NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F103376

Metagenome / Metatranscriptome Family F103376

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F103376
Family Type Metagenome / Metatranscriptome
Number of Sequences 101
Average Sequence Length 44 residues
Representative Sequence DAGVLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI
Number of Associated Samples 96
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.01 %
% of genes from short scaffolds (< 2000 bps) 96.04 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction Yes
3D model pTM-score0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (84.158 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment
(11.881 % of family members)
Environment Ontology (ENVO) Unclassified
(37.624 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(40.594 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 41.79%    β-sheet: 0.00%    Coil/Unstructured: 58.21%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF00462Glutaredoxin 14.85
PF00887ACBP 14.85
PF00472RF-1 7.92
PF00498FHA 6.93
PF03007WES_acyltransf 4.95
PF13616Rotamase_3 3.96
PF07311Dodecin 3.96
PF028262-Hacid_dh_C 2.97
PF13515FUSC_2 1.98
PF02915Rubrerythrin 1.98
PF07973tRNA_SAD 1.98
PF13103TonB_2 1.98
PF00571CBS 1.98
PF03401TctC 1.98
PF01389OmpA_membrane 0.99
PF01906YbjQ_1 0.99
PF01878EVE 0.99
PF01258zf-dskA_traR 0.99
PF02803Thiolase_C 0.99
PF00211Guanylate_cyc 0.99
PF05762VWA_CoxE 0.99
PF01609DDE_Tnp_1 0.99
PF00080Sod_Cu 0.99
PF00375SDF 0.99
PF00903Glyoxalase 0.99
PF13472Lipase_GDSL_2 0.99
PF04138GtrA 0.99
PF02110HK 0.99
PF04392ABC_sub_bind 0.99
PF05402PqqD 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG4281Acyl-CoA-binding proteinLipid transport and metabolism [I] 14.85
COG0216Protein chain release factor RF1Translation, ribosomal structure and biogenesis [J] 7.92
COG1186Protein chain release factor PrfBTranslation, ribosomal structure and biogenesis [J] 7.92
COG4908Uncharacterized conserved protein, contains a NRPS condensation (elongation) domainGeneral function prediction only [R] 4.95
COG3360Flavin-binding protein dodecinGeneral function prediction only [R] 3.96
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 1.98
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.99
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.99
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.99
COG5421TransposaseMobilome: prophages, transposons [X] 0.99
COG3637Opacity protein LomR and related surface antigensCell wall/membrane/envelope biogenesis [M] 0.99
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.99
COG3293TransposaseMobilome: prophages, transposons [X] 0.99
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.99
COG0063NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate dehydratase domainNucleotide transport and metabolism [F] 0.99
COG2947Predicted RNA-binding protein, contains EVE domainGeneral function prediction only [R] 0.99
COG2885Outer membrane protein OmpA and related peptidoglycan-associated (lipo)proteinsCell wall/membrane/envelope biogenesis [M] 0.99
COG2145Hydroxyethylthiazole kinase, sugar kinase familyCoenzyme transport and metabolism [H] 0.99
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.99
COG2032Cu/Zn superoxide dismutaseInorganic ion transport and metabolism [P] 0.99
COG1734RNA polymerase-binding transcription factor DksATranscription [K] 0.99
COG1673Predicted RNA-binding protein, contains PUA-like EVE domainGeneral function prediction only [R] 0.99
COG0393Uncharacterized pentameric protein YbjQ, UPF0145 familyFunction unknown [S] 0.99
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 0.99

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.16 %
