300025940 | Miscanthus Rhizosphere | MVIVRLLLFLALATVGVALLLYVFKRDRRYLRFIWQVAK |
| Ga0207711_119436142 | 3300025941 | Switchgrass Rhizosphere | VVLVRLLFFLALSAIAVSGLLYLYSKDRRYLRFIGKVIKFT |
| Ga0207661_105389672 | 3300025944 | Corn Rhizosphere | LILVRLLLFLSLAAIGAALLMWLIKRDRRYLRFIGLTLKFT |
| Ga0207668_100324154 | 3300025972 | Switchgrass Rhizosphere | VLIVRLLLFLSIGTIVVAGLFYLFNRDRRYLRFIV |
| Ga0207658_120301551 | 3300025986 | Switchgrass Rhizosphere | LILVRLLLFLALAAIAVAAAMYLIKRDRSYLRFIGQVV |
| Ga0209469_11227361 | 3300026307 | Soil | LVLVRLLLFFAFAAIAGAAVGYLVKRDRRYLRFIGQ |
| Ga0256807_10148072 | 3300026477 | Sediment | MVIVRLLLFLSLATIAGSLLLYFFTRNRRYLQFIWQVAK |
| Ga0209157_12581882 | 3300026537 | Soil | MVLVRLLLFIALAVVAGALVMYLVKRDRRYLRFIGQ |
| Ga0209995_10599842 | 3300027471 | Arabidopsis Thaliana Rhizosphere | LILVRLLLFLSLAAIGVALLLWLVKRDRRYLRFIGL |
| Ga0209293_104078311 | 3300027877 | Wetland | MVIVRLLLFLSLATIAGALLLYLFTRNRGYLQFIWQVAKFTLV |
| Ga0209254_110382692 | 3300027897 | Freshwater Lake Sediment | MVLVRLLLFLSLATVAVAGFLYLIKRDRRYLRFIGQI |
| Ga0209048_106516532 | 3300027902 | Freshwater Lake Sediment | VILVRFLLFIALATIAGAALLYMFRRDRRYLRFIVQVVK |
| Ga0302258_10585141 | 3300028770 | Fen | VILVRFLLFLALATIAVAAIFYLFKKDRRYLRFIGQVV |
| Ga0302323_1002125131 | 3300031232 | Fen | VIVVRVLLFSALAAIAVALIMYVIKRDRRYLRFIG |
| Ga0306917_111159301 | 3300031719 | Soil | MPVVRLLLFLALISIGVALALYLIRRDRRYLRFVWQV |
| Ga0307405_100123985 | 3300031731 | Rhizosphere | LILVRLLLFLSLAAIGVALLLWLVNRDRRYLRFIGLTL |
| Ga0307468_1016417852 | 3300031740 | Hardwood Forest Soil | VILVRLLLFLALAAMAVSAVMYLFTKDRRYLRFIGQ |
| Ga0307410_101466423 | 3300031852 | Rhizosphere | MVIVRLLLFLSLSAIGVALLLYLFRRDRRYLTFVWTVFK |
| Ga0306925_104766921 | 3300031890 | Soil | LILVRLLLFLALAAIGVAAILYLYKRDRRYLRFIGQVI |
| Ga0310893_101978312 | 3300031892 | Soil | LILVRLLLFLSLAAIGVALLLWLFTRDRRYLRFIGLTL |
| Ga0302322_1035156281 | 3300031902 | Fen | VILVRFLLFLALATIVVAAVLFFFKKDRRYLRFIGQV |
| Ga0318531_102578241 | 3300031981 | Soil | MPVVRLLLFLALISIGVALALYLIRRDRRYLRFVWQVVKF |
| Ga0308176_116885331 | 3300031996 | Soil | LILVRLLLFLSLAAIGAALLMWLVKRDRRYLRFIG |
| Ga0308176_124334811 | 3300031996 | Soil | MIIVRLLLFAALASVGAAVLLWLVKRDPRYLRFIGLTLKFTVLLLLAIL |
| Ga0315278_103503403 | 3300031997 | Sediment | VILVRLLFFLAVGAIAVAGLLYLYSKDRRYLRFIGQT |
| Ga0315272_104647412 | 3300032018 | Sediment | VILVRLLFFLAIGAVAVAGVMYLYSKDRKYLRFIG |
| Ga0318524_103348512 | 3300032067 | Soil | LILVRLLLFLALAAIGVAAILYLYKRDRRYLRFIGQ |
| Ga0308173_107810372 | 3300032074 | Soil | MIIVRLLLFAALASVGAAVLLWLVKRDPRYLRFIGLTLKFTVLL |
| Ga0315277_111987541 | 3300032118 | Sediment | VILVRLLFFLAIGAVAVAGVLYLYSKDRRYLRFIGQTIKF |
| Ga0310895_100890361 | 3300032122 | Soil | LILVRLLLFLSLAAIGAALLMWLIKRDRRYLRFIGLT |
| Ga0315283_118439581 | 3300032164 | Sediment | VILVRFLLFLALATIVVAAILYLFKKERRYLRFIA |
| Ga0307471_1013081981 | 3300032180 | Hardwood Forest Soil | LVIVRLLLFLALASVAVALFLYLFKRDRRYLRFIWQVAKFTL |
| Ga0315271_106035701 | 3300032256 | Sediment | LILVRLLFFLAIAAIAVAGVLYLYSKDRRYLRFIGKVI |
| Ga0335085_120760112 | 3300032770 | Soil | VALVRVLLFVALACIAVALVLYAVKRDRRYLRFVLRV |
| Ga0316605_107527761 | 3300033408 | Soil | VVLVRLFLFLALAAIAVSGVLYLFKKDRRYLRFIG |
| Ga0316601_1007578171 | 3300033419 | Soil | VVLVRLFLFLALAAIAVSGVLYLLKRDRRYLRFIGRVI |
| Ga0316627_1014006732 | 3300033482 | Soil | LVLVRFLLFLALAAIVVAAVLYLFKRDRRYLKFIGQVVKYTIFLLAGV |
| Ga0316629_102086983 | 3300033483 | Soil | MVIVRLLLFLSLATIAGSLLLYFFTRNRRYLQFIWQV |
| Ga0316629_105862111 | 3300033483 | Soil | VILVRFLLFLSLATVVVSAVLYLFKRDRRYLRFIGQ |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |