NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F103446

Metagenome Family F103446

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F103446
Family Type Metagenome
Number of Sequences 101
Average Sequence Length 170 residues
Representative Sequence MNKPGNIPGRDPKFSLHSEWQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRKLQAKKLNLDKVFNDSTGKIRVEVMNGEGMSEFPGHPEDEITNAINDVTIRVSDSLRNAGIDLENRPNVIIRNRELPGDSIRHKKGNMVISMNESFSRTGDSTKDFIY
Number of Associated Samples 81
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.00 %
% of genes near scaffold ends (potentially truncated) 99.01 %
% of genes from short scaffolds (< 2000 bps) 95.05 %
Associated GOLD sequencing projects 76
AlphaFold2 3D model prediction Yes
3D model pTM-score0.19

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.010 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(25.743 % of family members)
Environment Ontology (ENVO) Unclassified
(40.594 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(41.584 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 42.00%    β-sheet: 0.00%    Coil/Unstructured: 58.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.19
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF09697Porph_ging 7.92
PF00072Response_reg 0.99
PF08495FIST 0.99
PF13924Lipocalin_5 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG3287FIST domain protein MJ1623, contains FIST_N and FIST_C domainsSignal transduction mechanisms [T] 0.99
COG4398Small ligand-binding sensory domain FISTSignal transduction mechanisms [T] 0.99


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.01 %
UnclassifiedrootN/A0.99 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000596|KanNP_Total_noBrdU_T14TCDRAFT_1024298All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae → Runella → Runella slithyformis661Open in IMG/M
3300004114|Ga0062593_101569965All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae713Open in IMG/M
3300004156|Ga0062589_101429509All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes676Open in IMG/M
3300004157|Ga0062590_100807140All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae864Open in IMG/M
3300005290|Ga0065712_10018038All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1724Open in IMG/M
3300005290|Ga0065712_10478609All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes660Open in IMG/M
3300005330|Ga0070690_100242026All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → Niastella koreensis1273Open in IMG/M
3300005330|Ga0070690_101528339All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes540Open in IMG/M
3300005331|Ga0070670_100468643All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1118Open in IMG/M
3300005331|Ga0070670_102136781All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → Niastella koreensis516Open in IMG/M
3300005353|Ga0070669_100389815All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1138Open in IMG/M
3300005355|Ga0070671_101827756All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes540Open in IMG/M
3300005364|Ga0070673_101376611All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes664Open in IMG/M
3300005365|Ga0070688_101098131All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → Niastella koreensis636Open in IMG/M
3300005367|Ga0070667_100193875All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1801Open in IMG/M
3300005456|Ga0070678_101572461All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → Niastella koreensis617Open in IMG/M
3300005543|Ga0070672_101852671All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → Niastella koreensis543Open in IMG/M
3300005545|Ga0070695_101727828All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → Niastella koreensis524Open in IMG/M
3300005578|Ga0068854_100554841All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae975Open in IMG/M
3300005617|Ga0068859_101113853All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes868Open in IMG/M
3300005719|Ga0068861_102665964All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → Niastella koreensis504Open in IMG/M
3300006237|Ga0097621_101745439All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niabella593Open in IMG/M
3300006844|Ga0075428_102215013All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niabella567Open in IMG/M
3300007004|Ga0079218_10195808All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niabella1536Open in IMG/M
3300007004|Ga0079218_10763727All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niabella921Open in IMG/M
3300007004|Ga0079218_12443302All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niabella616Open in IMG/M
3300009176|Ga0105242_11902045All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes635Open in IMG/M