UnclassifiedrootN/A15.84 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004009|Ga0055437_10250290All Organisms → cellular organisms → Bacteria → Proteobacteria580Open in IMG/M
3300004479|Ga0062595_100088769All Organisms → cellular organisms → Bacteria → Proteobacteria1596Open in IMG/M
3300004778|Ga0062383_10137670All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae1083Open in IMG/M
3300005175|Ga0066673_10690609All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium588Open in IMG/M
3300005213|Ga0068998_10066906All Organisms → cellular organisms → Bacteria → Proteobacteria744Open in IMG/M
3300005337|Ga0070682_100450531All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria985Open in IMG/M
3300005338|Ga0068868_102304064All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria514Open in IMG/M
3300005341|Ga0070691_10250281All Organisms → cellular organisms → Bacteria950Open in IMG/M
3300005355|Ga0070671_101765235Not Available549Open in IMG/M
3300005367|Ga0070667_100972631All Organisms → cellular organisms → Bacteria → Proteobacteria791Open in IMG/M
3300005561|Ga0066699_10070662All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2220Open in IMG/M
3300005563|Ga0068855_101217951All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria782Open in IMG/M
3300005586|Ga0066691_10361622All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium860Open in IMG/M
3300005833|Ga0074472_10646456All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria600Open in IMG/M
3300005836|Ga0074470_11458641Not Available555Open in IMG/M
3300005840|Ga0068870_10165745All Organisms → cellular organisms → Bacteria1315Open in IMG/M
3300005841|Ga0068863_101261119All Organisms → cellular organisms → Bacteria → Proteobacteria745Open in IMG/M
3300005843|Ga0068860_100336664All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1483Open in IMG/M
3300006028|Ga0070717_12006568All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria521Open in IMG/M
3300006032|Ga0066696_10472633All Organisms → cellular organisms → Bacteria → Proteobacteria822Open in IMG/M
3300006354|Ga0075021_10244708All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis → Methyloversatilis universalis1103Open in IMG/M
3300006577|Ga0074050_11857740All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria512Open in IMG/M
3300006755|Ga0079222_11079088All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium702Open in IMG/M
3300006794|Ga0066658_10368826All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300006794|Ga0066658_10421883All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium725Open in IMG/M
3300006854|Ga0075425_100992917All Organisms → cellular organisms → Bacteria → Proteobacteria958Open in IMG/M
3300007076|Ga0075435_100300267All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales1373Open in IMG/M
3300009011|Ga0105251_10603282All Organisms → cellular organisms → Bacteria → Proteobacteria521Open in IMG/M
3300009111|Ga0115026_10772076All Organisms → cellular organisms → Bacteria → Proteobacteria748Open in IMG/M
3300009131|Ga0115027_10323025All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1048Open in IMG/M
3300009148|Ga0105243_10269799All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1527Open in IMG/M
3300009174|Ga0105241_10949364All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300009551|Ga0105238_10785130Not Available967Open in IMG/M
3300009553|Ga0105249_13110284Not Available533Open in IMG/M
3300010343|Ga0074044_10934834Not Available567Open in IMG/M
3300010371|Ga0134125_11559212All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria719Open in IMG/M
3300010375|Ga0105239_10467179All Organisms → cellular organisms → Bacteria1432Open in IMG/M
