| Basic Information | |
|---|---|
| Family ID | F103376 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 44 residues |
| Representative Sequence | DAGVLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.01 % |
| % of genes from short scaffolds (< 2000 bps) | 96.04 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.158 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (11.881 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.624 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (40.594 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.79% β-sheet: 0.00% Coil/Unstructured: 58.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF00462 | Glutaredoxin | 14.85 |
| PF00887 | ACBP | 14.85 |
| PF00472 | RF-1 | 7.92 |
| PF00498 | FHA | 6.93 |
| PF03007 | WES_acyltransf | 4.95 |
| PF13616 | Rotamase_3 | 3.96 |
| PF07311 | Dodecin | 3.96 |
| PF02826 | 2-Hacid_dh_C | 2.97 |
| PF13515 | FUSC_2 | 1.98 |
| PF02915 | Rubrerythrin | 1.98 |
| PF07973 | tRNA_SAD | 1.98 |
| PF13103 | TonB_2 | 1.98 |
| PF00571 | CBS | 1.98 |
| PF03401 | TctC | 1.98 |
| PF01389 | OmpA_membrane | 0.99 |
| PF01906 | YbjQ_1 | 0.99 |
| PF01878 | EVE | 0.99 |
| PF01258 | zf-dskA_traR | 0.99 |
| PF02803 | Thiolase_C | 0.99 |
| PF00211 | Guanylate_cyc | 0.99 |
| PF05762 | VWA_CoxE | 0.99 |
| PF01609 | DDE_Tnp_1 | 0.99 |
| PF00080 | Sod_Cu | 0.99 |
| PF00375 | SDF | 0.99 |
| PF00903 | Glyoxalase | 0.99 |
| PF13472 | Lipase_GDSL_2 | 0.99 |
| PF04138 | GtrA | 0.99 |
| PF02110 | HK | 0.99 |
| PF04392 | ABC_sub_bind | 0.99 |
| PF05402 | PqqD | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG4281 | Acyl-CoA-binding protein | Lipid transport and metabolism [I] | 14.85 |
| COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 7.92 |
| COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 7.92 |
| COG4908 | Uncharacterized conserved protein, contains a NRPS condensation (elongation) domain | General function prediction only [R] | 4.95 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 3.96 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.98 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.99 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.99 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.99 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.99 |
| COG3637 | Opacity protein LomR and related surface antigens | Cell wall/membrane/envelope biogenesis [M] | 0.99 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.99 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.99 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.99 |
| COG0063 | NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate dehydratase domain | Nucleotide transport and metabolism [F] | 0.99 |
| COG2947 | Predicted RNA-binding protein, contains EVE domain | General function prediction only [R] | 0.99 |
| COG2885 | Outer membrane protein OmpA and related peptidoglycan-associated (lipo)proteins | Cell wall/membrane/envelope biogenesis [M] | 0.99 |
| COG2145 | Hydroxyethylthiazole kinase, sugar kinase family | Coenzyme transport and metabolism [H] | 0.99 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.99 |
| COG2032 | Cu/Zn superoxide dismutase | Inorganic ion transport and metabolism [P] | 0.99 |
| COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 0.99 |
| COG1673 | Predicted RNA-binding protein, contains PUA-like EVE domain | General function prediction only [R] | 0.99 |
| COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 0.99 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.16 % |
| Unclassified | root | N/A | 15.84 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004009|Ga0055437_10250290 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 580 | Open in IMG/M |
| 3300004479|Ga0062595_100088769 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1596 | Open in IMG/M |
| 3300004778|Ga0062383_10137670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 1083 | Open in IMG/M |
| 3300005175|Ga0066673_10690609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 588 | Open in IMG/M |
| 3300005213|Ga0068998_10066906 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 744 | Open in IMG/M |
| 3300005337|Ga0070682_100450531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 985 | Open in IMG/M |
| 3300005338|Ga0068868_102304064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 514 | Open in IMG/M |
| 3300005341|Ga0070691_10250281 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300005355|Ga0070671_101765235 | Not Available | 549 | Open in IMG/M |
| 3300005367|Ga0070667_100972631 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 791 | Open in IMG/M |
| 3300005561|Ga0066699_10070662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2220 | Open in IMG/M |
| 3300005563|Ga0068855_101217951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 782 | Open in IMG/M |
| 3300005586|Ga0066691_10361622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 860 | Open in IMG/M |
| 3300005833|Ga0074472_10646456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 600 | Open in IMG/M |
| 3300005836|Ga0074470_11458641 | Not Available | 555 | Open in IMG/M |
| 3300005840|Ga0068870_10165745 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
| 3300005841|Ga0068863_101261119 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 745 | Open in IMG/M |
| 3300005843|Ga0068860_100336664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1483 | Open in IMG/M |
| 3300006028|Ga0070717_12006568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 521 | Open in IMG/M |
| 3300006032|Ga0066696_10472633 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 822 | Open in IMG/M |
| 3300006354|Ga0075021_10244708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis → Methyloversatilis universalis | 1103 | Open in IMG/M |
| 3300006577|Ga0074050_11857740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 512 | Open in IMG/M |
| 3300006755|Ga0079222_11079088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 702 | Open in IMG/M |
| 3300006794|Ga0066658_10368826 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300006794|Ga0066658_10421883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 725 | Open in IMG/M |
| 3300006854|Ga0075425_100992917 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 958 | Open in IMG/M |
| 3300007076|Ga0075435_100300267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 1373 | Open in IMG/M |
| 3300009011|Ga0105251_10603282 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
| 3300009111|Ga0115026_10772076 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 748 | Open in IMG/M |
| 3300009131|Ga0115027_10323025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1048 | Open in IMG/M |
| 3300009148|Ga0105243_10269799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1527 | Open in IMG/M |
| 3300009174|Ga0105241_10949364 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300009551|Ga0105238_10785130 | Not Available | 967 | Open in IMG/M |
| 3300009553|Ga0105249_13110284 | Not Available | 533 | Open in IMG/M |
| 3300010343|Ga0074044_10934834 | Not Available | 567 | Open in IMG/M |
| 3300010371|Ga0134125_11559212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 719 | Open in IMG/M |
| 3300010375|Ga0105239_10467179 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
| 3300010401|Ga0134121_12796534 | Not Available | 534 | Open in IMG/M |
| 3300012205|Ga0137362_10216481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1651 | Open in IMG/M |
| 3300012211|Ga0137377_11177468 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300012354|Ga0137366_10876475 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 633 | Open in IMG/M |
| 3300012357|Ga0137384_10205642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1647 | Open in IMG/M |
| 3300012469|Ga0150984_111576621 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300012957|Ga0164303_10940929 | Not Available | 609 | Open in IMG/M |
| 3300012988|Ga0164306_10185265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 1449 | Open in IMG/M |
| 3300013296|Ga0157374_12592012 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300013306|Ga0163162_10587509 | Not Available | 1240 | Open in IMG/M |
| 3300014497|Ga0182008_10786494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 551 | Open in IMG/M |
| 3300015373|Ga0132257_102775507 | Not Available | 638 | Open in IMG/M |
| 3300017792|Ga0163161_10452222 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1038 | Open in IMG/M |
| 3300017965|Ga0190266_10229861 | Not Available | 913 | Open in IMG/M |
| 3300017974|Ga0187777_10116528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1765 | Open in IMG/M |
| 3300018081|Ga0184625_10632920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300018085|Ga0187772_11423750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_64_23 | 515 | Open in IMG/M |
| 3300018482|Ga0066669_11368018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 641 | Open in IMG/M |
| 3300021346|Ga0210335_1260162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 876 | Open in IMG/M |
| 3300025914|Ga0207671_10811713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 742 | Open in IMG/M |
| 3300025928|Ga0207700_10288522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1414 | Open in IMG/M |
| 3300025932|Ga0207690_10249946 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300025932|Ga0207690_11310242 | Not Available | 605 | Open in IMG/M |
| 3300025935|Ga0207709_10131485 | All Organisms → cellular organisms → Bacteria | 1706 | Open in IMG/M |
| 3300025940|Ga0207691_10191172 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1785 | Open in IMG/M |
| 3300025945|Ga0207679_11296935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Noviherbaspirillum → unclassified Noviherbaspirillum → Noviherbaspirillum sp. Root189 | 668 | Open in IMG/M |
| 3300025960|Ga0207651_12143543 | Not Available | 502 | Open in IMG/M |
| 3300025986|Ga0207658_12135476 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
| 3300026095|Ga0207676_10077354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2691 | Open in IMG/M |
| 3300026121|Ga0207683_11184855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 708 | Open in IMG/M |
| 3300026316|Ga0209155_1223218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300026527|Ga0209059_1138663 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300026550|Ga0209474_10457489 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300027824|Ga0209040_10257755 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300027899|Ga0209668_10605719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 732 | Open in IMG/M |
| 3300028381|Ga0268264_11132769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae | 791 | Open in IMG/M |
| 3300029980|Ga0302298_10223171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 619 | Open in IMG/M |
| 3300029989|Ga0311365_11214816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 649 | Open in IMG/M |
| 3300030019|Ga0311348_10463352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 946 | Open in IMG/M |
| 3300030114|Ga0311333_10333095 | Not Available | 1214 | Open in IMG/M |