3300010403|Ga0134123_12612017All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter petaseus572Open in IMG/M
3300011400|Ga0137312_1099182All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter petaseus516Open in IMG/M
3300012883|Ga0157281_1002902All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1518Open in IMG/M
3300012883|Ga0157281_1025319All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae783Open in IMG/M
3300012884|Ga0157300_1044322All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter petaseus680Open in IMG/M
3300012892|Ga0157294_10151152All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter petaseus645Open in IMG/M
3300012895|Ga0157309_10093678All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes821Open in IMG/M
3300012898|Ga0157293_10058859All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae880Open in IMG/M
3300012898|Ga0157293_10219086All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter petaseus585Open in IMG/M
3300012899|Ga0157299_10131263All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes686Open in IMG/M
3300012899|Ga0157299_10187030All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes614Open in IMG/M
3300012900|Ga0157292_10005454All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2592Open in IMG/M
3300012902|Ga0157291_10165234All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter petaseus671Open in IMG/M
3300012902|Ga0157291_10176416All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes658Open in IMG/M
3300012904|Ga0157282_10042154All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1076Open in IMG/M
3300012904|Ga0157282_10395970All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter petaseus516Open in IMG/M
3300012905|Ga0157296_10170788All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter petaseus669Open in IMG/M
3300012908|Ga0157286_10193593All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes681Open in IMG/M
3300012911|Ga0157301_10390952All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter petaseus536Open in IMG/M
3300012912|Ga0157306_10221904All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes649Open in IMG/M
3300012913|Ga0157298_10070861All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae866Open in IMG/M
3300013296|Ga0157374_12229625All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter petaseus575Open in IMG/M
3300013308|Ga0157375_13405739All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter petaseus530Open in IMG/M
3300014968|Ga0157379_11301688All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter petaseus702Open in IMG/M
3300015373|Ga0132257_103201529All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes596Open in IMG/M
3300015373|Ga0132257_104163105All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter petaseus526Open in IMG/M
3300015374|Ga0132255_103654154All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter petaseus654Open in IMG/M
3300015374|Ga0132255_105070531All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes558Open in IMG/M
3300017792|Ga0163161_11737815All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes553Open in IMG/M
3300018053|Ga0184626_10304316All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes661Open in IMG/M
3300018067|Ga0184611_1000430All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae7611Open in IMG/M
3300018067|Ga0184611_1355824All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter petaseus501Open in IMG/M
3300018073|Ga0184624_10258648All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter petaseus781Open in IMG/M
3300018083|Ga0184628_10667703All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes520Open in IMG/M
3300018476|Ga0190274_10987410All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae915Open in IMG/M
3300018476|Ga0190274_11364973All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae797Open in IMG/M
3300019356|Ga0173481_10198796All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae867Open in IMG/M
3300019361|Ga0173482_10258124All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae746Open in IMG/M
3300019362|Ga0173479_10084746All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1136Open in IMG/M
3300019362|Ga0173479_10275820All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter petaseus753Open in IMG/M
3300020009|Ga0193740_1034914All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes796Open in IMG/M
3300021510|Ga0222621_1044926All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes922Open in IMG/M
3300022883|Ga0247786_1024147All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1162Open in IMG/M
3300022893|Ga0247787_1020442All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae883Open in IMG/M