3300010401|Ga0134121_12796534Not Available534Open in IMG/M
3300012205|Ga0137362_10216481All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1651Open in IMG/M
3300012211|Ga0137377_11177468All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300012354|Ga0137366_10876475All Organisms → cellular organisms → Bacteria → Proteobacteria633Open in IMG/M
3300012357|Ga0137384_10205642All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1647Open in IMG/M
3300012469|Ga0150984_111576621All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300012957|Ga0164303_10940929Not Available609Open in IMG/M
3300012988|Ga0164306_10185265All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales1449Open in IMG/M
3300013296|Ga0157374_12592012All Organisms → cellular organisms → Bacteria → Proteobacteria535Open in IMG/M
3300013306|Ga0163162_10587509Not Available1240Open in IMG/M
3300014497|Ga0182008_10786494All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales551Open in IMG/M
3300015373|Ga0132257_102775507Not Available638Open in IMG/M
3300017792|Ga0163161_10452222All Organisms → cellular organisms → Bacteria → Proteobacteria1038Open in IMG/M
3300017965|Ga0190266_10229861Not Available913Open in IMG/M
3300017974|Ga0187777_10116528All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1765Open in IMG/M
3300018081|Ga0184625_10632920All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium520Open in IMG/M
3300018085|Ga0187772_11423750All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_64_23515Open in IMG/M
3300018482|Ga0066669_11368018All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium641Open in IMG/M
3300021346|Ga0210335_1260162All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales876Open in IMG/M
3300025914|Ga0207671_10811713All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria742Open in IMG/M
3300025928|Ga0207700_10288522All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1414Open in IMG/M
3300025932|Ga0207690_10249946All Organisms → cellular organisms → Bacteria1369Open in IMG/M
3300025932|Ga0207690_11310242Not Available605Open in IMG/M
3300025935|Ga0207709_10131485All Organisms → cellular organisms → Bacteria1706Open in IMG/M
3300025940|Ga0207691_10191172All Organisms → cellular organisms → Bacteria → Proteobacteria1785Open in IMG/M
3300025945|Ga0207679_11296935All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Noviherbaspirillum → unclassified Noviherbaspirillum → Noviherbaspirillum sp. Root189668Open in IMG/M
3300025960|Ga0207651_12143543Not Available502Open in IMG/M
3300025986|Ga0207658_12135476All Organisms → cellular organisms → Bacteria → Proteobacteria509Open in IMG/M
3300026095|Ga0207676_10077354All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2691Open in IMG/M
3300026121|Ga0207683_11184855All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium708Open in IMG/M
3300026316|Ga0209155_1223218All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium586Open in IMG/M
3300026527|Ga0209059_1138663All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300026550|Ga0209474_10457489All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300027824|Ga0209040_10257755All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300027899|Ga0209668_10605719All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae732Open in IMG/M
3300028381|Ga0268264_11132769All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae791Open in IMG/M
3300029980|Ga0302298_10223171All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria619Open in IMG/M
3300029989|Ga0311365_11214816All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria649Open in IMG/M
3300030019|Ga0311348_10463352All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium946Open in IMG/M