| 3300030294|Ga0311349_10196514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1898 | Open in IMG/M |
| 3300031726|Ga0302321_103272706 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300031938|Ga0308175_102223762 | Not Available | 615 | Open in IMG/M |
| 3300031997|Ga0315278_10375681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1468 | Open in IMG/M |
| 3300031997|Ga0315278_10494449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1259 | Open in IMG/M |
| 3300031997|Ga0315278_10518403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1226 | Open in IMG/M |
| 3300031999|Ga0315274_11903723 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
| 3300032074|Ga0308173_11004659 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300032143|Ga0315292_10503555 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1020 | Open in IMG/M |
| 3300032163|Ga0315281_11412122 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 686 | Open in IMG/M |
| 3300032164|Ga0315283_10316195 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1695 | Open in IMG/M |
| 3300032173|Ga0315268_11102101 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 802 | Open in IMG/M |
| 3300032173|Ga0315268_11299332 | Not Available | 738 | Open in IMG/M |
| 3300032180|Ga0307471_101743083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 776 | Open in IMG/M |
| 3300032275|Ga0315270_11140439 | Not Available | 518 | Open in IMG/M |
| 3300032397|Ga0315287_11209429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 869 | Open in IMG/M |
| 3300032401|Ga0315275_11563337 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 706 | Open in IMG/M |
| 3300033413|Ga0316603_10049552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium ADurb.Bin100 | 3052 | Open in IMG/M |
| 3300033418|Ga0316625_102618692 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 512 | Open in IMG/M |
| 3300033483|Ga0316629_11682221 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
| 3300033486|Ga0316624_10712075 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 884 | Open in IMG/M |
| 3300033513|Ga0316628_100050222 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4321 | Open in IMG/M |
| 3300033521|Ga0316616_100599520 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1293 | Open in IMG/M |
| 3300034159|Ga0370509_0328909 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 560 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 11.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.93% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.94% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 5.94% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.97% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.97% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.98% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.98% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.98% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.98% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.98% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.98% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.99% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.99% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.99% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.99% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.99% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.99% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.99% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.99% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.99% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.99% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.99% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.99% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005213 