3300022901|Ga0247788_1064829All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter petaseus692Open in IMG/M
3300022908|Ga0247779_1149064All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter petaseus612Open in IMG/M
3300023062|Ga0247791_1075448All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter petaseus553Open in IMG/M
3300023069|Ga0247751_1000588All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3761Open in IMG/M
3300023077|Ga0247802_1022517All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae895Open in IMG/M
3300023263|Ga0247800_1035028All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae871Open in IMG/M
3300023266|Ga0247789_1046140All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae793Open in IMG/M
3300024055|Ga0247794_10323723All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter petaseus523Open in IMG/M
3300024055|Ga0247794_10350187All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → unclassified Niastella → Niastella sp. CF465505Open in IMG/M
3300025271|Ga0207666_1017158All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1043Open in IMG/M
3300025321|Ga0207656_10474688All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → unclassified Niastella → Niastella sp. CF465633Open in IMG/M
3300025923|Ga0207681_10395420All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1115Open in IMG/M
3300025925|Ga0207650_10078941All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2491Open in IMG/M
3300025925|Ga0207650_10784141All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes807Open in IMG/M
3300025925|Ga0207650_11283852All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes623Open in IMG/M
3300025934|Ga0207686_11819891All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → unclassified Niastella → Niastella sp.504Open in IMG/M
3300025938|Ga0207704_10231065All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1375Open in IMG/M
3300026121|Ga0207683_10452528All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1184Open in IMG/M
3300026142|Ga0207698_10637859All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1054Open in IMG/M
3300028381|Ga0268264_11722767All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → unclassified Niastella → Niastella sp.637Open in IMG/M
3300031547|Ga0310887_10360775All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes845Open in IMG/M
3300031547|Ga0310887_10971255All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter petaseus541Open in IMG/M
3300031562|Ga0310886_10748542All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter petaseus612Open in IMG/M
3300031908|Ga0310900_10408622All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1033Open in IMG/M
3300031913|Ga0310891_10135372All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes788Open in IMG/M
3300031944|Ga0310884_10516117All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter petaseus704Open in IMG/M
3300032012|Ga0310902_10163124All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1274Open in IMG/M
3300032012|Ga0310902_10847894All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter petaseus626Open in IMG/M
3300032179|Ga0310889_10641691All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes551Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil25.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil9.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere9.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil8.91%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.95%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.97%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.97%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.97%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere1.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.98%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.99%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.99%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.99%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.99%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.99%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.99%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.99%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000596Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA no BrdU F1.4TCEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011400Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2EnvironmentalOpen in IMG/M
3300012883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1EnvironmentalOpen in IMG/M