3300030114|Ga0311333_10333095Not Available1214Open in IMG/M
3300030294|Ga0311349_10196514All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1898Open in IMG/M
3300031726|Ga0302321_103272706All Organisms → cellular organisms → Bacteria → Proteobacteria528Open in IMG/M
3300031938|Ga0308175_102223762Not Available615Open in IMG/M
3300031997|Ga0315278_10375681All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1468Open in IMG/M
3300031997|Ga0315278_10494449All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1259Open in IMG/M
3300031997|Ga0315278_10518403All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1226Open in IMG/M
3300031999|Ga0315274_11903723All Organisms → cellular organisms → Bacteria → Proteobacteria540Open in IMG/M
3300032074|Ga0308173_11004659All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300032143|Ga0315292_10503555All Organisms → cellular organisms → Bacteria → Proteobacteria1020Open in IMG/M
3300032163|Ga0315281_11412122All Organisms → cellular organisms → Bacteria → Proteobacteria686Open in IMG/M
3300032164|Ga0315283_10316195All Organisms → cellular organisms → Bacteria → Proteobacteria1695Open in IMG/M
3300032173|Ga0315268_11102101All Organisms → cellular organisms → Bacteria → Proteobacteria802Open in IMG/M
3300032173|Ga0315268_11299332Not Available738Open in IMG/M
3300032180|Ga0307471_101743083All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium776Open in IMG/M
3300032275|Ga0315270_11140439Not Available518Open in IMG/M
3300032397|Ga0315287_11209429All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales869Open in IMG/M
3300032401|Ga0315275_11563337All Organisms → cellular organisms → Bacteria → Proteobacteria706Open in IMG/M
3300033413|Ga0316603_10049552All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium ADurb.Bin1003052Open in IMG/M
3300033418|Ga0316625_102618692All Organisms → cellular organisms → Bacteria → Proteobacteria512Open in IMG/M
3300033483|Ga0316629_11682221All Organisms → cellular organisms → Bacteria → Proteobacteria522Open in IMG/M
3300033486|Ga0316624_10712075All Organisms → cellular organisms → Bacteria → Proteobacteria884Open in IMG/M
3300033513|Ga0316628_100050222All Organisms → cellular organisms → Bacteria → Proteobacteria4321Open in IMG/M
3300033521|Ga0316616_100599520All Organisms → cellular organisms → Bacteria → Proteobacteria1293Open in IMG/M
3300034159|Ga0370509_0328909All Organisms → cellular organisms → Bacteria → Proteobacteria560Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment11.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.93%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.94%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen5.94%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.97%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.97%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.97%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland1.98%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.98%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.98%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.98%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.98%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.98%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.98%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.99%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.99%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.99%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.99%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.99%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.99%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.99%