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2 | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021346 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.374 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300029980 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_3 | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300034159 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_0210_18 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0055437_102502901 | 3300004009 | Natural And Restored Wetlands | ADAAIVSRFETRPPAGLYGAPPGRQKAVIRDPELLRRLTI* |
| Ga0062595_1000887691 | 3300004479 | Soil | GDQVSIAFDSRCADAGVLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI* |
| Ga0062383_101376701 | 3300004778 | Wetland Sediment | EVNVTFDKSCSDPAILARLETNPPAGLYGAPPGRQKALIKDPETLRRLTI* |
| Ga0066673_106906091 | 3300005175 | Soil | ADAAVLSRFDSNPPAGLYGAPLSRQKSVIRDPATLKKLTT* |
| Ga0068998_100669061 | 3300005213 | Natural And Restored Wetlands | AQNCADPAILSRLETNPPAGLYGAPPDRQKALIKDPETLRRLAI* |
| Ga0070682_1004505311 | 3300005337 | Corn Rhizosphere | VSIAFDSRCADAGVLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI* |
| Ga0068868_1023040641 | 3300005338 | Miscanthus Rhizosphere | AMFGQPCLSLGRIAGEEVDVIFAKACTEPSVLSRLETNPPAGLYGAPPGRQKALIKDPETLRRLSI* |
| Ga0070691_102502813 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | GIAGDQVSIAFDRRCADAGVLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI* |
| Ga0070671_1017652351 | 3300005355 | Switchgrass Rhizosphere | RCADAGVLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI* |
| Ga0070667_1009726313 | 3300005367 | Switchgrass Rhizosphere | AGDQVSIAFDSRCADAGVLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI* |
| Ga0066699_100706623 | 3300005561 | Soil | VVFDKSCADPSVLGRLETNPPAGLYAAPPSRQRTVIKNPEMLRKLTV* |
| Ga0068855_1012179512 | 3300005563 | Corn Rhizosphere | DARCADAAVLSRLETNPPAGLYGAPPARLKTIVVNPDTRRKLTI* |
| Ga0066691_103616221 | 3300005586 | Soil | PSVLGRLETNPPAGLYGAPLSRQKTVIKNPEMLRKLTV* |
| Ga0074472_106464562 | 3300005833 | Sediment (Intertidal) | LNAKFGQTCLALGRTAGDEVNVTFDKSCGDPAILARLETNPPAGLYGAPPGRQKALIKDPETLRRLTI* |
| Ga0074470_114586411 | 3300005836 | Sediment (Intertidal) | ILSRFETNPPAGLYGAPPGRQKAVIRDPETLRRLTV* |
| Ga0068870_101657453 | 3300005840 | Miscanthus Rhizosphere | VLSRLETNPPAGLYGAPLSRQKAVIKDPEALKKLMI* |
| Ga0068863_1012611191 | 3300005841 | Switchgrass Rhizosphere | VLSRLETNPPAGLYGAPPGRQKALIKDPETLRRLSI* |
| Ga0068860_1003366641 | 3300005843 | Switchgrass Rhizosphere | KACTEPSVLSRLETNPPAGLYGAPPGRQKALIKDPETLRRLSI* |
| Ga0070717_120065682 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | FDRRCADAGVLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI* |
| Ga0066696_104726331 | 3300006032 | Soil | VLNRLETNPPAGLYGAPLSRQKTVIKNPETLRKLTI* |
| Ga0075021_102447082 | 3300006354 | Watersheds | ATSGETVTVTFDKGCADATVLSRFESNPPAGLYGAPLSRQKSVIKDPATLKKLTT* |
| Ga0074050_118577401 | 3300006577 | Soil | KGCAEASVLSRLETNPPAGLYAAPLPRQKALIKDPETLKRLSI* |
| Ga0079222_110790882 | 3300006755 | Agricultural Soil | ALDKRCTEASVLNRLETNPPAGLYSAPPARQKTVIRNPDLLRKITI* |
| Ga0066658_103688262 | 3300006794 | Soil | LSRLETNPPAGLYGAPAARQKTVVKNPETLRKLMI* |
| Ga0066658_104218832 | 3300006794 | Soil | FDKSCADPSVLGRLETNPPAGLYGAPLSRQKTVIKNPEMLRKLTV* |
| Ga0075425_1009929171 | 3300006854 | Populus Rhizosphere | GLARNRLETNPPAGLYGAPPARQKAVIKNPEVLRKLVV* |
| Ga0075435_1003002671 | 3300007076 | Populus Rhizosphere | SILDKLETNPPAGLYGAPPGRQKTVIKNPETLRKLSI* |
| Ga0105251_106032822 | 3300009011 | Switchgrass Rhizosphere | CFSLGRIAGEEVSVIFAKGCTEPSVLSRLETNPPAGLYGAPPGRQKALIKDPETLRRLSI |
| Ga0115026_107720761 | 3300009111 | Wetland | ALSRLESNPPAGLYGAPPTRQKSVIRNPQTLSKLGVSA* |