3300012884Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2EnvironmentalOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012902Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1EnvironmentalOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300020009Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s1EnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300022883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4EnvironmentalOpen in IMG/M
3300022893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S126-311R-4EnvironmentalOpen in IMG/M
3300022901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4EnvironmentalOpen in IMG/M
3300022908Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L221-509R-5EnvironmentalOpen in IMG/M
3300023062Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4EnvironmentalOpen in IMG/M
3300023069Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S049-202B-5EnvironmentalOpen in IMG/M
3300023077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6EnvironmentalOpen in IMG/M
3300023263Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6EnvironmentalOpen in IMG/M
3300023266Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025271Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KanNP_Total_noBrdU_T14TCDRAFT_102429813300000596SoilMNRSGNISASNPKLSLHNEWQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSNVVFKETVRKLQGKKLNLDKVFNDSAAAGKIRVEVMNGEAMPGFPGHPGDEIANAINDVTIRVSDSLRNAGIDLENRPGFIIKNKELPGDSMRHKKGNMVISMSESFSRTGDSN
Ga0062593_10156996523300004114SoilMNKPGNIPGRDPKFSLHSEWQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRKLQAKKLNLDKVFNDSTGKIRVEVMNGEPMPGFPGHPEDEITNAINDVTIRVSDSLRNAGIDLENRPNVIIRNRGLSDDSIRHKKGN
Ga0062589_10142950923300004156SoilMARSGNISVNDPKQRIHNEWQLLLMAIPILIIAGFQVFWIRENYIKEKKNLEFRSSVVFKETVRKLQAKKLNLDKVFNDSTGRLRVEVMNGQPMTGFPGHPEDDIANAINDVTIRVNDSLRNAGIILENKPNVIIRNKELPGDSMRHRKGNMVISMNESFSGTGDSTKNFMYERKGPPEEIFR
Ga0062590_10080714013300004157SoilMSSPRNISADNPKLRIHNEWQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSNVVFKETVRKLQAKKLNLDRIFNDSTGKIRVEMMNGEAMTGFPGHPEDEIANAINDVTIRVSDSLRKAELDLRNRPNVIIKNKELPADSMRYTKGNMVISMNESFSRTGDSNKNFRYERKGPPGEIFRFLYNVDSL
Ga0065712_1001803813300005290Miscanthus RhizosphereMNKPGNIPGRDPXXSLHSEWQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRKLQAKKLNLDKVFNDSTGKIRVEVMNGEPMPGFPGHPEDEITNAINDVTIRVSDSLRKAGIDLENRPNVIIRNRGLPGDSIRHKKGNMVISMNESFSRTGDSTKDFMYERKGPPGEIFKF
Ga0065712_1047860913300005290Miscanthus RhizosphereMNRPGNIPGRDPKLSLHSEWQLLLMTVPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRKLQAKKLNLDKVFNDSTGKIRVEVMNGDALSGFPGHPEDEITNAINDVTIRVSDSLRNAGMDLENRPNVIIRNRGLPGDSIRHKKGNMVISMNESFSRTGDSTKDFMYERKGPPGEIFKFLYNVDSL
Ga0070690_10024202613300005330Switchgrass RhizosphereMAKFVFQMKRHANISANNPKRSTHNEWQLLLMTIPILIIAGFQVFWLRENYIKEKKNLEFRSNVVFKETVRRLQGKKLNLDRVFNDSTGKVKIIMNDEAMPGLPGHPEDEIANAINDVTIRVNDSLRNAGIVLENRPNVIIRNKELPADSMRHKKGNMIISMNESFSRT
Ga0070690_10152833913300005330Switchgrass RhizosphereSHNEWQLLLMTIPILIIAGFQIFWLRENYIKEKKDLEFRSNVVFKETVRKLQGKKLNLGKVFNDSTSKVKVEIMNGEPGFPGHPEDEITNAINNVTIRVNDSLRNAGIVLEDRPNVIIRNKELPGDSMRHKKGNMIISMNESFSRKGDSTKDFLFERKGPPGEIFRFLYNVDSLQDSLR
Ga0070670_10046864313300005331Switchgrass RhizosphereMNRPGNIPGRDPKLSLHSEWQLLLMTVPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRKLQAKKLNLDKVFNDSTGKIRVEVMNGDALSGFPGHPEDEITNAINDVTIRVSDSLRNAGIDLENRPNVIIRNRGLPGDSIRHKKGNMVISMNESFSRT
Ga0070670_10213678113300005331Switchgrass RhizosphereRYLMAKFVFQMNRSGKISERNPKLNSHNEWQLLLMAIPILIIAGFQVFWLSENYSKEKKNLEFRSNVVFKETVRKLQAKKLNLDKVFNDSTGKIRVEVMNGEAMTGFPGHPEDEIANAINNVTIRVNDSLRNAGIVLENRPNVIIRNKELPGDSMRHRKGNMIISMNESFSR
Ga0070669_10038981513300005353Switchgrass RhizosphereMAKFVFQMKRHANISANNPKRSTHNEWQLLLMTIPILIIAGFQVFWLRENYIKEKKNLEFRSNVVFKETVRRLQGKKLNLDRVFNDSTGKVKIIMNDEAMPGLPGHPEDEIANAINDVTIRVNDSLRNAGIVLENRPNVIIRNKELPADSMRHKKGNMIISMNESFSR
Ga0070671_10182775613300005355Switchgrass RhizosphereRKSSSHNEWQLLLMAIPILVIVGFQVFWLRENYIKEKKDLEFRSNVVFKETVRKLQGKKLNLDRVFNDSTGKVKIIMNDEVMPGFPGHPEDEITNAINNVTIRVNDSLRNAGIVLENRPNVVIRNKEHPGDSMRRKKGNMVISMNESFSRTGDSTTDFLFERKGPPGEIFRFLYNVDSL
Ga0070673_10137661113300005364Switchgrass RhizosphereMNRPGNIPGRDPKLSLHSEWQLLLMTVPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRKLQAKKLNLDKVFNDSTGKIRVEVMNGDALSGFPGHPEDEITNAINDVTIRVSDSLRNAGMDLENRPNVIIRNRGLPGDSIRHKKGNMVISMNESFSRTGDSTKDF
Ga0070688_10109813113300005365Switchgrass RhizosphereMNRPGNIPGRDPKLSLHSEWQLLLMTVPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRRLQAKKLNLDKVFNDSIGKIRVDIMNDEPMSRFPSHPEDEIANAINNVTIRVNDSLRNAGIDLENRPNVIIRNRELPGDSIGHKKGNMVISMNESFSRTGDS
Ga0070667_10019387533300005367Switchgrass RhizosphereMAKFVYQMNRPRSISANNPKLSSHNEWQLLLMTIPILIIAGFQVFWLRENYIKEKKDLEFRSNVVFKETVRKLQGKKLNLGKVFNDSTSKVKVEIMNGEPGFPGHPEDEITNAINNVTIRVNDSLRNAGIVLEDRPNVIIRNKELPGDSMRHKKGNMIISM
Ga0070678_10157246113300005456Miscanthus RhizosphereMAKFVSQMKRSGNISVSSRKSSSLNEWQLLVMAIPILVIAGFQVFWLRENYIKEKKDLEFRSNVVFKETVRKLQGKKLNLGKVFNDSTSKIKVEVMNDRPGFPGHPDDEITNAINNVTIRVNDSLRNAGIVLEDRPNVIIRNKELPGDSMRHKKGNMIISMNESFSKTGDSTKDFLFERK