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.99%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.99%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.99%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.99%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.99%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.99%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.99%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.99%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004009Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3FreshEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005213Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005833Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBKEnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006577Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300021346Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.374 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026527Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300029980Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_3EnvironmentalOpen in IMG/M
3300029989III_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030019II_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300031999Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300033413Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCTEnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033483Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_AEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300034159Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_0210_18EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0055437_1025029013300004009Natural And Restored WetlandsADAAIVSRFETRPPAGLYGAPPGRQKAVIRDPELLRRLTI*
Ga0062595_10008876913300004479SoilGDQVSIAFDSRCADAGVLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI*
Ga0062383_1013767013300004778Wetland SedimentEVNVTFDKSCSDPAILARLETNPPAGLYGAPPGRQKALIKDPETLRRLTI*
Ga0066673_1069060913300005175SoilADAAVLSRFDSNPPAGLYGAPLSRQKSVIRDPATLKKLTT*
Ga0068998_1006690613300005213Natural And Restored WetlandsAQNCADPAILSRLETNPPAGLYGAPPDRQKALIKDPETLRRLAI*
Ga0070682_10045053113300005337Corn RhizosphereVSIAFDSRCADAGVLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI*
Ga0068868_10230406413300005338Miscanthus RhizosphereAMFGQPCLSLGRIAGEEVDVIFAKACTEPSVLSRLETNPPAGLYGAPPGRQKALIKDPETLRRLSI*
Ga0070691_1025028133300005341Corn, Switchgrass And Miscanthus RhizosphereGIAGDQVSIAFDRRCADAGVLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI*
Ga0070671_10176523513300005355Switchgrass RhizosphereRCADAGVLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI*
Ga0070667_10097263133300005367Switchgrass RhizosphereAGDQVSIAFDSRCADAGVLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI*
Ga0066699_1007066233300005561SoilVVFDKSCADPSVLGRLETNPPAGLYAAPPSRQRTVIKNPEMLRKLTV*
Ga0068855_10121795123300005563Corn RhizosphereDARCADAAVLSRLETNPPAGLYGAPPARLKTIVVNPDTRRKLTI*
Ga0066691_1036162213300005586SoilPSVLGRLETNPPAGLYGAPLSRQKTVIKNPEMLRKLTV*
Ga0074472_1064645623300005833Sediment (Intertidal)LNAKFGQTCLALGRTAGDEVNVTFDKSCGDPAILARLETNPPAGLYGAPPGRQKALIKDPETLRRLTI*
Ga0074470_1145864113300005836Sediment (Intertidal)ILSRFETNPPAGLYGAPPGRQKAVIRDPETLRRLTV*
Ga0068870_1016574533300005840Miscanthus RhizosphereVLSRLETNPPAGLYGAPLSRQKAVIKDPEALKKLMI*
Ga0068863_10126111913300005841Switchgrass RhizosphereVLSRLETNPPAGLYGAPPGRQKALIKDPETLRRLSI*
Ga0068860_10033666413300005843Switchgrass RhizosphereKACTEPSVLSRLETNPPAGLYGAPPGRQKALIKDPETLRRLSI*
Ga0070717_1200656823300006028Corn, Switchgrass And Miscanthus RhizosphereFDRRCADAGVLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI*
Ga0066696_1047263313300006032SoilVLNRLETNPPAGLYGAPLSRQKTVIKNPETLRKLTI*