| Ga0115027_103230251 | 3300009131 | Wetland | KFDPRCADPSVLSRLETNPPAGLYGAPPGRQKSVVKNPDTLRKLTTI* |
| Ga0105243_102697993 | 3300009148 | Miscanthus Rhizosphere | LARLDTNPPASLYGAPAARQKAVIKNAETLKKLMI* |
| Ga0105241_109493641 | 3300009174 | Corn Rhizosphere | GVLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI* |
| Ga0105238_107851303 | 3300009551 | Corn Rhizosphere | SRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI* |
| Ga0105249_131102842 | 3300009553 | Switchgrass Rhizosphere | DAGVLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI* |
| Ga0074044_109348342 | 3300010343 | Bog Forest Soil | LAGVSGAEVSVVFDKRCAEPSVLNRFETNPPAGLYGAPPGRQKAVLKNPESLRKLSI* |
| Ga0134125_115592121 | 3300010371 | Terrestrial Soil | DQVSIAFDRRCADASVLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI* |
| Ga0105239_104671794 | 3300010375 | Corn Rhizosphere | CFSVRGIAGDQVSIAFDRRCADAGVLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI |
| Ga0134121_127965341 | 3300010401 | Terrestrial Soil | LRARLETNPPAGLYRAPEGRRKAIIKNPEMLRKLV* |
| Ga0137362_102164811 | 3300012205 | Vadose Zone Soil | KRCAEASVLNRLETNPPAGLYGAPLSRQKTVIKNPEMLRRLTI* |
| Ga0137377_111774683 | 3300012211 | Vadose Zone Soil | SVLLRLETNPPAGLYGAPAGRQKTVVKNPETLRKLMI* |
| Ga0137366_108764753 | 3300012354 | Vadose Zone Soil | VTGDPVANKFDKSCADPSVLGRIETNPPAGLYGAPLSSQKTVIKNPEMLRKLTI* |
| Ga0137384_102056422 | 3300012357 | Vadose Zone Soil | AVSGERVSITFDKRCAEASVLNRLETNPPAGLYGAPLSRQKTVIKNPEMLRKLTI* |
| Ga0150984_1115766211 | 3300012469 | Avena Fatua Rhizosphere | RVSITFDASCADPSILGRLETNPPAGLYGAPLSRQKTVIKNPEMLRKLTV* |
| Ga0164303_109409291 | 3300012957 | Soil | RARFETNPPAALYGAPPARQKAIIKNPDTLRKLV* |
| Ga0164306_101852651 | 3300012988 | Soil | RVSIAFDSRCADAGVLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI* |
| Ga0157374_125920122 | 3300013296 | Miscanthus Rhizosphere | SVLSRLETNPPAGLYGAPPGRQKALIKDPETLRRLSI* |
| Ga0163162_105875092 | 3300013306 | Switchgrass Rhizosphere | DGPILSRLDTNLPAGLYSAPPGRQKDVISDPETLKKLTI* |
| Ga0182008_107864942 | 3300014497 | Rhizosphere | ARCADASVLSRLETNPPAGLYGAPPARLKAIVANPDTRKKLTI* |
| Ga0132257_1027755073 | 3300015373 | Arabidopsis Rhizosphere | LSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI* |
| Ga0163161_104522222 | 3300017792 | Switchgrass Rhizosphere | ADAPILSRLDTNLPAGLYSAPPGRQKDVISDPETLKKLTI |
| Ga0190266_102298611 | 3300017965 | Soil | ADATTRLETLPPAGLYGAPPARQRAVIRSADTLRKLTV |
| Ga0187777_101165281 | 3300017974 | Tropical Peatland | VLNRLETNPPAGLYGAPPGRQKTVIRNPETLRKITL |
| Ga0184625_106329201 | 3300018081 | Groundwater Sediment | LNRLETNPPAGLYGAPPGRQKTVIKNPETLRKLSI |
| Ga0187772_114237501 | 3300018085 | Tropical Peatland | IARFDTNPPAALYEAPPARQKWVLKDPEAVKKLSM |
| Ga0066669_113680182 | 3300018482 | Grasslands Soil | GTIAGERVAIVFDPRCADPSVLGRLETNPPAGLYGAPPSRQKTVIKNPEMLRKLTV |
| Ga0210335_12601623 | 3300021346 | Estuarine | VTFDKSCGNPQILSRFETNPPAGLYGAPPGRQKALISDPETLRRLTI |
| Ga0207671_108117131 | 3300025914 | Corn Rhizosphere | AGDQVSIAFDRRCADAGVLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI |
| Ga0207700_102885222 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VLSRLETNPPAGLYAAPPARQKALIANPEARRKLMI |
| Ga0207690_102499461 | 3300025932 | Corn Rhizosphere | AGVLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI |
| Ga0207690_113102422 | 3300025932 | Corn Rhizosphere | QVSIAFDSRCADAGVLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI |
| Ga0207709_101314854 | 3300025935 | Miscanthus Rhizosphere | LARLDTNPPASLYGAPAARQKAVIKNAETLKKLMI |
| Ga0207691_101911724 | 3300025940 | Miscanthus Rhizosphere | IAGEEVDVIFAKACTEPSVLSRLETNPPAGLYGAPPGRQKALIKDPETLRRLSI |
| Ga0207679_112969351 | 3300025945 | Corn Rhizosphere | ARCADAAVLSRLETNPPAGLYGAPPARLKTIVVNPDTRRKLTI |