Ga0070672_10185267113300005543Miscanthus RhizosphereMNKPGNIPGRDPKFSLHSEWQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRKLQAKKLNLDKVFNDSTGKIRVEIMNGETMPGFSGHSEEDIANTINDVTIRVNDSLRSAGIDLEDRPNIIIRNREIPHDSMRRKKGK
Ga0070695_10172782813300005545Corn, Switchgrass And Miscanthus RhizosphereNEWQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRRLQAKKLNLDKVFNDSTGKIRVEVMNGEAMSGFPGHPEDEITNAINNVTIRVNDSLRNAGIDLENRPNVIIRNRGLPGDSIRHKKGNMVISMNESFSRTGDSTRDFMYERKGPPEEIFRFLYNVDSL
Ga0068854_10055484123300005578Corn RhizosphereMNRPGNIPGRDPKLSLHSEWQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRRLQAKKLNLDKVFNDSTGKIRVEVMNDEPMSGFPGHPEDEITNAINNVTIRVNDSLRNAGIDLENRPNVIIRNRGLPGDSIRHKKGNMVISMNESFSRTGDSTKDFMYERKGPPGEIFRFLYNVDSLQDSLRV
Ga0068859_10111385313300005617Switchgrass RhizosphereMSSPRNISASNPKRSTHNEWQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSNVVFKETVRKLQAKKLNLDKVFTDSTTKLRVDVINGEALPGFPGHPEDEMANAINDVTILVNDSLRKAGITLEKKPNVIIRNQKLPGDSTRLKKGNMVISMSESFSKTRDSNKNITFERKGPPGEFFRFLYNVDSLQDSL
Ga0068861_10266596413300005719Switchgrass RhizosphereMNRSGNISASNPKLSLHNEWQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSNVVFKETVRKLQGKKLNLDKVFNDSAAAGKIRVEVMNGEAMPGFPGHPGDEIANAINDVTIRVSDSLRNAGIDLENRPGFIIKNKELPGDSMRHKKGNMVISMSESFS
Ga0097621_10174543913300006237Miscanthus RhizosphereMNRSGKISARNPKLNSHNEWQLLLMAIPILIIAGFQVFWLSENYSKEKKNLEFRSNVVFKETVRKLQAKKLNLDKVFNDSTGKIRVEVMNGEAMTGFPGHPEDEIANAINNVTIRVNDSLRNAGIVLENRPNVIIRNKELPGDSMRHRKGNMIISMNESFSRTGDSSKDVMFERKGPPGEIFRFLYNVDSLQDSLRV
Ga0075428_10221501313300006844Populus RhizosphereMSSPRNISASSPKLRTHNEWQLLLMAVPILIIAGFQVFWLRENYIKERKNLEFRSSVVFKETVRKLQAKKLNLDKVFNDSAVTGKVRVEVMNGERLPGFAGHPEDDIASAINDVTIRVNDSLRNAGVVLENRPDVIIRNKELPGDSMRHRKGNMVISMRESFSKAGDSTKNFTYERKGPPGEI
Ga0079218_1019580833300007004Agricultural SoilMSRPGNISASHPKVSVHSEWQLLLMAVPILIIAGFQVFWLRENYIKEKSNLEFRSSVVFKETVRSLQAKKLNLDKVFNDSMGKIRVEVMNGEPIPGFPGHPEDEIANAINNVTIRVNDSLRNAGIDLENRPNVIIRNRELPGDSIRHK
Ga0079218_1076372723300007004Agricultural SoilMSKFVFQMNRPGNISVSNPKLGSHNEWHLLLMAIPILIIAGFQVFWLRENYTKEQKNLEFRSSVVFKETVRRLQAKKLNLDKVFNDSTGNIRVEVMNGEAMTGFPGHPEDEIANAINNVTIRVNDSLRNAGIDLENRPNVIIRNRELPGDSIRHKKGNMVISMNKSFSRTGDSTKDFMYERKGPPGEIFR
Ga0079218_1244330213300007004Agricultural SoilMAKFVFQMNRPGKISTSNPKFSSHNEWQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKEAVRKLQAKKLNLDKVFNDSTGKIRVEVMNGEAMSGFPGHPEDEIANAINNVTIRVNDSLRNAGIDLENRPNVIIRNREMPGDSMGRKKNMVISMSESFSRTGDSAKDFTFERKGPPGEIFRFLYNVD
Ga0105242_1190204523300009176Miscanthus RhizosphereMNRTGNIHSEGQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRRLQAKKLNLDKVFNDSTGKIRVEVMNDEPMSGFPGHPEDEITNAINNVTIRVNDSLRNAGIDLENRPNVIIRNRGLPGDSIRHKKGNMVISMNESFSRTGDSTRDFMYERKGPPEEIFRFL
Ga0134123_1261201713300010403Terrestrial SoilMTIPILIIAGFQGFWLRENYIKEKKDLEFRSNVVFKETVRKLQGKKLNLGKVFNDSTSKVKVEIMNGEPGFPGHPEDEITNAINNVTIRVNDSLRNAGIVLEDRPNVIIRNKELPGDSMRHKKGNMIISMNESFSKTGDSTKDFLFERKGPP
Ga0137312_109918213300011400SoilMSRPGNISASHPKVSVHSEWQLLLMAVPILIIAGFQVFWLRENYTKEQKNLEFRSSVVFKETVRKLQAKKLNLDKVFNDSIGKIRVEVMNGEAMTGFPVHPEDEIANALNNVTIRVSDSLRNAGIDLENRPNVIIRNRELAGDTMRRKKGDMVISMSESFTRT
Ga0157281_100290223300012883SoilMNRPGNIPGRDPKLSLHSEWQLLLMAVPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRRLQAKKLNLDKVFNDSIGKIRVEVMNDEPMSRFPGHPEEEIANAINNVTIRVNDSLRNAGIDLENRPNVIIRNRELPGDSIGHKKGNMVISMNESFSR
Ga0157281_102531923300012883SoilMSSPRNISADNPKLRIHNEWQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSNVVFKETVRKLQAKKLNLDRIFNDSTGKIRVEMMNGEAMTGFPGHPEDEIANAINDVTIRVSDSLRKAELDLRNRPNVIIKNKELPADSMRYTKG
Ga0157300_104432213300012884SoilMNRTGNIHSEGQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRRLQAKKLNLDKVFNDSIGKIRVEVMNDEPMSRFPSHPEDEIANAINNVTIRVNDSLRNAGIDLENRPNVIIRNRELPGDSIGHKKGNMVISMNESFSRTGDSTKDFMYERKGPP
Ga0157294_1015115213300012892SoilMNRPGNIPGGDSKLSLHSEWQLLLMAVPILIIAGFQVFWLRENYTKEKKNLEFRSSVVFKETVRKLQAKKLNLDKVFNDSTGKIRVEVMNGEAMTGFPGHPEDEIANAINNVTIRVNDSLRNAGIVLENRPNVIIRNKELPGDSMRHRKGNMIISMNESFSRAGDSSKDVMFERKGPPGEIFRFLYNVDSLQDSL
Ga0157309_1009367823300012895SoilMNRPGNIPGGDSKLSLHSEWQLLLMAVPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRRLQAKKLNLDKVFNDSIGKIRVEVMNDEPMSRFPGHPEDEIANAINNVTIRVNDSLRNAGIDLENRPNVIIRNRELPGDSIRHKKGDMVISMNESFSRTGDSTKDFKFERK
Ga0157293_1005885913300012898SoilMNRPGNIPGRDPKLSLHSEWQLLLMAVPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRKLQAKKLNLDKVFNDSTGKIRVEVMNGEPMPGFPGHPEDEITNAINDVTIRVSDSLRNAGIDLENRPNVIIRNRGLPGDSIRHKKGNM
Ga0157293_1021908613300012898SoilMAKFVFQMSRPGNISVSHPKVSVHSEWQLLLMAVPILIIAGFQVFWLRENYIKEKNNLEFRSSVVFKETVRRLQAKKLNLDKVFNDSIGKIRVEVMNGEPIPGFPGHPEDEIANAINNVTIRVNDSLRNAGIDLENRPNVIIRNRELPGDSIRHKKGDMVISMNESFSRTGDSTKDFKFERKGPPGEIFRFLYN