Ga0075021_1024470823300006354WatershedsATSGETVTVTFDKGCADATVLSRFESNPPAGLYGAPLSRQKSVIKDPATLKKLTT*
Ga0074050_1185774013300006577SoilKGCAEASVLSRLETNPPAGLYAAPLPRQKALIKDPETLKRLSI*
Ga0079222_1107908823300006755Agricultural SoilALDKRCTEASVLNRLETNPPAGLYSAPPARQKTVIRNPDLLRKITI*
Ga0066658_1036882623300006794SoilLSRLETNPPAGLYGAPAARQKTVVKNPETLRKLMI*
Ga0066658_1042188323300006794SoilFDKSCADPSVLGRLETNPPAGLYGAPLSRQKTVIKNPEMLRKLTV*
Ga0075425_10099291713300006854Populus RhizosphereGLARNRLETNPPAGLYGAPPARQKAVIKNPEVLRKLVV*
Ga0075435_10030026713300007076Populus RhizosphereSILDKLETNPPAGLYGAPPGRQKTVIKNPETLRKLSI*
Ga0105251_1060328223300009011Switchgrass RhizosphereCFSLGRIAGEEVSVIFAKGCTEPSVLSRLETNPPAGLYGAPPGRQKALIKDPETLRRLSI
Ga0115026_1077207613300009111WetlandALSRLESNPPAGLYGAPPTRQKSVIRNPQTLSKLGVSA*
Ga0115027_1032302513300009131WetlandKFDPRCADPSVLSRLETNPPAGLYGAPPGRQKSVVKNPDTLRKLTTI*
Ga0105243_1026979933300009148Miscanthus RhizosphereLARLDTNPPASLYGAPAARQKAVIKNAETLKKLMI*
Ga0105241_1094936413300009174Corn RhizosphereGVLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI*
Ga0105238_1078513033300009551Corn RhizosphereSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI*
Ga0105249_1311028423300009553Switchgrass RhizosphereDAGVLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI*
Ga0074044_1093483423300010343Bog Forest SoilLAGVSGAEVSVVFDKRCAEPSVLNRFETNPPAGLYGAPPGRQKAVLKNPESLRKLSI*
Ga0134125_1155921213300010371Terrestrial SoilDQVSIAFDRRCADASVLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI*
Ga0105239_1046717943300010375Corn RhizosphereCFSVRGIAGDQVSIAFDRRCADAGVLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI
Ga0134121_1279653413300010401Terrestrial SoilLRARLETNPPAGLYRAPEGRRKAIIKNPEMLRKLV*
Ga0137362_1021648113300012205Vadose Zone SoilKRCAEASVLNRLETNPPAGLYGAPLSRQKTVIKNPEMLRRLTI*
Ga0137377_1117746833300012211Vadose Zone SoilSVLLRLETNPPAGLYGAPAGRQKTVVKNPETLRKLMI*
Ga0137366_1087647533300012354Vadose Zone SoilVTGDPVANKFDKSCADPSVLGRIETNPPAGLYGAPLSSQKTVIKNPEMLRKLTI*
Ga0137384_1020564223300012357Vadose Zone SoilAVSGERVSITFDKRCAEASVLNRLETNPPAGLYGAPLSRQKTVIKNPEMLRKLTI*
Ga0150984_11157662113300012469Avena Fatua RhizosphereRVSITFDASCADPSILGRLETNPPAGLYGAPLSRQKTVIKNPEMLRKLTV*
Ga0164303_1094092913300012957SoilRARFETNPPAALYGAPPARQKAIIKNPDTLRKLV*
Ga0164306_1018526513300012988SoilRVSIAFDSRCADAGVLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI*
Ga0157374_1259201223300013296Miscanthus RhizosphereSVLSRLETNPPAGLYGAPPGRQKALIKDPETLRRLSI*
Ga0163162_1058750923300013306Switchgrass RhizosphereDGPILSRLDTNLPAGLYSAPPGRQKDVISDPETLKKLTI*
Ga0182008_1078649423300014497RhizosphereARCADASVLSRLETNPPAGLYGAPPARLKAIVANPDTRKKLTI*
Ga0132257_10277550733300015373Arabidopsis RhizosphereLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI*
Ga0163161_1045222223300017792Switchgrass RhizosphereADAPILSRLDTNLPAGLYSAPPGRQKDVISDPETLKKLTI
Ga0190266_1022986113300017965SoilADATTRLETLPPAGLYGAPPARQRAVIRSADTLRKLTV
Ga0187777_1011652813300017974Tropical PeatlandVLNRLETNPPAGLYGAPPGRQKTVIRNPETLRKITL
Ga0184625_1063292013300018081Groundwater SedimentLNRLETNPPAGLYGAPPGRQKTVIKNPETLRKLSI
Ga0187772_1142375013300018085Tropical PeatlandIARFDTNPPAALYEAPPARQKWVLKDPEAVKKLSM
Ga0066669_1136801823300018482Grasslands SoilGTIAGERVAIVFDPRCADPSVLGRLETNPPAGLYGAPPSRQKTVIKNPEMLRKLTV
Ga0210335_126016233300021346EstuarineVTFDKSCGNPQILSRFETNPPAGLYGAPPGRQKALISDPETLRRLTI
Ga0207671_1081171313300025914Corn RhizosphereAGDQVSIAFDRRCADAGVLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI
Ga0207700_1028852223300025928Corn, Switchgrass And Miscanthus RhizosphereVLSRLETNPPAGLYAAPPARQKALIANPEARRKLMI
Ga0207690_1024994613300025932Corn RhizosphereAGVLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI
Ga0207690_1131024223300025932Corn RhizosphereQVSIAFDSRCADAGVLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI
Ga0207709_1013148543300025935Miscanthus RhizosphereLARLDTNPPASLYGAPAARQKAVIKNAETLKKLMI
Ga0207691_1019117243300025940Miscanthus RhizosphereIAGEEVDVIFAKACTEPSVLSRLETNPPAGLYGAPPGRQKALIKDPETLRRLSI
Ga0207679_1129693513300025945Corn RhizosphereARCADAAVLSRLETNPPAGLYGAPPARLKTIVVNPDTRRKLTI
Ga0207651_1214354313300025960Switchgrass RhizospherePGGRLETNPPAGLYGAPPARQKSIIKNPDTLRKLV
Ga0207658_1213547623300025986Switchgrass RhizosphereLSRFDTNPPAGLYGAPAPRQKALIKNPETLKQLSM
Ga0207676_1007735463300026095Switchgrass RhizosphereEVDVIFAKACTEPSVLSRLETNPPAGLYGAPPGRQKALIKDPETLRRLSI
Ga0207683_1118485523300026121Miscanthus RhizosphereGVASEQVTVVFDKSCSDASVMSRFETSPPAGLYSAPLPRQKAVIKDPETLRRVSI
Ga0209155_122321823300026316SoilDAAVLSRFDSNPPAGLYGAPLSRQKSVIRDPATLKKLTT
Ga0209059_113866313300026527SoilDTSILSRLETNPPAGLYGAPAGRQKTVVKNPETLRKLMI
Ga0209474_1045748933300026550SoilVLNRLETNPPAGLYGAPLSRQKTVIKNPETLRKLTI
Ga0209040_1025775513300027824Bog Forest SoilVLAGASGTEVSVVFDKRCADAAVLNRFETNPPAGLYGAPPGRQKAVLKNPEALRKLAT
Ga0209668_1060571933300027899Freshwater Lake SedimentFDKSCGDPAILARLETNPPAGLYGAPPGRQKALIKDPETLRRLTI
Ga0268264_1113276933300028381Switchgrass RhizosphereDQVSIAFDSRCADAGVLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI
Ga0302298_1022317113300029980FenTAGDEVGVVFDARCNDATVLGGLDTNPPAGLYGAPPGRQKAVVRNPETRKKLMI
Ga0311365_1121481623300029989FenDATVLGGLDTNPPAGLYGAPPGRQKAVVRNPETRKKLMI
Ga0311348_1046335223300030019FenDPAVLSRLESYPPAGLYGATPGRQKTVTRNPETLRKLTT
Ga0311333_1033309513300030114FenDEVGVVFDARCNDATVLGGLDTNPPAGLYGAPPGRQKAVVRNPETRKKLMI
Ga0311349_1019651433300030294FenVLSRLETNPPAALYGAPLSRQKAVIKDPEALKKLMI
Ga0302321_10327270623300031726FenRCGDAAILSRLETNPPAGLYGAPLARQRAVIKDPEVLKKLMI
Ga0308175_10222376223300031938SoilGQECFSVRGIAGDQVSIAFDRRCADAGVLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI
Ga0315278_1037568113300031997SedimentGQTCLALGRTAGDEVNVTFDKSCSDPAILARLETNPPAGLYGAPPDRQKALIKDPETLRRLTI
Ga0315278_1049444913300031997SedimentTGDEVSVIFDKNCGEPTILSRLETNPPAGLYGAPPSRQKALIKDPETLRRLTI
Ga0315278_1051840333300031997SedimentGEAAVLSRLETNPPAGLYGAPPGRQKAVLRDPETLRKLVI
Ga0315274_1190372313300031999SedimentCFSLGPIAGYEVNVVFAPNCTEPAILARLETNPPAGLYGAPTARQKALIKDPETLRRLVI
Ga0308173_1100465933300032074SoilVVSRLETNPPASLYNAPAQRQKAIVKNPDTLKKLLI
Ga0315292_1050355533300032143SedimentEILARLETNPPAGLYGAPPGRQKALIKDPETLRRLTI
Ga0315281_1141212213300032163SedimentAVLSRLETNPPAGLYGAPSGRQKAVIRDPETLRRLTI
Ga0315283_1031619513300032164SedimentGRIAGDEVNVNFDKNCGDPTILSRLETNPPAGLYGAPPSRQKALIKDPETLRRLTI
Ga0315268_1110210113300032173SedimentLGNVAGDQVSVTFDQQRCGDAAVLSRFETNPPAGLYGAPPGRKKAVIRDPETLRRLTI
Ga0315268_1129933213300032173SedimentAVLSRLETNPPAALYGAPLSRQKAVIKDPEALKKLMI
Ga0307471_10174308323300032180Hardwood Forest SoilNSAVLGRLESNPPAGLYGAPPQRQKSVIKDPGTLRKLST
Ga0315270_1114043923300032275SedimentAVVFDKQRCGDAAVLSRLETNPPAGLYGAPPGRQKAVIRDPEMLRRLTI
Ga0315287_1120942933300032397SedimentTFDKSCSDPAILARLETNPPAGLYGAPPDRQKALIKDPETLRRLTI
Ga0315275_1156333713300032401SedimentNVTFDKSCSDPAILARLETNPPAGLYGAPPGRQKALIKDPETLRRLTI
Ga0316603_1004955213300033413SoilVLSRLESNPPAGLYGASPTRQKSVIRNPQTLSKLGVSA
Ga0316625_10261869223300033418SoilDAGVLSRLESNPPAGLYGASPTRQKSVIRNPQTLSKLGVSA
Ga0316629_1168222113300033483SoilEVNVTFDKSCSDPAILARLETNPPAGLYGAPPGRQKALIKDPETLRRLTI
Ga0316624_1071207513300033486SoilDGLVRARLESNPPAGLYGAPPGRQKAVIKNPEMLRKLVV
Ga0316628_10005022283300033513SoilAFDARCADGLARGRLESNPPAGLYGAPPGRQKAVIKNPELLRKLVV
Ga0316616_10059952013300033521SoilSRLETNPPAALYGAPPARQKSVIRNPETLSKLGVTA
Ga0370509_0328909_1_1113300034159Untreated Peat SoilMGRFETAPPAGLYGAPPARQKSVIKNPETLKRITTI

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.