| Ga0207651_121435431 | 3300025960 | Switchgrass Rhizosphere | PGGRLETNPPAGLYGAPPARQKSIIKNPDTLRKLV |
| Ga0207658_121354762 | 3300025986 | Switchgrass Rhizosphere | LSRFDTNPPAGLYGAPAPRQKALIKNPETLKQLSM |
| Ga0207676_100773546 | 3300026095 | Switchgrass Rhizosphere | EVDVIFAKACTEPSVLSRLETNPPAGLYGAPPGRQKALIKDPETLRRLSI |
| Ga0207683_111848552 | 3300026121 | Miscanthus Rhizosphere | GVASEQVTVVFDKSCSDASVMSRFETSPPAGLYSAPLPRQKAVIKDPETLRRVSI |
| Ga0209155_12232182 | 3300026316 | Soil | DAAVLSRFDSNPPAGLYGAPLSRQKSVIRDPATLKKLTT |
| Ga0209059_11386631 | 3300026527 | Soil | DTSILSRLETNPPAGLYGAPAGRQKTVVKNPETLRKLMI |
| Ga0209474_104574893 | 3300026550 | Soil | VLNRLETNPPAGLYGAPLSRQKTVIKNPETLRKLTI |
| Ga0209040_102577551 | 3300027824 | Bog Forest Soil | VLAGASGTEVSVVFDKRCADAAVLNRFETNPPAGLYGAPPGRQKAVLKNPEALRKLAT |
| Ga0209668_106057193 | 3300027899 | Freshwater Lake Sediment | FDKSCGDPAILARLETNPPAGLYGAPPGRQKALIKDPETLRRLTI |
| Ga0268264_111327693 | 3300028381 | Switchgrass Rhizosphere | DQVSIAFDSRCADAGVLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI |
| Ga0302298_102231711 | 3300029980 | Fen | TAGDEVGVVFDARCNDATVLGGLDTNPPAGLYGAPPGRQKAVVRNPETRKKLMI |
| Ga0311365_112148162 | 3300029989 | Fen | DATVLGGLDTNPPAGLYGAPPGRQKAVVRNPETRKKLMI |
| Ga0311348_104633522 | 3300030019 | Fen | DPAVLSRLESYPPAGLYGATPGRQKTVTRNPETLRKLTT |
| Ga0311333_103330951 | 3300030114 | Fen | DEVGVVFDARCNDATVLGGLDTNPPAGLYGAPPGRQKAVVRNPETRKKLMI |
| Ga0311349_101965143 | 3300030294 | Fen | VLSRLETNPPAALYGAPLSRQKAVIKDPEALKKLMI |
| Ga0302321_1032727062 | 3300031726 | Fen | RCGDAAILSRLETNPPAGLYGAPLARQRAVIKDPEVLKKLMI |
| Ga0308175_1022237622 | 3300031938 | Soil | GQECFSVRGIAGDQVSIAFDRRCADAGVLSRLETNPPAGLYGAPPGRQRTVVKDPELLRKLTI |
| Ga0315278_103756811 | 3300031997 | Sediment | GQTCLALGRTAGDEVNVTFDKSCSDPAILARLETNPPAGLYGAPPDRQKALIKDPETLRRLTI |
| Ga0315278_104944491 | 3300031997 | Sediment | TGDEVSVIFDKNCGEPTILSRLETNPPAGLYGAPPSRQKALIKDPETLRRLTI |
| Ga0315278_105184033 | 3300031997 | Sediment | GEAAVLSRLETNPPAGLYGAPPGRQKAVLRDPETLRKLVI |
| Ga0315274_119037231 | 3300031999 | Sediment | CFSLGPIAGYEVNVVFAPNCTEPAILARLETNPPAGLYGAPTARQKALIKDPETLRRLVI |
| Ga0308173_110046593 | 3300032074 | Soil | VVSRLETNPPASLYNAPAQRQKAIVKNPDTLKKLLI |
| Ga0315292_105035553 | 3300032143 | Sediment | EILARLETNPPAGLYGAPPGRQKALIKDPETLRRLTI |
| Ga0315281_114121221 | 3300032163 | Sediment | AVLSRLETNPPAGLYGAPSGRQKAVIRDPETLRRLTI |
| Ga0315283_103161951 | 3300032164 | Sediment | GRIAGDEVNVNFDKNCGDPTILSRLETNPPAGLYGAPPSRQKALIKDPETLRRLTI |
| Ga0315268_111021011 | 3300032173 | Sediment | LGNVAGDQVSVTFDQQRCGDAAVLSRFETNPPAGLYGAPPGRKKAVIRDPETLRRLTI |
| Ga0315268_112993321 | 3300032173 | Sediment | AVLSRLETNPPAALYGAPLSRQKAVIKDPEALKKLMI |
| Ga0307471_1017430832 | 3300032180 | Hardwood Forest Soil | NSAVLGRLESNPPAGLYGAPPQRQKSVIKDPGTLRKLST |
| Ga0315270_111404392 | 3300032275 | Sediment | AVVFDKQRCGDAAVLSRLETNPPAGLYGAPPGRQKAVIRDPEMLRRLTI |
| Ga0315287_112094293 | 3300032397 | Sediment | TFDKSCSDPAILARLETNPPAGLYGAPPDRQKALIKDPETLRRLTI |
| Ga0315275_115633371 | 3300032401 | Sediment | NVTFDKSCSDPAILARLETNPPAGLYGAPPGRQKALIKDPETLRRLTI |
| Ga0316603_100495521 | 3300033413 | Soil | VLSRLESNPPAGLYGASPTRQKSVIRNPQTLSKLGVSA |
| Ga0316625_1026186922 | 3300033418 | Soil | DAGVLSRLESNPPAGLYGASPTRQKSVIRNPQTLSKLGVSA |
| Ga0316629_116822211 | 3300033483 | Soil | EVNVTFDKSCSDPAILARLETNPPAGLYGAPPGRQKALIKDPETLRRLTI |
| Ga0316624_107120751 | 3300033486 | Soil | DGLVRARLESNPPAGLYGAPPGRQKAVIKNPEMLRKLVV |
| Ga0316628_1000502228 | 3300033513 | Soil | AFDARCADGLARGRLESNPPAGLYGAPPGRQKAVIKNPELLRKLVV |
| Ga0316616_1005995201 | 3300033521 | Soil | SRLETNPPAALYGAPPARQKSVIRNPETLSKLGVTA |
| Ga0370509_0328909_1_111 | 3300034159 | Untreated Peat Soil | MGRFETAPPAGLYGAPPARQKSVIKNPETLKRITTI |
| ⦗Top⦘ |