Ga0157299_1013126313300012899SoilMNRTGNIHNEGQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRRLQAKKLNLDKVFNDSIGKIRVDIMNDEPMSRFPSHPEDEIANAINNVTIRVNDSLRNAGIDLENRPNVIIRNRELPGDSIGHKKGNMVISMNESFSRTGDSTKDF
Ga0157299_1018703023300012899SoilMSSPRNISADNPKLRIHNEWQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSNVVFKETVRKLQAKKLNLDRIFNDSTGKIRVEMMNGEAMTGFPGHPEDEIANAINDVTIRVSDSLRNSELDLRNRPNVIIRNKELAGDSMRHKK
Ga0157292_1000545443300012900SoilMNKPGNIPGRDPKFSLHSEWQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRKLQAKKLNLDKVFNDSTGKIRVEVMNGEGMSEFPGHPEDEITNAINDVTIRVSDSLRNAGIDLENRPNVIIRNRELPGDSIRHKKGNMVISMNESFSRTGDSTKDFIY
Ga0157291_1016523413300012902SoilMAIPILIIAGFQVFWLRENYIKEKKNLEFRSNVVFKETVRKLQAKKLNLDRIFNDSTGKIRVEMMNGEAMTGFPGHPEDEIANAINDVTIRVNDSLRNAGIILENRPNVIVRNKELPGDSMRHKKGNMVISMSESFSRTGDSTKNFTYERKGP
Ga0157291_1017641613300012902SoilMNRTGNIHSEGQLLLMAIPILIIAGFQVFWLQENYIKEKKNLEFRTSVVFKETVRKLQAKKLNLDKVFTDSIGKVRVEVMNGEPMPGFQGHPEDEIANAINDVTIRVNDSLRNAGIVLENRPNVIIRNNELPGDTMRHKKGNMVISMSESF
Ga0157282_1004215413300012904SoilMSSPRNISADNPKLRIHNEWQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSNVVFKETVRKLQAKKLNLDRIFNDSTGKIRVEMMNGEAMTGFPGHPEDEIANAINDVTIRVSDSLRKAELDLRNRPNVIIKNKELPADSMRYTKGNMVISMNESFLR
Ga0157282_1039597013300012904SoilSEGQLLLMAIPILIIAGFQVFWLQENYIKEKKNLEFRTSVVFKETVRKLQAKKLNLDKVFTDSIGKVRVEVMNGEAIPAFPGHPEDEIANAINDVTIRVNDSLRNAGIVLENRPNVIIRNREMAGDTMRRKKGNMVISMSESFSKTRDSNKNITFERKGPPGEFFRFLYNV
Ga0157296_1017078813300012905SoilMNRTGNIHSEGQLLLMAIPILIIAGFQVFWLQENYIKEKKNLEFRSSVVFKETVRRLQAKKLNLDKVFNDSIGKIRVDIMNDEPMSRFPSHPEDEIANAINNVTIRVNDSLRNAGIDLENRPNVIIRNRELPGDSIGHKKGNMVISMNESFSRTGDSTKDFMFERKGPPGEIFRFLYNVDSLQGSLRVKEIDSACRIAFDKEGMNVPISILKDTNVNRR
Ga0157286_1019359323300012908SoilMSSPRNISADNPKLRIHNEWQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSNVVFKETVRKLQAKKLNLDRIFNDSTGKIRVEMMNGEAMTGFPGHPEDEIANAINDVTIRVSDSLRKAELDLRNRPNVIIKNKELPADSMRYTKGNMIISMNESFSKTGDS
Ga0157301_1039095213300012911SoilSLHSEWQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRKLQAKKLNLDKVFNDSTGKIRVEVMNGEPMPGFPGHPEDEITNAINDVTIRVSDSLRNAGIDLENRPNVIIRNRELPGDSIRHKKGNMVISMNESFSRTGDSTKNFMYERKGPPGEIFKFLYNVDSLQ
Ga0157306_1022190423300012912SoilMSSPRNISADNPKLRIHNEWQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSNVVFKETVRKLQAKKLNLDRIFNDSTGKIRVEMMNGEAMTGFPGHPEDEIANAINDVTIRVSDSLRKAELDLRNRPNVIIKNKELPADSMRYTKGNMVISMNESFSRTGDSNKNFRY
Ga0157298_1007086113300012913SoilMNRTGNIHSEGQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRKLQAKKLNLDKVFNDSTGKIRVEVMNGEGMSEFPGHPEDEITNAINDVTIRVNDSLRNAGIDLENRPNVIIRNRGLPGDSIRHKKGKMVISMNESFSRT
Ga0157374_1222962513300013296Miscanthus RhizosphereMAIPILIIAGFQVFWLRENYIKEKKNLEFRSNVVFKETVRKLQAKKLNLDKVFTDSTTKLRVDVINGEAMPGFPGHPEDEIASAINDVTILVNDSLRKAGITLEKRPNVIIRNQKLPGDSMRLKKGNMVISMNESFSKTRDSNKNITFERKGPPGEFFR
Ga0157375_1340573913300013308Miscanthus RhizosphereMAIPILVIAGFQVFWLRENYIKEKKDLEFRSNVVFKETVRKLQGKKLNLDRVFNDSTGKVKIIMNDEVMPGFPGHPEDEITNAINNVTIRVNDSLRNAGIVLENRPNAVIRNKEHPGDSMRRKKGNMVISMNESFSRTGDSTKDFLFERKGPPGEIFRFLYN
Ga0157379_1130168813300014968Switchgrass RhizosphereMAKFVFQMKRHANISANNPKRSTHNEWQLLLMTIPILIIAGFQVFWLRENYIKEKKNLEFRSNVVFKETVRRLQGKKLNLDRVFNDSTGKVKIIMNDEAMPGLPGHPEDEIANAINDVTIRVNDSLRNAGIVLENRPNVIIRNKELPADSMRHKKGNMIISMNESFSRTGDSSKNITFERKGPP
Ga0132257_10320152913300015373Arabidopsis RhizosphereMKKTGNISASNGKLSSHNEWQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSNVVFKETIRRLQGKKLNLDRVFNDSTGKVKIIMNDEAMPGFPGHPEDEIANAINDVTIRVNDSLRNAGIVLENRPNVIIRNKELPGDSMTHKKG
Ga0132257_10416310513300015373Arabidopsis RhizosphereMNSPRDISASSHKLGTHNEWQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSNVVFKETVRKLQARKLNLDKVFTDSTNKLRIDVMNGEAMPGFPGHPEDEIANAINDVTILVNDSLRNAGIDLKYRPNVIIKNKELPGDSLRHKKGNMVISMNESFSRTGDSSKNIMF
Ga0132255_10365415413300015374Arabidopsis RhizosphereMAIPILIIAGFQVFWLRENYIKEKKNLEFRSGVVFKETVRKLQAKKLNLDKVFNDSTGKVRIVMNGEGMPGFPGHPEDEITNAINDVTIRVNDSLRNAGIVLENRPNVIIRNKELPGDSMRHKKRNMVISMNESFSRRGDSTKDFLFERKGPPGEAFHFLYSLDSLQESLRVEEIDSACR
Ga0132255_10507053123300015374Arabidopsis RhizosphereMTIPILIIAGFQVFWLRENYIKEKKDLEFRSNVVFKETVRKLQGKKLNLDRVFNDSTGKVKIIMNDEVMPGFPGHPEDEITNAINNVTIRVNDSLRNAGIVLENRPNVVIRNKEHPGDSMRRKKGNMVISM
Ga0163161_1173781513300017792Switchgrass RhizosphereMAKFVFQMNRSGKISARNPKLNSHNEWQLLLMAIPILIIAGFQVFWLSENYSKEKKNLEFRSNVVFKETVRKLQAKKLNLDKVFNDSTGKIRVEVMNGEAMTGFPGHPEDEIANAINNVTIRVNDSLRNAGIVLENRPNVIIRNKELPGDS
Ga0184626_1030431623300018053Groundwater SedimentMSSPRNISTHNEWQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRTSVVFKETVRKLQAKKLNLDKVFTDSIGKVRVEVMNGGPMPGFPGHPEDEIANAINDVTIRVNDSLRNAGIVLENRPNIIIRNRELPPDSMRRKKGDMVISMNESFSRTGDSSKNLTFERTGPSGEIFRFLYNVDSLQDSLRIK
Ga0184611_100043013300018067Groundwater SedimentMSSPRNISTHNEWQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRTSVVFKETVRKLQAKKLNLDKVFTDSIGKVRVEVMNGGPMPGFPGHPEDEIANAINDVTIRVNDSLRNAGIVLENRPNVIIRNRELPPDSMRRKKGDMVISMNESFSRTGDSSKNLTFERKGPSGEIFRFLYNVDSLQDSLR
Ga0184611_135582413300018067Groundwater SedimentMNKPGNISGRDPKFSLHSEWQLLLMAVPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRKLQAKKLNLDKVFNDSTGKIRVEVMNDGEMNRFPGHPEDEITNAINNVTIRVSDSLRNAGIDLENRPNVIIRNRGLSDDSIRHKKGNMVISMNESF
Ga0184624_1025864813300018073Groundwater SedimentMNKPGNIPGRDPKFSLHSEWQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRKLQAKKLNLDKVFNDSTGKIRVEVMNGEPMPGFPGHPEDEITNAINDVTIRVSDSLRNAGIDLENRPNVIIRNRELPGDSIRHKKGNMVISMNESFSRTGDSTKDFMYERKGPPGEIFRFLYNVDSLQDS
Ga0184628_1066770323300018083Groundwater SedimentMSSPRNISTHNEWQLLLMAIPILIIAGFQVFWLRENYTKEQKNLEFRSSVVFKETVRKLQAKKLNLDKVFTDSIGKVRVEVMNGEGMPAFPGHPEDEIANAINDVTIRVNDSLRNAGIVLENRPNVIIRNREMAGDTMRREKGN
Ga0190274_1098741023300018476SoilMNKPGNIPGRDPKFSLHSEWQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRKLQAKKLNLDKVFNDSTGKIRVEVMNGEGMPGFSGHSEDEIANAINDVTIRVNDSLRNAGIVLENTPNVIIRNREMAGDTMRRKKGNMVISM
Ga0190274_1136497323300018476SoilMAIPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRKLQAKKLNLDKVFTDSIGKVRVEVMNGERMPGFPGHPEDEIANAINDVTIRVNDSLRNAGIDLENRPNVIIRNKELPGDSMRHRKGNMVISM
Ga0173481_1019879623300019356SoilMNRTGNIHSEGQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRRLQAKKLNLDKVFNDSIGKIRVEVMNDEPMSRFPSHPEDEIANAINNVTIRVNDSLRNAGIDLENRPNVIIRNRELPGDSIGHKKGNMVISMNESFSR
Ga0173482_1025812413300019361SoilMNRTGNIHSEGQLLLMAIPILIIAGFQVFWLRENYTKEKKNLEFRSSVVFKETVRKLQAKKLNLDKIFNDSAGRIRVEMMNGESMPGSPGHPEDEIANAINDVTIRVNDSLRNAGFEVDNTPNIIIRNREIPHDSMRHKKGQMVISMNE
Ga0173479_1008474623300019362SoilMNRTGNIHSEGQLLLMAIPILIIAGFQVFWLQENYIKEKKNLEFRSSVVFKETVRRLQAKKLNLDKVFNDSIGKIRVEVMNDEPMSRFPGHPEEEIANAINNVTIRVNDSLRNAGIDLENRPNVIIRNRELPGDSIGHKKGNMVISMNESFSRTGDSTKDFKFERKGPPGEIFR
Ga0173479_1027582013300019362SoilMSSSRNIPTSDPRVHTHSEGQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRKLQAKKLNLDKIFNDSAGKIRVEMMNGESMPGFPGHPEDEIANAINDVTIRVNDSLRNAGIEVENRPNIIIRNREIPHDSMRHKKGQMVISMNESFSRIADSTKKITYERKGPPGEIFRFLYNVDSLQDSLRVK
Ga0193740_103491413300020009SoilMAKFVFQMNRPGKISTSDPKFRSHNEWQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSNVVFKESVRRLQAKKLNLDKVFKDSTGKIRVEVMNGEAMTEFPGHPEDEIANAINNVTIRVNDSLRNAGIDLENRPNVIIRNREMQGDSMRRKKRNMVI
Ga0222621_104492613300021510Groundwater SedimentMAKFVFQMNRSGKISARNPKLNSHNEWQLLLMAIPILIIAGFQVFWLSENYSKEKKNLEFRSNVVFKETVRKLQAKKLNLDKVFNDSTGKIRVEVMNGEAMTGFPGHPEDEIANAINNVTIRVNDSLRNAGIVLENRPNVIIRNKELPGD
Ga0247786_102414713300022883SoilMNRTGNIHSEGQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRKLQAKKLNLDKVFNDSTGKIRVEVMNGEPMPRFPGHPEDEITNAINDVTIRVSDSLRNAGIDLENRPNVIIRNRGLPGDSIRHKKGNMVISMNESFSRTGDSTKDFMYERKGPLGEIFKF
Ga0247787_102044213300022893SoilMNRTGNIHSEGQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRRLQAKKLNLDKVFNDSIGKIRVDIMNDEPMSRFPSHPEDEIANAINNVTIRVNDSLRNAGIDLENRPNVIIRNRELPGDSIGHKKGNMVISMNESFSRT
Ga0247788_106482913300022901SoilMTSSRNIPESDPRVRTHSEGQLLLMAIPILIIAGFQVFWLRENYVKEKKNLEFRSSVVFKETVRKLQAKKLNLDKIFNDSAGKIRVEMMNGESMPGFPGHPEDEIANAINDVTIRVNDSLRNAGIEVENRPNIIIRNREIPHDSMRHKKGQMVISMNESFSRIADSTKNFTYERKGPPGEIFRFLYNVDSLQDSLRVK
Ga0247779_114906413300022908Plant LitterMNRTGNIHSEGQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRRLQAKKLNLDKVFNDSIGKIRVEVMNDEPMSRFPGHPEEEIANAINNVTIRVNDSLRNAGIDLENRPNVIIRNRELPGDSIRHKKGNMVISMNESFSRTGDSTKDFKFERKGPPGEIFRFLYNVDSLQDSLR
Ga0247791_107544813300023062SoilREKAAYRLAKFVFQMARSGNISVNDPKQRIHNEWQLLLMAIPILIIAGFQVFWIRENYIKEKKNLEFRSSVVFKETVRKLQAKKLNLDKVFNDSTGRLRVEVMNGQPMTGFPGHPEDDIANAINDVTIRVNDSLRNAGIILENKPNVIIRNKELPGDSMRHRKGNMVISMNESFSGTGDSTKN
Ga0247751_100058813300023069SoilMSSPRNISADNPKLRIHNEWQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSNVVFKETVRKLQAKKLNLDRIFNDSTGKIRVEMMNGEAMTGFPGHPEDEIANAINDVTIRVSDSLRKAELDLRNRPNVIIKNKELPADSMRYTKGNMVISMNQSFSRTGDSNKNFRYERKGPPGEIFRFLYNVDSLQDSLRVKE
Ga0247802_102251713300023077SoilMNRTGNIHSEGQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRRLQAKKLNLDKVFNDSIGKIRVDIMNDEPMSRFPSHPEDEIANAINNVTIRVNDSLRNAGIDLENRPNVIIRNRELPGDSIRHKKGNMVISMNESFSRTGDSTKDFMYERKGPPGEIF
Ga0247800_103502813300023263SoilMNRTGNIHSEGQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRKLQAKKLNLDKVFNDSTGRLRVEVMNGQPMTGFPGHPEDDIANAINDVTIRVNDSLRNAGIILENKPNVIIRNKELPGDSMRHRKGNMVISMNESFSGTGDSTKNFMYERKGPPEEIFRLLYNVDSLQD
Ga0247789_104614013300023266SoilMTSSRNIPESDPRVRTHSEGQLLLMAIPILIIAGFQVFWLRENYVKEKKNLEFRSSVVFKETVRKLQAKKLNLDKIFNDSAGKIRVEMMNGESMPGFPGHPEDEIANAINDVTIRVNDSLRNAGIEVENRPNIIIRNREIPHDSMRHKKGQMVISMNESFSRIA
Ga0247794_1032372313300024055SoilMNRTGNIHSEGQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRRLQAKKLNLDKVFNDSIGKIRVDIMNDEPMSRFPSHPEDEIANAINNVTIRVNDSLRNAGIDLENRPNVIIRNRELPGDSIRHKKGNM
Ga0247794_1035018713300024055SoilERNPKLNSHNEWQLLLMAIPILIIAGFQVFWLSENYSKEKKNLEFRSNVVFKETVRKLQAKKLNLDKVFNDSTGKIRVEVMNGEAMTGFPGHPEDEIANAINNVTIRVNDSLRNAGIVLENRPNVIIRNKELPGDSMRHRKGNMIISMNESFSRAGDSSKDVMFERKG
Ga0207666_101715813300025271Corn, Switchgrass And Miscanthus RhizosphereMAKFVFQMKRHANISANNPKRSTHNEWQLLLMTIPILIIAGFQVFWLRENYIKEKKNLEFRSNVVFKETVRRLQGKKLNLDRVFNDSTGKVKIIMNDEAMPGLPGHPEDEIANAINDVTIRVNDSLRNAGIVLENRPNVIIRNKELPADSMR
Ga0207656_1047468813300025321Corn RhizosphereMNRSGKISERNPKLNSHNEWQLLLMAIPILIIAGFQVFWLSENYSKEKKNLEFRSNVVFKETVRKLQAKKLNLDKVFNDSTGKIRVEVMNGEAMTGFPGHPEDEIANAINNVTIRVNDSLRNAGIVLENRPNVIIRNKELPGDSMRHKKGNMIISMNESFSRAGDSSKDVMFERKGPPGEIFRFLYNVDSL
Ga0207681_1039542023300025923Switchgrass RhizosphereMAKFVFQMKRHANISANNPKRSTHNEWQLLLMTIPILIIAGFQVFWLRENYIKEKKNLEFRSNVVFKETVRRLQGKKLNLDRVFNDSTGKVKIIMNDEAMPGLPGHPEDEIANAINDVTIRVNDSLRNAGIVLENRPNVIIRNKELPADSMRHKKGNMIISMNESFSRTGDSSKNITFERKGPPGEIFRFLY
Ga0207650_1007894113300025925Switchgrass RhizosphereMAKFVFQMNRSGKISERNPKLNSHNEWQLLLMAIPILIIAGFQVFWLSENYSKEKKNLEFRSNVVFKETVRKLQAKKLNLDKVFNDSTGKIRVEVMNGEAMTGFPGHPEDEIANAINNVTIRVNDSLRNAGIVLENRPNVIIRNKELPGDSMRHRKGNMIISMNESFSRAGDSSKDVMFE
Ga0207650_1078414123300025925Switchgrass RhizosphereMSSPRNISASNPKLRTHNEWQLLLMAIPIFIIAGFQVFWLRENYIKEKKNLEFRSNVVFKETVRKLQARKLTLDKVFTDSTTKLRVDVINGEALPGFPGHPEDEIANAINDVTILVNDSLRKAGITLEKRPNVIIRNQKLPGDSTRLKKGNMVISMSESFSRTGDSTKNLTFERKGPSGEIFRFLYNVD
Ga0207650_1128385223300025925Switchgrass RhizosphereMAKFVFQMKRHANISANNPKRSTHNEWQLLLMTIPILIIAGFQVFWLRENYIKEKKNLEFRSNVVFKETVRRLQGKKLNLDRVFNDSTGKVKIIMNDEAMPGLPGHPEDEIANAINDVTIRVNDSLRNAGIVLENRPNVIIRNKELPADSMRHKKGNMIISMNESFSRTGDSSKNI
Ga0207686_1181989113300025934Miscanthus RhizosphereKLNSHNEWQLLLMAIPILIIAGFQVFWLSENYSKEKKNLEFRSNVVFKETVRKLQAKKLNLDKVFNDSTGKIRVEVMNGEAMTGFPGHPEDEIANAINNVTIRVNDSLRNAGIVLENRPNVIIRNKELPGDSMRHRKGNMIISMNESFSRAGDSSKDVMFERKGPPGE
Ga0207704_1023106513300025938Miscanthus RhizosphereMAKFVFQMNRSGKISARNPKLNSHNEWQLLLMAIPILIIAGFQVFWLSENYSKEKKNLEFRSNVVFKETVRKLQAKKLNLDKVFNDSTGKIRVEVMNGEAMTGFPGHPEDEIANAINNVTIRVNDSLRNAGIVLENRPNVIIRNKELPGDSMRHRKGNMIISMNESFSRAGDSSKDVM
Ga0207712_1197775713300025961Switchgrass RhizosphereMAKFVFQMNRSGKISERNPKLNSHNEWQLLLMAIPILIIAGFQVFWLSENYSKEKKNLEFRSNVVFKETVRKLQAKKLNLDKVFNDSTGKIRVEVMNGEAMTGFPGHPEDEIANAINNVTIRVNDSLRNAGIVLENRPNVIIRNKELP
Ga0207683_1045252823300026121Miscanthus RhizosphereMAKFVFQMNRSGKISARNPKLNSHNEWQLLLMAIPILIIAGFQVFWLSENYSKEKKNLEFRSNVVFKETVRKLQAKKLNLDKVFNDSTGKIRVEVMNGEAMTGFPGHPEDEIANAINNVTIRVNDSLRNAGIVLENRPNVIIRNKELPGDSMRHRKGNMIISMNESFSRTGDSSKDV
Ga0207698_1063785913300026142Corn RhizosphereMAKFVFQMKRHANISANNPKRSTHNEWQLLLMTIPILIIAGFQVFWLRENYIKEKKNLEFRSNVVFKETVRRLQGKKLNLDRVFNDSTGKVKIIMNDEAMPGLPGHPEDEIANAINDVTIRVNDSLRNAGIVLENRPNVIIRNKELPADSMRHKKGNMIISMNESFSRTGDSSKNITFE
Ga0268264_1172276713300028381Switchgrass RhizosphereMAKFVFQMNRSGKISERNPKLNSHNEWQLLLMAIPILIIAGFQVFWLSENYSKEKKNLEFRSNVVFKETVRKLQAKKLNLDKVFNDSTGKIRVEVMNGEAMTGFPGHPEDEIANAINNVTIRVNDSLRNAGIVLENRPNVIIRNKELPGDSMRHRKGNMIISMNESFSRTGDSSK
Ga0310887_1036077523300031547SoilMNRPRNISVSNPKLSSHNEWQLLLMAIPILIIAGFQVFWLRENYIKEKKDLEFRSNVVFKETVRKLQGKKLNLGRVFNDSTAKVKVEIMNGEPGFPGHPEDEITNAINNVTIRVNDSLRNAGIVLEDRPNVIIRNKELPGDSMRHKKGNMIISMNESFSRKGDSTKDFLFERKGPSGEIFRFLYNVDSLQDS
Ga0310887_1097125513300031547SoilEGQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRRLQAKKLNLDKVFNDSIGKIRVDIMNDEPMSRFPSHPEDEIANAINNVTIRVNDSLRNAGIDLENRPNVIIRNRGLPGDSIRHKKGNMVISMNESFSRTGDSTKDFLFERKGPSGEIFRFLYNVDSLQDSLRV
Ga0310886_1074854213300031562SoilMNRTGNIHSEGQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRRLQAKKLNLDKVFNDSIGKIRVDIMNDEPMSRFPSHPEDEIANAINNVTIRVNDSLRNAGIDLENRPNVIIRNRELPGDSIGHKKGNMVISMNESFSRTG
Ga0310900_1040862223300031908SoilMNRTGNIHSEGQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRRLQAKKLNLDKVFNDSTGKIRVEVMNGETMPGFPGHPEDEIANAINNVTIRVNDSLRNAGIDLENRPNVIIRNRELPGDSIGHKKGNM
Ga0310891_1013537223300031913SoilMNRPRNISVSNPKLSSHNEWQLLLMAIPILIIAGFQVFWLRENYIKEKKDLEFRSNVLFKETVRKLQGKKLNLGRVFNDSTAKVKVEIMNGEPGFPGHPEDEITNAINNVTIRVNDSLRNAGIVLEDRPNVIIRNKDLPGDSMRHKKGKMIISMNESFSRTGDSTKDFLFERKGPSGEIF
Ga0310884_1051611713300031944SoilMNRPGNIPGRDPKLRLHSEWQLLLMAIPILIIAGFQVFWLRENYVKEKKNLEFRSSVVFKETVRKLQAKKLNLDKVFNDSTGKIRVEVMNGEPMPGFPGHPEDEITNAINDVTIRVSDSLRNAGIDLENRPNVIIRNRELPGDSIRHKKGNMVISMNESFSRTGDSTKDFMYERKGPPGEIFRFLYNVDS
Ga0310902_1016312413300032012SoilMNRTGNIHSEGQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRRLQAKKLNLDKVFNDSIGKIRVDIMNDEPMSRFPSHPEDEIANAINNVTIRVNDSLRNAGIDLENRPNVIIRNRELPGDSIGHKKGNMVISMNESFSRTGDSTKDFMFERKGPPGEIFRFLYNVDSLQGSLRVKEIDSACR
Ga0310902_1084789413300032012SoilMNKPGNIPGRDPKFSLHSEWQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRKLQAKKLNLDKVFNDSTGKIRVEVMNGEPMPGFPGHPEDEITNAINDVTIRVSDSLRNAGIDLENRPNVIIRNRGLPGDSIRHKKG
Ga0310889_1064169113300032179SoilMNRTGNIHSEGQLLLMAIPILIIAGFQVFWLRENYIKEKKNLEFRSSVVFKETVRRLQAKKLNLDKVFNDSTGKIRVEVMNDEPMSGFPGHPEDEITNAINNVTIRVNDSLRNAGIDLENRPNVIIRNRELPGDSIGHKKGNMVISM


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.